BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO48823.1 dred0 ABO48823.1 GIB00494CH01 "acetylornithine
aminotransferase"
         (396 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2e54A [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE                        369   e-105
2ordA [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE                        349   7e-99
2eh6A [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE                        326   8e-92
2pb0B [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE                 316   8e-89
2pb2A [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE                 308   1e-86
2pb0A [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE                 306   7e-86
2pb2B [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE                 305   2e-85
1vefA [x.x.x] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE          238   2e-65
2byjA [x.x.x] ORNITHINE AMINOTRANSFERASE                              233   9e-64
2oatA [c.67.1] ORNITHINE AMINOTRANSFERASE                             231   4e-63
1gbnA [c.67.1] ORNITHINE AMINOTRANSFERASE                             231   4e-63
2bylA [x.x.x] ORNITHINE AMINOTRANSFERASE                              228   2e-62
1z7dB [x.x.x] ORNITHINE AMINOTRANSFERASE                              216   1e-58
1z7dE [x.x.x] ORNITHINE AMINOTRANSFERASE                              215   2e-58
1z7dA [x.x.x] ORNITHINE AMINOTRANSFERASE                              215   2e-58
1z7dD [x.x.x] ORNITHINE AMINOTRANSFERASE                              213   8e-58
1z7dC [x.x.x] ORNITHINE AMINOTRANSFERASE                              210   5e-57
1sffA [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE                       209   1e-56
1szuA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE                        207   4e-56
1szkA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE                        207   6e-56
1szsA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE                        206   9e-56
2eo5A [x.x.x] 419AA LONG HYPOTHETICAL AMINOTRANSFERASE                196   1e-52
1z3zA [x.x.x] DIALKYLGLYCINE DECARBOXYLASE                            154   4e-40
1zodA [c.67.1 (1m0nA)] 2,2-DIALKYLGLYCINE DECARBOXYLASE               153   7e-40
1dgdA [x.x.x] DIALKYLGLYCINE DECARBOXYLASE                            153   9e-40
1d7uA [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE              153   9e-40
3gjuA [x.x.x] PUTATIVE AMINOTRANSFERASE                               152   1e-39
3i5tB [x.x.x] AMINOTRANSFERASE                                        144   3e-37
3hmuB [x.x.x] AMINOTRANSFERASE, CLASS III                             144   6e-37
3hmuA [x.x.x] AMINOTRANSFERASE, CLASS III                             144   6e-37
3i5tA [x.x.x] AMINOTRANSFERASE                                        143   1e-36
3fcrA [x.x.x] PUTATIVE AMINOTRANSFERASE                               140   8e-36
2cfbA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                139   2e-35
3bs8A [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                139   2e-35
3du4A [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               138   3e-35
2zsmB [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                133   1e-33
2zsmA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                133   1e-33
2epjA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                133   1e-33
3bv0B [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               122   2e-30
3bv0A [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               122   2e-30
3drdB [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               122   2e-30
3drdA [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               122   2e-30
3dodB [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               122   2e-30
3dodA [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE               122   2e-30
2zukB [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE                120   5e-30
3dxvA [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE                120   9e-30
2gsaA [c.67.1] GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE                119   2e-29
2hozA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)         118   3e-29
2zukA [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE                117   6e-29
3dxvB [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE                117   8e-29
2hozB [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)         116   1e-28
1qj3B [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE                    115   2e-28
2jjfA [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE                       115   2e-28
2hoyA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)         115   2e-28
2hp1B [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)         114   4e-28
2cinA [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE                       113   8e-28
1qj3A [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE                    112   1e-27
2hoyB [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)         112   1e-27
2jjeA [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE                       112   2e-27
2jjhA [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE                       111   4e-27
1qj5A [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE                    110   5e-27
1mlyA [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE           110   5e-27
1s09A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              110   7e-27
1qj5B [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE                    110   7e-27
1mlyB [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE           110   7e-27
1mgvA [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE           110   7e-27
1s09B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              110   9e-27
1s08A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              110   9e-27
1s07B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              108   3e-26
1s07A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              108   3e-26
1s06A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              108   3e-26
1s0aA [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              107   5e-26
1s06B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              107   5e-26
1s0aB [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              107   6e-26
1s08B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              107   6e-26
1dtyA [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE              106   1e-25
2e7uA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                102   2e-24
3i4jB [x.x.x] AMINOTRANSFERASE, CLASS III                              96   1e-22
3i4jA [x.x.x] AMINOTRANSFERASE, CLASS III                              93   1e-21
1ohvA [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE                        73   2e-15
1gtxA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE                         73   2e-15
2cy8A [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE                         55   3e-10
1wyuB [x.x.x] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN)              42   3e-06
1wytB [x.x.x] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN)              42   3e-06
1o4sB [c.67.1] ASPARTATE AMINOTRANSFERASE                              35   5e-04
1o4sA [c.67.1] ASPARTATE AMINOTRANSFERASE                              35   5e-04

>2e54A [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
          Length = 385

 Score =  369 bits (948), Expect = e-105
 Identities = 179/383 (46%), Positives = 245/383 (63%), Gaps = 4/383 (1%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y+MNTY R P   V G+G+W++D  G  YLDF SGIAVN LGH+HP + EA+  Q + L+
Sbjct: 2   YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLI 61

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           HCSN++W  PQ++LA+LL +N+   K FF N+G EANE AIK+AR           Y I+
Sbjct: 62  HCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARXXXXXXXXXX-YRIL 120

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
           +A NSFHGRTL ++TATGQ KYQ+  +PL  GF Y  FN++E L+  +    CAV LEP+
Sbjct: 121 SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPI 180

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGE G++PA + +LE  ++LC+E   LL+FDEVQCG+GRTGK   YQ YGV PD++T AK
Sbjct: 181 QGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAK 240

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
            LGGG PIGA++  E+ A   +PGDH +TFGGNPLA  A +  ++ L ++G LE   + G
Sbjct: 241 GLGGGVPIGAVIVNER-ANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 299

Query: 313 EYFKAELTKLAAEVPLVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLR 370
            Y   +L ++  E  +V +VR                +++   C E  LL+     N +R
Sbjct: 300 NYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIR 359

Query: 371 FLPPLIITKDEIDQAVQILKRAM 393
           FLPPL +   EID AV+ LK+ +
Sbjct: 360 FLPPLTVEYGEIDLAVETLKKVL 382


>2ordA [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
          Length = 384

 Score =  349 bits (896), Expect = 7e-99
 Identities = 178/379 (46%), Positives = 238/379 (62%), Gaps = 7/379 (1%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHC 74
           +NTY R P   V G+G+W++D  G  YLDF SGIAVN LGH+HP + EA+  Q + L+HC
Sbjct: 10  LNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHC 69

Query: 75  SNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
           SN++W  PQ +LA+LL +N+   K FF N+G EANE AIK+AR           Y I++A
Sbjct: 70  SNLFWNRPQ-ELAELLSKNTFGGKVFFANTGTEANEAAIKIAR-XXXXXXXXXXYRILSA 127

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQG 194
            NSFHGRTL ++TATGQ KYQ+  +PL  GF Y  FN++E L+       CAV LEP+QG
Sbjct: 128 HNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRK-SEDVCAVFLEPIQG 186

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
           E G++PA + +LE  ++LC+E   LL+FDEVQCG GRTGK   YQ YGV PD++T AK L
Sbjct: 187 ESGIVPATKEFLEEARKLCDEYDALLVFDEVQCG-GRTGKLFAYQKYGVVPDVLTTAKGL 245

Query: 255 GGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEY 314
           GGG PIGA++  E+ A   +PGDH +TFGGNPLA  A +  ++ L ++G LE   + G Y
Sbjct: 246 GGGVPIGAVIVNER-ANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNY 304

Query: 315 FKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPP 374
            K    K   E  +V +VR              +++   C E  LL+     N +RFLPP
Sbjct: 305 LKKLQEK--EEYDVVADVRGGLIGIQFREEVSNREVATKCFENKLLVVPAGNNTIRFLPP 362

Query: 375 LIITKDEIDQAVQILKRAM 393
           L +   EID AV+ LK+ +
Sbjct: 363 LTVEYGEIDLAVETLKKVL 381


>2eh6A [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
          Length = 375

 Score =  326 bits (835), Expect = 8e-92
 Identities = 183/382 (47%), Positives = 256/382 (67%), Gaps = 9/382 (2%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y+MN Y RLP+  V+G+G +++D +G++YLDFVSGI VN LGHA+P++ EA+ +QV+ LL
Sbjct: 2   YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLL 61

Query: 73  HCSNIYWIEPQVKLAKLLVENSCAD-KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
           H SN+Y    Q +LA  LV++   + K FF NSG E+ E AIKLARKY +   G +K++ 
Sbjct: 62  HVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYWRDK-GKNKWKF 120

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I+  NSFHGRT  +++ATGQ K+ +G +PL  GF+Y   ND++++   +   T       
Sbjct: 121 ISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAXXXXXX 180

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
                    A++ +L  ++++C+EK +LLI DEVQ G+GRTG+F  YQH+ ++PD+I LA
Sbjct: 181 XXXXXXXNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALA 240

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K LGGG PIGA+LA+E+VAQ+F PG H STFGGNPLA  A    ++ +  + +L +  ++
Sbjct: 241 KGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREV 298

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRF 371
           G YFK                               KD V   LE+GLLINCT G VLRF
Sbjct: 299 GNYFKE-----XXXXXXXXXXXXXXXXXXXXXXXXCKDYVLKALEKGLLINCTAGKVLRF 353

Query: 372 LPPLIITKDEIDQAVQILKRAM 393
           LPPLII K+ ID+A+ +L+  +
Sbjct: 354 LPPLIIQKEHIDRAISVLREIL 375


>2pb0B [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
          Length = 387

 Score =  316 bits (809), Expect = 8e-89
 Identities = 159/372 (42%), Positives = 224/372 (60%), Gaps = 4/372 (1%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVK 85
           VKG+G+ VWD  G++Y+DF  GIAV  LGH HP + EA+  Q +TL H SN++  EP ++
Sbjct: 12  VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALR 71

Query: 86  LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLAT 145
           L + L++ + A++  F NSG EANE A KLAR YA     P K +II   N+FHGR+L T
Sbjct: 72  LGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFT 131

Query: 146 VTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAY 205
           V+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP+QGEGGV  A   +
Sbjct: 132 VSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEF 191

Query: 206 LEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           L+G++ LC+E   LL+FDEVQCG+GRTG    Y HYGV PDI+T AKALGGGFP+ AML 
Sbjct: 192 LKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLT 251

Query: 266 KEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
            +++A AF  G H ST+GGNPLA   + A  + +    VL+      + F   L  +  +
Sbjct: 252 TQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQ 311

Query: 326 VPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDE 381
             +  ++R              K    D +    E G+++     +V+RF P L++ + +
Sbjct: 312 FDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEAD 371

Query: 382 IDQAVQILKRAM 393
           I + +Q   +A+
Sbjct: 372 IHEGMQRFAQAV 383


>2pb2A [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
          Length = 378

 Score =  308 bits (790), Expect = 1e-86
 Identities = 158/372 (42%), Positives = 223/372 (59%), Gaps = 8/372 (2%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVK 85
           VKG+G+ VWD  G++Y+DF  GIAV  LGH HP + EA+  Q +TL H SN++  EP ++
Sbjct: 6   VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALR 65

Query: 86  LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLAT 145
           L + L++ + A++  F NSG EANE A KLAR YA     P K +II   N+FHGR+L T
Sbjct: 66  LGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFT 125

Query: 146 VTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAY 205
           V+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP+QGEGGV  A   +
Sbjct: 126 VSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEF 185

Query: 206 LEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           L+G++ LC+E   LL+FDEVQCG+GRTG    Y HYGV PDI+T AKALGGGFP+ AML 
Sbjct: 186 LKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLT 245

Query: 266 KEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
            +++A AF    H ST+GGNPLA   + A  + +    VL+      + F   L  +  +
Sbjct: 246 TQEIASAF----HGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQ 301

Query: 326 VPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDE 381
             +  ++R              K    D +    E G+++     +V+RF P L++ + +
Sbjct: 302 FDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEAD 361

Query: 382 IDQAVQILKRAM 393
           I + +Q   +A+
Sbjct: 362 IHEGMQRFAQAV 373


>2pb0A [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
          Length = 389

 Score =  306 bits (784), Expect = 7e-86
 Identities = 158/386 (40%), Positives = 226/386 (58%), Gaps = 9/386 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKG+G+ VWD  G++Y+DF  GIAV  LGH HP + EA+  Q +TL
Sbjct: 4   EVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETL 63

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++L + L++ + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 64  WHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKI 123

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 124 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEP 183

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G++ LC+E   LL+FDEVQCG+GRTG    Y HYGV PDI+T A
Sbjct: 184 IQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSA 243

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+ AML  +++A AF      ST+GGNPLA   + A  + +    VL+     
Sbjct: 244 KALGGGFPVSAMLTTQEIASAF-----GSTYGGNPLACAVAGAAFDIINTPEVLQGIHTK 298

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            + F   L  +  +  +  ++R              K    D +    E G+++     +
Sbjct: 299 RQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGAD 358

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RF P L++ + +I + +Q   +A+
Sbjct: 359 VMRFAPSLVVEEADIHEGMQRFAQAV 384


>2pb2B [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
          Length = 382

 Score =  305 bits (780), Expect = 2e-85
 Identities = 157/372 (42%), Positives = 222/372 (59%), Gaps = 10/372 (2%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVK 85
           VKG+G+ VWD  G++Y+DF  GIAV  LGH HP + EA+  Q +TL H SN++  EP ++
Sbjct: 12  VKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALR 71

Query: 86  LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLAT 145
           L + L++ + A++  F NSG EANE A KLAR YA     P K +II   N+FHGR+L T
Sbjct: 72  LGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFT 131

Query: 146 VTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAY 205
           V+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP+QGEGGV  A   +
Sbjct: 132 VSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEF 191

Query: 206 LEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           L+G++ LC+E   LL+FDEVQCG+GRTG    Y HYGV PDI+T AKALGGGFP+ AML 
Sbjct: 192 LKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLT 251

Query: 266 KEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
            +++A AF      ST+GGNPLA   + A  + +    VL+      + F   L  +  +
Sbjct: 252 TQEIASAF------STYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQ 305

Query: 326 VPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDE 381
             +  ++R              K    D +    E G+++     +V+RF P L++ + +
Sbjct: 306 FDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEAD 365

Query: 382 IDQAVQILKRAM 393
           I + +Q   +A+
Sbjct: 366 IHEGMQRFAQAV 377


>1vefA [x.x.x] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
          Length = 387

 Score =  238 bits (607), Expect = 2e-65
 Identities = 134/367 (36%), Positives = 205/367 (55%), Gaps = 11/367 (2%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y +  + +V+GQGA VWDA+G +Y+D V G  V  LGH +PEV EAV +Q +TL+     
Sbjct: 16  YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT 75

Query: 78  YWIEPQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                + +  + L  +     ++ F  NSG EANE A+K AR     H G  K+  + A 
Sbjct: 76  LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARA----HTGRKKF--VAAM 129

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGE 195
             F GRT+ +++ T + KY+    PL +   ++P+ND+EALK  +   T AV+LEPVQGE
Sbjct: 130 RGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGE 189

Query: 196 GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALG 255
           GGV PA   +L   +++ +EKG LLI DE+Q G+GRTGK   ++H+G+ PDI+T      
Sbjct: 190 GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTXXXXXX 249

Query: 256 GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYF 315
                     +E+VA++   G H +TFGGNPLA  A +A +  L +  + E A ++G +F
Sbjct: 250 XXXXXXXXXMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWF 309

Query: 316 KAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNG-NVLRFLPP 374
             +L  + +  P ++EVR                 +A   ++  ++    G  V+RFLPP
Sbjct: 310 MEKLRAIPS--PKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPP 367

Query: 375 LIITKDE 381
           L+I K++
Sbjct: 368 LVIEKED 374


>2byjA [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 404

 Score =  233 bits (593), Expect = 9e-64
 Identities = 136/400 (34%), Positives = 212/400 (53%), Gaps = 10/400 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           + +I     +Y  + Y  LP+AL +G+G ++WD +GR+Y DF+S I+    GH HP++  
Sbjct: 5   SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVN 64

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+  QV  L   S  ++     +  + + +     K    N+G EA E A KLARK+   
Sbjct: 65  ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYT 124

Query: 123 HLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
             G  KY+  I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  +
Sbjct: 125 VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERAL 184

Query: 181 -GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             P+  A M+EP+QGE GV+     YL GV++LC    +L I DE+Q GL RTG++L   
Sbjct: 185 QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVD 244

Query: 240 HYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +  V PDI+ L KAL GG +P+ A+L  + +    +PG+H ST+GGNPL           
Sbjct: 245 YENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRXXXXXXXX 304

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL-- 355
                      ++G   + EL KL ++V  V  VR                D    CL  
Sbjct: 305 XXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDWDAWKVCLRL 362

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
            + GLL   T+G+++RF PPL+I +DE+ ++++I+ + +L
Sbjct: 363 RDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL 402


>2oatA [c.67.1] ORNITHINE AMINOTRANSFERASE
          Length = 404

 Score =  231 bits (588), Expect = 4e-63
 Identities = 135/400 (33%), Positives = 211/400 (52%), Gaps = 10/400 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           + +I     +Y  + Y  LP+AL +G+G ++WD +GR+Y DF+S  +    GH HP++  
Sbjct: 5   SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVN 64

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+  QV  L   S  ++     +  + + +     K    N+G EA E A KLARK+   
Sbjct: 65  ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYT 124

Query: 123 HLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
             G  KY+  I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  +
Sbjct: 125 VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERAL 184

Query: 181 -GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             P+  A M+EP+QGE GV+     YL GV++LC    +L I DE+Q GL RTG++L   
Sbjct: 185 QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVD 244

Query: 240 HYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +  V PDI+ L KAL GG +P+ A+L  + +    +PG+H ST+GGNPL           
Sbjct: 245 YENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRXXXXXXXX 304

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL-- 355
                      ++G   + EL KL ++V  V  VR                D    CL  
Sbjct: 305 XXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDWDAWKVCLRL 362

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
            + GLL   T+G+++RF PPL+I +DE+ ++++I+ + +L
Sbjct: 363 RDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL 402


>1gbnA [c.67.1] ORNITHINE AMINOTRANSFERASE
          Length = 402

 Score =  231 bits (588), Expect = 4e-63
 Identities = 135/400 (33%), Positives = 211/400 (52%), Gaps = 10/400 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           + +I     +Y  + Y  LP+AL +G+G ++WD +GR+Y DF+S  +    GH HP++  
Sbjct: 3   SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVN 62

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+  QV  L   S  ++     +  + + +     K    N+G EA E A KLARK+   
Sbjct: 63  ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYT 122

Query: 123 HLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
             G  KY+  I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  +
Sbjct: 123 VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERAL 182

Query: 181 -GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             P+  A M+EP+QGE GV+     YL GV++LC    +L I DE+Q GL RTG++L   
Sbjct: 183 QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVD 242

Query: 240 HYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +  V PDI+ L KAL GG +P+ A+L  + +    +PG+H ST+GGNPL           
Sbjct: 243 YENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRXXXXXXXX 302

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL-- 355
                      ++G   + EL KL ++V  V  VR                D    CL  
Sbjct: 303 XXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDWDAWKVCLRL 360

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
            + GLL   T+G+++RF PPL+I +DE+ ++++I+ + +L
Sbjct: 361 RDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL 400


>2bylA [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 404

 Score =  228 bits (582), Expect = 2e-62
 Identities = 135/400 (33%), Positives = 211/400 (52%), Gaps = 10/400 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           + +I     +Y  +    LP+AL +G+G ++WD +GR+Y DF+S I+    GH HP++  
Sbjct: 5   SDDIFEREYKYGAHNAHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVN 64

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+  QV  L   S  ++     +  + + +     K    N+G EA E A KLARK+   
Sbjct: 65  ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYT 124

Query: 123 HLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
             G  KY+  I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  +
Sbjct: 125 VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERAL 184

Query: 181 -GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             P+  A M+EP+QGE GV+     YL GV++LC    +L I DE+Q GL RTG++L   
Sbjct: 185 QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVD 244

Query: 240 HYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +  V PDI+ L KAL GG +P+ A+L  + +    +PG+H ST+GGNPL           
Sbjct: 245 YENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHFSTYGGNPLGCRXXXXXXXX 304

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL-- 355
                      ++G   + EL KL ++V  V  VR                D    CL  
Sbjct: 305 XXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDWDAWKVCLRL 362

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
            + GLL   T+G+++RF PPL+I +DE+ ++++I+ + +L
Sbjct: 363 RDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL 402


>1z7dB [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 377

 Score =  216 bits (549), Expect = 1e-58
 Identities = 125/389 (32%), Positives = 199/389 (51%), Gaps = 34/389 (8%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP +  A+  Q K L
Sbjct: 12  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNL 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YAKQHLGPDKY 129
             CS  ++  P     + L      DK    N+GAEANE A KL RK  Y  + +  +  
Sbjct: 72  TICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMA 131

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG-PHTCAVM 188
           +I+   N+F                           + VP+            P+ CA +
Sbjct: 132 KIVVCKNNF---------------------------SKVPYXXXXXXXXXXXXPNVCAFI 164

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+QGE GVI  +  YL+GV  +C++  +L + DEVQ GLGRTGK L   HY V+PD+I
Sbjct: 165 VEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVI 224

Query: 249 TLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            L KAL GG +PI A+LA + +    +PG+H ST+GGNPLAA+  +  +  L+ + + EN
Sbjct: 225 LLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCEN 284

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCT 364
           A ++G  F   L +   +  +V++VR               +++  CL   E GL+    
Sbjct: 285 AEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDV 344

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 345 HDKTIRLTPPLCITKEQLDECTEIIVKTV 373


>1z7dE [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 374

 Score =  215 bits (548), Expect = 2e-58
 Identities = 125/387 (32%), Positives = 197/387 (50%), Gaps = 33/387 (8%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP +  A+  Q K L
Sbjct: 12  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNL 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
             CS  ++  P     + L      DK    N+GAEANE A KL RK+         YE+
Sbjct: 72  TICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG--------YEV 123

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG-PHTCAVMLE 190
                                K    +  +   F+ VP+            P+ CA ++E
Sbjct: 124 --------------------KKIPENMAKIVVCFSKVPYXXXXXXXXXXXXPNVCAFIVE 163

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+QGE GVI  +  YL+GV  +C++  +L + DEVQ GLGRTGK L   HY V+PD+I L
Sbjct: 164 PIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILL 223

Query: 251 AKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
            KAL GG +PI A+LA + +    +PG+H ST+GGNPLAA+  +  +  L+ + + ENA 
Sbjct: 224 GKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCENAE 283

Query: 310 QMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCTNG 366
           ++G  F   L +   +  +V++VR               +++  CL   E GL+    + 
Sbjct: 284 KLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDVHD 343

Query: 367 NVLRFLPPLIITKDEIDQAVQILKRAM 393
             +R  PPL ITK+++D+  +I+ + +
Sbjct: 344 KTIRLTPPLCITKEQLDECTEIIVKTV 370


>1z7dA [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 378

 Score =  215 bits (548), Expect = 2e-58
 Identities = 125/389 (32%), Positives = 199/389 (51%), Gaps = 33/389 (8%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP +  A+  Q K L
Sbjct: 12  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNL 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YAKQHLGPDKY 129
             CS  ++  P     + L      DK    N+GAEANE A KL RK  Y  + +  +  
Sbjct: 72  TICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMA 131

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG-PHTCAVM 188
           +I+   N+                           F+ VP+            P+ CA +
Sbjct: 132 KIVVCKNN--------------------------QFSKVPYXXXXXXXXXXXXPNVCAFI 165

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+QGE GVI  +  YL+GV  +C++  +L + DEVQ GLGRTGK L   HY V+PD+I
Sbjct: 166 VEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVI 225

Query: 249 TLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            L KAL GG +PI A+LA + +    +PG+H ST+GGNPLAA+  +  +  L+ + + EN
Sbjct: 226 LLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCEN 285

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCT 364
           A ++G  F   L +   +  +V++VR               +++  CL   E GL+    
Sbjct: 286 AEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDV 345

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 346 HDKTIRLTPPLCITKEQLDECTEIIVKTV 374


>1z7dD [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 375

 Score =  213 bits (542), Expect = 8e-58
 Identities = 125/387 (32%), Positives = 198/387 (51%), Gaps = 32/387 (8%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP +  A+  Q K L
Sbjct: 12  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNL 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
             CS  ++  P     + L      DK    N+GAEANE A KL RK+         YE+
Sbjct: 72  TICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG--------YEV 123

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG-PHTCAVMLE 190
                +     +A +                  F+ VP+            P+ CA ++E
Sbjct: 124 KKIPEN-----MAKIVVCK--------------FSKVPYXXXXXXXXXXXXPNVCAFIVE 164

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+QGE GVI  +  YL+GV  +C++  +L + DEVQ GLGRTGK L   HY V+PD+I L
Sbjct: 165 PIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILL 224

Query: 251 AKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
            KAL GG +PI A+LA + +    +PG+H ST+GGNPLAA+  +  +  L+ + + ENA 
Sbjct: 225 GKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCENAE 284

Query: 310 QMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCTNG 366
           ++G  F   L +   +  +V++VR               +++  CL   E GL+    + 
Sbjct: 285 KLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDVHD 344

Query: 367 NVLRFLPPLIITKDEIDQAVQILKRAM 393
             +R  PPL ITK+++D+  +I+ + +
Sbjct: 345 KTIRLTPPLCITKEQLDECTEIIVKTV 371


>1z7dC [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 369

 Score =  210 bits (535), Expect = 5e-57
 Identities = 123/389 (31%), Positives = 194/389 (49%), Gaps = 42/389 (10%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP +  A+  Q K L
Sbjct: 12  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNL 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
             CS  ++  P     + L      DK    N+GAEANE A KL RK+         YE+
Sbjct: 72  TICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG--------YEV 123

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPF---NDLEALKNTIGPHTCAVM 188
                                        +P+  A +                P+ CA +
Sbjct: 124 ---------------------------KKIPENMAKIVVCYXXXXXXXXXXXXPNVCAFI 156

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+QGE GVI  +  YL+GV  +C++  +L + DEVQ GLGRTGK L   HY V+PD+I
Sbjct: 157 VEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVI 216

Query: 249 TLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            L KAL GG +PI A+LA + +    +PG+H ST+GGNPLAA+  +  +  L+ + + EN
Sbjct: 217 LLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCEN 276

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCT 364
           A ++G  F   L +   +  +V++VR               +++  CL   E GL+    
Sbjct: 277 AEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDV 336

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 337 HDKTIRLTPPLCITKEQLDECTEIIVKTV 365


>1sffA [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE
          Length = 425

 Score =  209 bits (531), Expect = 1e-56
 Identities = 137/424 (32%), Positives = 216/424 (50%), Gaps = 41/424 (9%)

Query: 2   NNQEILAMGQQYVMNTYGRL-PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +N+E++    Q +    G++ P+   + +   VWD +GR+YLDF  GIAV   GH HP+V
Sbjct: 2   SNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKV 61

Query: 61  AEAVCKQVKTLLH-CSNIYWIEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLA 116
             AV  Q+K L H C  +   EP ++L +++   V    A K     +G+EA E A+K+A
Sbjct: 62  VAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIA 121

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTK-YQRGLDPLPQGFAY-----VPF 170
           R   K+         I  + ++HGRT  T+  TG+   Y  G+  +P G  Y      P 
Sbjct: 122 RAATKRS------GTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMP-GHVYRALYPCPL 174

Query: 171 NDLEA----------LKNTIGPHT-CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLL 219
           + +             KN   P    A+++EPVQGEGG   ++ A+++ ++ LC+E G++
Sbjct: 175 HGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIM 234

Query: 220 LIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA 279
           LI DEVQ G GRTG     +  GV PD+ T AK++ GGFP+  +  + +V  A  PG   
Sbjct: 235 LIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLG 294

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR------ 333
            T+ GNP+A  A+L  ++   Q+ +L+ A  +G+  K  L  +A + P + +VR      
Sbjct: 295 GTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMI 354

Query: 334 ----XXXXXXXXXXXXXXKDIVAHCLEQGL-LINC-TNGNVLRFLPPLIITKDEIDQAVQ 387
                              +IVA   ++GL L++C    NVLR L PL I   +I Q ++
Sbjct: 355 AIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLE 414

Query: 388 ILKR 391
           I+ +
Sbjct: 415 IISQ 418


>1szuA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
          Length = 425

 Score =  207 bits (527), Expect = 4e-56
 Identities = 136/424 (32%), Positives = 215/424 (50%), Gaps = 41/424 (9%)

Query: 2   NNQEILAMGQQYVMNTYGRL-PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +N+E++    Q +    G++ P+   + +   VWD +GR+YLDF  GIAV   GH HP+V
Sbjct: 2   SNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKV 61

Query: 61  AEAVCKQVKTLLH-CSNIYWIEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLA 116
             AV  Q+K L H C  +   EP ++L +++   V    A K     +G+EA E A+K+A
Sbjct: 62  VAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIA 121

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTK-YQRGLDPLPQGFAY-----VPF 170
           R   K+         I  + ++HGRT  T+  TG+   Y  G+  +P G  Y      P 
Sbjct: 122 RAATKRS------GTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMP-GHVYRALYPCPL 174

Query: 171 NDLEA----------LKNTIGPHT-CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLL 219
           + +             KN   P    A+++EPVQGEGG   ++ A+++ ++ LC+E G++
Sbjct: 175 HGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIM 234

Query: 220 LIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA 279
           LI DE Q G GRTG     +  GV PD+ T AK++ GGFP+  +  + +V  A  PG   
Sbjct: 235 LIADEAQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLG 294

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR------ 333
            T+ GNP+A  A+L  ++   Q+ +L+ A  +G+  K  L  +A + P + +VR      
Sbjct: 295 GTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMI 354

Query: 334 ----XXXXXXXXXXXXXXKDIVAHCLEQGL-LINC-TNGNVLRFLPPLIITKDEIDQAVQ 387
                              +IVA   ++GL L++C    NVLR L PL I   +I Q ++
Sbjct: 355 AIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLE 414

Query: 388 ILKR 391
           I+ +
Sbjct: 415 IISQ 418


>1szkA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
          Length = 425

 Score =  207 bits (526), Expect = 6e-56
 Identities = 136/424 (32%), Positives = 215/424 (50%), Gaps = 41/424 (9%)

Query: 2   NNQEILAMGQQYVMNTYGRL-PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +N+E++    Q +    G++ P+   + +   VWD +GR+YLDF  GIAV   GH HP+V
Sbjct: 2   SNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKV 61

Query: 61  AEAVCKQVKTLLH-CSNIYWIEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLA 116
             AV  Q+K L H C  +   EP ++L +++   V    A K     +G+EA E A+K+A
Sbjct: 62  VAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIA 121

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTK-YQRGLDPLPQGFAY-----VPF 170
           R   K+         I  + ++HGRT  T+  TG+   Y  G+  +P G  Y      P 
Sbjct: 122 RAATKRS------GTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMP-GHVYRALYPCPL 174

Query: 171 NDLEA----------LKNTIGPHT-CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLL 219
           + +             KN   P    A+++EPVQG GG   ++ A+++ ++ LC+E G++
Sbjct: 175 HGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGSGGFYASSPAFMQRLRALCDEHGIM 234

Query: 220 LIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA 279
           LI DEVQ G GRTG     +  GV PD+ T AK++ GGFP+  +  + +V  A  PG   
Sbjct: 235 LIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLG 294

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR------ 333
            T+ GNP+A  A+L  ++   Q+ +L+ A  +G+  K  L  +A + P + +VR      
Sbjct: 295 GTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMI 354

Query: 334 ----XXXXXXXXXXXXXXKDIVAHCLEQGL-LINC-TNGNVLRFLPPLIITKDEIDQAVQ 387
                              +IVA   ++GL L++C    NVLR L PL I   +I Q ++
Sbjct: 355 AIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLE 414

Query: 388 ILKR 391
           I+ +
Sbjct: 415 IISQ 418


>1szsA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
          Length = 425

 Score =  206 bits (524), Expect = 9e-56
 Identities = 136/424 (32%), Positives = 215/424 (50%), Gaps = 41/424 (9%)

Query: 2   NNQEILAMGQQYVMNTYGRL-PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +N+E++    Q +    G++ P+   + +   VWD +GR+YLDF  G AV   GH HP+V
Sbjct: 2   SNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGQAVLNTGHLHPKV 61

Query: 61  AEAVCKQVKTLLH-CSNIYWIEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLA 116
             AV  Q+K L H C  +   EP ++L +++   V    A K     +G+EA E A+K+A
Sbjct: 62  VAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIA 121

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTK-YQRGLDPLPQGFAY-----VPF 170
           R   K+         I  + ++HGRT  T+  TG+   Y  G+  +P G  Y      P 
Sbjct: 122 RAATKRS------GTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMP-GHVYRALYPCPL 174

Query: 171 NDLEA----------LKNTIGPHT-CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLL 219
           + +             KN   P    A+++EPVQGEGG   ++ A+++ ++ LC+E G++
Sbjct: 175 HGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIM 234

Query: 220 LIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA 279
           LI DEVQ G GRTG     +  GV PD+ T AK++ GGFP+  +  + +V  A  PG   
Sbjct: 235 LIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLG 294

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR------ 333
            T+ GNP+A  A+L  ++   Q+ +L+ A  +G+  K  L  +A + P + +VR      
Sbjct: 295 GTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMI 354

Query: 334 ----XXXXXXXXXXXXXXKDIVAHCLEQGL-LINC-TNGNVLRFLPPLIITKDEIDQAVQ 387
                              +IVA   ++GL L++C    NVLR L PL I   +I Q ++
Sbjct: 355 AIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLE 414

Query: 388 ILKR 391
           I+ +
Sbjct: 415 IISQ 418


>2eo5A [x.x.x] 419AA LONG HYPOTHETICAL AMINOTRANSFERASE
          Length = 412

 Score =  196 bits (497), Expect = 1e-52
 Identities = 134/409 (32%), Positives = 209/409 (51%), Gaps = 55/409 (13%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGH-AHPEVAEAVCKQVKTLLHCS-NIYW 79
           P+ +  G+G W++D DG +YLDF SGI VN LG  +HPEV +   +Q++ L H + N ++
Sbjct: 25  PLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWPSHPEVIKIGIEQMQKLAHAAANDFY 84

Query: 80  IEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
             PQ++LAK LV  S  +   K FF NSG EA E +IK+ +   +++       II    
Sbjct: 85  NIPQLELAKKLVTYSPGNFQKKVFFSNSGTEAIEASIKVVKNTGRKY-------IIAFLG 137

Query: 137 SFHGRTLATVTATGQTKYQRGL-DPLPQGFAYVPF--------------NDLEALK---- 177
            FHGRT  +++ T     QR +  P   G  +VP+              N  E +     
Sbjct: 138 GFHGRTFGSISLTASKAVQRSIVGPFMPGVIHVPYPNPYRNPWHINGYENPSELVNRVIE 197

Query: 178 --------NTIGPHTCA-VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCG 228
                   N + P   A +  EP+QGEGG +   + +   +++L ++ G+LL+ DEVQ G
Sbjct: 198 FIEDYIFVNLVPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMG 257

Query: 229 LGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPL 287
           LGRTGK    +++   PD+ITLAKALGGG  PIGA + ++ +           TFGGN L
Sbjct: 258 LGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDL--------DFKTFGGNAL 309

Query: 288 AATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXX 347
           A       ++  + K +L +  ++G+ F  EL  LA +V  +                  
Sbjct: 310 ACAIGSKVID--IVKDLLPHVNEIGKIFAEELQGLADDVRGI----GLAWGLEYNEKKVR 363

Query: 348 KDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
             I+    ++GLL+     + +R +PPL+I+++E  Q + ILK+ + VV
Sbjct: 364 DRIIGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVV 412


>1z3zA [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
          Length = 431

 Score =  154 bits (389), Expect = 4e-40
 Identities = 120/411 (29%), Positives = 185/411 (45%), Gaps = 46/411 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           PM + + +G++V+DADGR  LDF SG     LGH HPE+   + +    L H  +     
Sbjct: 24  PMIIERAKGSFVYDADGRAILDFTSGAMSAVLGHCHPEIVSVIGEYAGKLDHLFSEMLSR 83

Query: 82  PQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P V LA  L  +     D+A   ++GAE+NE AI++A+      L   KYEI+    S+H
Sbjct: 84  PVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWH 137

Query: 140 GRTLATVTATGQTKYQRGLDP-------LPQGFAYVPFND--------------LEALKN 178
           G              ++G+ P       +P  F Y P  +               + +  
Sbjct: 138 GMXXXXXXXXXXXX-RKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFDLIDR 196

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
               +  A + EP+   GG+I     Y+  +K+ CE +G+LLI DE Q G+GRTG     
Sbjct: 197 QSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC 256

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAATASLATM 296
           Q  GV PDI+TL+K LG G P+ A++    + +      +   +T   +PL A   L  +
Sbjct: 257 QRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL 316

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-------- 348
           + + + G++  A  M                 + +                +        
Sbjct: 317 DVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRTKEPADGL 376

Query: 349 --DIVAHCLEQGLLINCTN----GNVLRFLPPLIITKDEIDQAVQILKRAM 393
              I   C+  GL +N       G V R  PPL +++DEID  + +L +A+
Sbjct: 377 GAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI 427


>1zodA [c.67.1 (1m0nA)] 2,2-DIALKYLGLYCINE DECARBOXYLASE
          Length = 431

 Score =  153 bits (387), Expect = 7e-40
 Identities = 120/411 (29%), Positives = 185/411 (45%), Gaps = 46/411 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           PM + + +G++V+DADGR  LDF SG     LGH HPE+   + +    L H  +     
Sbjct: 24  PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSEMLSR 83

Query: 82  PQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P V LA  L  +     D+A   ++GAE+NE AI++A+      L   KYEI+    S+H
Sbjct: 84  PVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWH 137

Query: 140 GRTLATVTATGQTKYQRGLDP-------LPQGFAYVPFND--------------LEALKN 178
           G              ++G+ P       +P  F Y P  +               + +  
Sbjct: 138 GMXXXXXXXXXXXX-RKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFDLIDR 196

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
               +  A + EP+   GG+I     Y+  +K+ CE +G+LLI DE Q G+GRTG     
Sbjct: 197 QSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC 256

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAATASLATM 296
           Q  GV PDI+TL+K LG G P+ A++    + +      +   +T   +PL A   L  +
Sbjct: 257 QRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL 316

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-------- 348
           + + + G++  A  M                 + +                +        
Sbjct: 317 DVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRTKEPADGL 376

Query: 349 --DIVAHCLEQGLLINCTN----GNVLRFLPPLIITKDEIDQAVQILKRAM 393
              I   C+  GL +N       G V R  PPL +++DEID  + +L +A+
Sbjct: 377 GAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI 427


>1dgdA [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
          Length = 431

 Score =  153 bits (386), Expect = 9e-40
 Identities = 120/411 (29%), Positives = 185/411 (45%), Gaps = 46/411 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           PM + + +G++V+DADGR  LDF SG     LGH HPE+   + +    L H  +     
Sbjct: 24  PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGMLSR 83

Query: 82  PQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P V LA  L  +     D+A   ++GAE+NE AI++A+      L   KYEI+    S+H
Sbjct: 84  PVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWH 137

Query: 140 GRTLATVTATGQTKYQRGLDP-------LPQGFAYVPFND--------------LEALKN 178
           G              ++G+ P       +P  F Y P  +               + +  
Sbjct: 138 GMXXXXXXXXXXXX-RKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFDLIDR 196

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
               +  A + EP+   GG+I     Y+  +K+ CE +G+LLI DE Q G+GRTG     
Sbjct: 197 QSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC 256

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAATASLATM 296
           Q  GV PDI+TL+K LG G P+ A++    + +      +   +T   +PL A   L  +
Sbjct: 257 QRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL 316

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-------- 348
           + + + G++  A  M                 + +                +        
Sbjct: 317 DVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRTKEPADGL 376

Query: 349 --DIVAHCLEQGLLINCTN----GNVLRFLPPLIITKDEIDQAVQILKRAM 393
              I   C+  GL +N       G V R  PPL +++DEID  + +L +A+
Sbjct: 377 GAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI 427


>1d7uA [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
          Length = 431

 Score =  153 bits (386), Expect = 9e-40
 Identities = 120/411 (29%), Positives = 185/411 (45%), Gaps = 46/411 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           PM + + +G++V+DADGR  LDF SG     LGH HPE+   + +    L H  +     
Sbjct: 24  PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGMLSR 83

Query: 82  PQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P V LA  L  +     D+A   ++GAE+NE AI++A+      L   KYEI+    S+H
Sbjct: 84  PVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWH 137

Query: 140 GRTLATVTATGQTKYQRGLDP-------LPQGFAYVPFND--------------LEALKN 178
           G              ++G+ P       +P  F Y P  +               + +  
Sbjct: 138 GMXXXXXXXXXXXX-RKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFDLIDR 196

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
               +  A + EP+   GG+I     Y+  +K+ CE +G+LLI DE Q G+GRTG     
Sbjct: 197 QSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC 256

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAATASLATM 296
           Q  GV PDI+TL+K LG G P+ A++    + +      +   +T   +PL A   L  +
Sbjct: 257 QRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL 316

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-------- 348
           + + + G++  A  M                 + +                +        
Sbjct: 317 DVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRTKEPADGL 376

Query: 349 --DIVAHCLEQGLLINCTN----GNVLRFLPPLIITKDEIDQAVQILKRAM 393
              I   C+  GL +N       G V R  PPL +++DEID  + +L +A+
Sbjct: 377 GAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI 427


>3gjuA [x.x.x] PUTATIVE AMINOTRANSFERASE
          Length = 446

 Score =  152 bits (385), Expect = 1e-39
 Identities = 117/412 (28%), Positives = 190/412 (46%), Gaps = 49/412 (11%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL--HCSN 76
           G  P  +  G+G  VWD +GR+ +D  +G+    +G+   ++A+A+  Q K L   H   
Sbjct: 28  GESPTRIAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYV 87

Query: 77  IYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
            +  E  + LAK++       + +F  SG++ANE  IKL   Y      P+K +II+   
Sbjct: 88  GHGTEASITLAKIIDRAPKGSRVYFGLSGSDANETNIKLIWYYNNVLGRPEKKKIISRWR 147

Query: 137 SFHGRTLATVTATGQTKYQRGLDPLPQG---------------------FAYVPFNDLEA 175
            +HG  + T + TG   +    D LP+                      F+    + LE 
Sbjct: 148 GYHGSGV-TGSLTGLDLFHNAFD-LPRAPVLHTEAPYYFRRTDRSSEEQFSQHCADKLEE 205

Query: 176 LKNTIGPHTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK 234
           +    GP T A  + EP+ G GG++P    Y E ++ + ++  +LL+ DEV  G GR G 
Sbjct: 206 ILAE-GPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGT 264

Query: 235 FLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGD-------HASTFGGNP 286
           F G  HYG++PD+IT+AK L   + P+  ++  ++V Q    G        H  T+  +P
Sbjct: 265 F-GSDHYGIKPDLITIAKGLTSAYAPLSGVIVADRVWQVLVQGSDKLGSLGHGWTYSAHP 323

Query: 287 LAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXX 346
           +   A +A +E L+ + ++ NA + G YF+AEL K       V EVR             
Sbjct: 324 ICVAAGVANLE-LIDEDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGLAAVEFVADK 382

Query: 347 XKDI-----------VAHCL-EQGLLINCTNGNVLRFLPPLIITKDEIDQAV 386
              +           VA  L   G++     G++L F PPL +T+++ D  V
Sbjct: 383 DDRVFFDASQKIGPQVATALAASGVIGRAPQGDILGFAPPLCLTREQADIVV 434


>3i5tB [x.x.x] AMINOTRANSFERASE
          Length = 442

 Score =  144 bits (364), Expect = 3e-37
 Identities = 118/412 (28%), Positives = 187/412 (45%), Gaps = 43/412 (10%)

Query: 25  LVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI-EPQ 83
           L   +G +V   DGR+ +D  +G+    +G+   E+ +A+  Q   L + S  Y    P 
Sbjct: 28  LTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWYMATSPA 87

Query: 84  VKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGR 141
            +LA+ +   +  D  + FF   G+ A + A++ +  Y      P K  II   + +HG 
Sbjct: 88  ARLAEKIATLTPGDLNRIFFTTGGSTAVDSALRFSEFYNNVLGRPQKKRIIVRYDGYHGS 147

Query: 142 TLATVTATGQTKYQRGLD-----------PLP--------QGFAYVPFNDLEALKNTIGP 182
           T  T   TG+T      D           P P        + F      + E    ++GP
Sbjct: 148 TALTAACTGRTGNWPNFDIAQDRISFLSSPNPRHAGNRSQEAFLDDLVQEFEDRIESLGP 207

Query: 183 HTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK-FLGYQH 240
            T A  L EP+   GGVI     Y    K +CE+  +L I DEV  G GR G+ F   + 
Sbjct: 208 DTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKV 267

Query: 241 YGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHAS--------TFGGNPLAATA 291
           +GV PDIIT AK +  G+ P+G +   E V      G++A         T+   P+A  A
Sbjct: 268 FGVVPDIITFAKGVTSGYVPLGGLAISEAVLARIS-GENAKGSWFTNGYTYSNQPVACAA 326

Query: 292 SLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD-- 349
           +LA +E + ++G+++ A +M +YF A L  L  ++P V E R               +  
Sbjct: 327 ALANIELMEREGIVDQAREMADYFAAALASL-RDLPGVAETRSVGLVGCVQCLLGTAEDK 385

Query: 350 -----IVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                I   C E GL++    G++    PPLII++ +ID+ V I+++A+  V
Sbjct: 386 AFTLKIDERCFELGLIVR-PLGDLCVISPPLIISRAQIDEMVAIMRQAITEV 436


>3hmuB [x.x.x] AMINOTRANSFERASE, CLASS III
          Length = 460

 Score =  144 bits (362), Expect = 6e-37
 Identities = 108/409 (26%), Positives = 183/409 (44%), Gaps = 40/409 (9%)

Query: 25  LVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE--P 82
           + + +G W+ D++G + LD ++G+    +G+   E+AE   +Q++ L + +  +     P
Sbjct: 36  ITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNTFFKTTHVP 95

Query: 83  QVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            + LA+ L E +  D    FF   G+EAN+  I++ R Y +    P+K  II+  N++HG
Sbjct: 96  AIALAQKLAELAPGDLNHVFFAGGGSEANDTNIRMVRTYWQNKGQPEKTVIISRKNAYHG 155

Query: 141 RTLATVTATGQTKY--QRGLDP----LPQGFAYVPFNDLEALKNTIGP------------ 182
            T+A+    G      Q GL P    + Q   +    D++                    
Sbjct: 156 STVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMDPXXXXXXXXXXXXXXXXXXX 215

Query: 183 --HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A + EPVQG GGVI A  +Y   ++++C++  +LLI DEV CG GRTG + G Q 
Sbjct: 216 XNRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQT 275

Query: 241 YGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGD--HASTFGGNPLAATASLATME 297
            G+ P I+T+AK L  G+ PIG  +  ++VA      +  H  T+ G+P+AA  +     
Sbjct: 276 MGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVIGKDEFNHGYTYSGHPVAAAVAXXXXX 335

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQ 357
                   ++   +   +  E  +   + PLV E +                      E 
Sbjct: 336 XXXXXXXXDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASRAKFASEP 395

Query: 358 GL-------------LINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           G              LI    G+ +   PPL+IT  EID+    +++++
Sbjct: 396 GTIGYICRERCFANNLIMRHVGDRMIISPPLVITPAEIDEMFVRIRKSL 444


>3hmuA [x.x.x] AMINOTRANSFERASE, CLASS III
          Length = 464

 Score =  144 bits (362), Expect = 6e-37
 Identities = 108/409 (26%), Positives = 183/409 (44%), Gaps = 40/409 (9%)

Query: 25  LVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE--P 82
           + + +G W+ D++G + LD ++G+    +G+   E+AE   +Q++ L + +  +     P
Sbjct: 36  ITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNTFFKTTHVP 95

Query: 83  QVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            + LA+ L E +  D    FF   G+EAN+  I++ R Y +    P+K  II+  N++HG
Sbjct: 96  AIALAQKLAELAPGDLNHVFFAGGGSEANDTNIRMVRTYWQNKGQPEKTVIISRKNAYHG 155

Query: 141 RTLATVTATGQTKY--QRGLDP----LPQGFAYVPFNDLEALKNTIGP------------ 182
            T+A+    G      Q GL P    + Q   +    D++                    
Sbjct: 156 STVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMDPXXXXXXXXXXXXXXXXXXX 215

Query: 183 --HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A + EPVQG GGVI A  +Y   ++++C++  +LLI DEV CG GRTG + G Q 
Sbjct: 216 XNRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQT 275

Query: 241 YGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGD--HASTFGGNPLAATASLATME 297
            G+ P I+T+AK L  G+ PIG  +  ++VA      +  H  T+ G+P+AA  +     
Sbjct: 276 MGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVIGKDEFNHGYTYSGHPVAAAVAXXXXX 335

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQ 357
                   ++   +   +  E  +   + PLV E +                      E 
Sbjct: 336 XXXXXXXXDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASRAKFASEP 395

Query: 358 GL-------------LINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           G              LI    G+ +   PPL+IT  EID+    +++++
Sbjct: 396 GTIGYICRERCFANNLIMRHVGDRMIISPPLVITPAEIDEMFVRIRKSL 444


>3i5tA [x.x.x] AMINOTRANSFERASE
          Length = 444

 Score =  143 bits (360), Expect = 1e-36
 Identities = 118/413 (28%), Positives = 186/413 (45%), Gaps = 44/413 (10%)

Query: 25  LVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI-EPQ 83
           L   +G +V   DGR+ +D  +G+    +G+   E+ +A+  Q   L + S  Y    P 
Sbjct: 28  LTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWYMATSPA 87

Query: 84  VKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGR 141
            +LA+ +   +  D  + FF   G+ A + A++ +  Y      P K  II   + +HG 
Sbjct: 88  ARLAEKIATLTPGDLNRIFFTTGGSTAVDSALRFSEFYNNVLGRPQKKRIIVRYDGYHGS 147

Query: 142 TLATVTATGQTKYQRGLD-----------PLP--------QGFAYVPFNDLEALKNTIGP 182
           T  T   TG+T      D           P P        + F      + E    ++GP
Sbjct: 148 TALTAACTGRTGNWPNFDIAQDRISFLSSPNPRHAGNRSQEAFLDDLVQEFEDRIESLGP 207

Query: 183 HTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK-FLGYQH 240
            T A  L EP+   GGVI     Y    K +CE+  +L I DEV  G GR G+ F   + 
Sbjct: 208 DTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKV 267

Query: 241 YGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHAS--------TFGGNPLAATA 291
           +GV PDIIT AK +  G+ P+G +   E V      G++A         T+   P+A  A
Sbjct: 268 FGVVPDIITFAKGVTSGYVPLGGLAISEAVLARIS-GENAKGSWFTNGYTYSNQPVACAA 326

Query: 292 SLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK--- 348
           +LA +E + ++G+++ A +M +YF A L  L  ++P V E R                  
Sbjct: 327 ALANIELMEREGIVDQAREMADYFAAALASL-RDLPGVAETRSVGLVGCVQCLLDGTAED 385

Query: 349 -----DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                 I   C E GL++    G++    PPLII++ +ID+ V I+++A+  V
Sbjct: 386 KAFTLKIDERCFELGLIVR-PLGDLCVISPPLIISRAQIDEMVAIMRQAITEV 437


>3fcrA [x.x.x] PUTATIVE AMINOTRANSFERASE
          Length = 452

 Score =  140 bits (352), Expect = 8e-36
 Identities = 113/414 (27%), Positives = 178/414 (42%), Gaps = 50/414 (12%)

Query: 30  GAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI--YWIEPQVKLA 87
           G ++ D DG + LD  +G+    +G+   E+AEA+  Q + L +  +   +  E  + LA
Sbjct: 40  GVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARELAYYHSYVGHGTEASITLA 99

Query: 88  KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVT 147
           K+L       K +F   G++ANE  +KL   Y      P+K +II+    +H        
Sbjct: 100 KILDRAPKNSKVYFGLGGSDANETNVKLIWYYNNILGRPEKKKIISRWRGYHXXXXXXXX 159

Query: 148 ATGQTKYQRGLD---------PLPQGFAYVPFN------------DLEALKNTIGPHTCA 186
                 + +  D           P  F     N            +LEAL    G  T A
Sbjct: 160 XXXXXXFHKKFDLPVEQVIHTEAPYYFRREDLNQTEEQFVAHCVAELEALIEREGADTIA 219

Query: 187 VML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
             + EP+ G GG++P    Y E ++ +  +  +LL+ DEV  G GR G F G  HYG+EP
Sbjct: 220 AFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTF-GSDHYGLEP 278

Query: 246 DIITLAKALGGGF-PIGAMLAKEQVAQAFQPG-------DHASTFGGNPLAATASLATME 297
           DIIT+AK L   + P+   +  ++V +  + G        H  T+  +P+ A A +A ++
Sbjct: 279 DIITIAKGLTSAYAPLSGSIVSDKVWKVLEQGTDENGPIGHGWTYSAHPIGAAAGVANLK 338

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLA--------------AEVPLVKEVRXXXXXXXXXX 343
            L +  ++ NA ++G Y  A    L+                V  VK+            
Sbjct: 339 LLDELNLVSNAGEVGAYLNATAEALSQHANVGDVRGEGLLCAVEFVKD--RDSRTFFDAA 396

Query: 344 XXXXKDIVAHCLEQGLLI-NCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                 I A  LEQ  +I     G++L F PP  +T+ E DQ V+   RA+  V
Sbjct: 397 DKIGPQISAKLLEQDKIIARAPQGDILGFAPPFCLTRAEADQVVEGTLRAVKAV 450


>2cfbA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 360

 Score =  139 bits (349), Expect = 2e-35
 Identities = 98/300 (32%), Positives = 141/300 (47%), Gaps = 56/300 (18%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+     +GA +WD DG QY+D+V       +GHAHPEV +A        LH +    +E
Sbjct: 1   PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDA--------LHAA----LE 48

Query: 82  PQVKL-AKLLVENSCADKAF----------FCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
                 A  L+EN  A+             F NSG EA    ++L R Y ++       +
Sbjct: 49  KGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQRE------K 102

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH---TCAV 187
           +I     +HG   AT+TA                    P+NDLEA+      +      V
Sbjct: 103 VIKFEGCYHGHA-ATLTA--------------------PYNDLEAVSRLFEQYPNDIAGV 141

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G IP    +LEG+++L ++ G LL+FDEV  G  R       + +GV PD+
Sbjct: 142 ILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGF-RIAYGGAQEKFGVTPDL 200

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            TL K +GGG P+GA   + ++ +   P     T  GNPLA TA + T+E L + G  E+
Sbjct: 201 TTLGKVIGGGLPVGAYGGRAEIMKMVAPA--GPTLSGNPLAMTAGIKTLEILSRPGSYEH 258


>3bs8A [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 430

 Score =  139 bits (349), Expect = 2e-35
 Identities = 98/316 (31%), Positives = 159/316 (50%), Gaps = 24/316 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + +G+G+ ++D DG +Y+D+V       LGH +  V E++ K  +     S     E
Sbjct: 36  PIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAE--YGTSFGAPTE 93

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            + +LAKL+++     +     +SG EA   A++LAR Y  ++      +I+     +HG
Sbjct: 94  VENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRN------KILKFEGCYHG 147

Query: 141 RTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVMLE 190
              + +   G      GL     +P+G A     VP+NDLE++K      G     V++E
Sbjct: 148 HGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVE 207

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  GV+P  + +L+G++ + E+ G LLIFDEV  G  R        ++GV PD+  L
Sbjct: 208 PVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGF-RVDYNCAQGYFGVTPDLTCL 266

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA   K ++ +   P      A T  GNPLA TA L T++ L      +N
Sbjct: 267 GKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQLTPDS-YKN 325

Query: 308 AWQMGEYFKAELTKLA 323
             + G+  +  ++K A
Sbjct: 326 FIKKGDRLEEGISKAA 341


>3du4A [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 447

 Score =  138 bits (347), Expect = 3e-35
 Identities = 115/427 (26%), Positives = 185/427 (43%), Gaps = 55/427 (12%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----K 69
           M  Y   P+ +  G G  V D +G++Y D  S + +N  GH   E+ +A+ KQ+      
Sbjct: 20  MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHS 79

Query: 70  TLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           TLL  +N+    P  +LA+ L++ S     + F+ +SGAEA E A+K+A +Y K    P+
Sbjct: 80  TLLGMTNV----PATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPE 135

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCA- 186
           K + I   N +HG T+  V+      +     PL       P   +   ++   P  C  
Sbjct: 136 KQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPYVYRSESG-DPDECRD 194

Query: 187 -------------------VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQC 227
                                   VQG  G+I   + YL GV++LC    +L+I DEV  
Sbjct: 195 XXXXXXXXXXXXXXXXXXXXXXSMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVAT 254

Query: 228 GLGRTGKFLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAF-------QPGDHA 279
           G GRTGK    +H  V+PD++   K + GG+ PI    A E + +AF       +   H 
Sbjct: 255 GFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHG 314

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXX 339
            ++ GN L    +L  +     + ++E   +  +     L  L A +P V ++R      
Sbjct: 315 HSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMC 373

Query: 340 XXXXXXXXK-------------DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAV 386
                   +              +     E G+L     G+V+ FLPPL  T +E+ + V
Sbjct: 374 GAELVRSKETKEPYPADRRIGYKVSLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMV 432

Query: 387 QILKRAM 393
            I+K+A+
Sbjct: 433 AIMKQAI 439


>2zsmB [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 419

 Score =  133 bits (334), Expect = 1e-33
 Identities = 99/293 (33%), Positives = 141/293 (48%), Gaps = 21/293 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI- 80
           P  + +G+GA+++  DG + +D V       LGH HP V EAV    +  L    +Y   
Sbjct: 30  PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EEALARGWLYGAP 85

Query: 81  -EPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E +V LA K+L          F NSG EA   AI+LAR Y  + L      I+     +
Sbjct: 86  GEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDL------ILKFDGCY 139

Query: 139 HGRTLATVTATGQTKYQRGLDPLPQGFAYV-PFNDLEALKNTI---GPHTCAVMLEPVQG 194
           HG   A + A G      G+         V P+ND+EAL+      G     V++EPV  
Sbjct: 140 HGSHDAVLVAAGGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIA 199

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GVIP  + +L  +++L  E G LLI DEV  G  R G      ++ +E DII L K +
Sbjct: 200 NAGVIPPRREFLAALQRLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKII 258

Query: 255 GGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
           GGGFP+GA+    +V     P     +A TF  +P+   A LAT++ L ++ V
Sbjct: 259 GGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPV 311


>2zsmA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 425

 Score =  133 bits (334), Expect = 1e-33
 Identities = 99/293 (33%), Positives = 141/293 (48%), Gaps = 21/293 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI- 80
           P  + +G+GA+++  DG + +D V       LGH HP V EAV    +  L    +Y   
Sbjct: 36  PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EEALARGWLYGAP 91

Query: 81  -EPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E +V LA K+L          F NSG EA   AI+LAR Y  + L      I+     +
Sbjct: 92  GEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDL------ILKFDGCY 145

Query: 139 HGRTLATVTATGQTKYQRGLDPLPQGFAYV-PFNDLEALKNTI---GPHTCAVMLEPVQG 194
           HG   A + A G      G+         V P+ND+EAL+      G     V++EPV  
Sbjct: 146 HGSHDAVLVAAGGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIA 205

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GVIP  + +L  +++L  E G LLI DEV  G  R G      ++ +E DII L K +
Sbjct: 206 NAGVIPPRREFLAALQRLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKII 264

Query: 255 GGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
           GGGFP+GA+    +V     P     +A TF  +P+   A LAT++ L ++ V
Sbjct: 265 GGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPV 317


>2epjA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 420

 Score =  133 bits (334), Expect = 1e-33
 Identities = 99/293 (33%), Positives = 141/293 (48%), Gaps = 21/293 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI- 80
           P  + +G+GA+++  DG + +D V       LGH HP V EAV    +  L    +Y   
Sbjct: 31  PFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAV----EEALARGWLYGAP 86

Query: 81  -EPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E +V LA K+L          F NSG EA   AI+LAR Y  + L      I+     +
Sbjct: 87  GEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDL------ILKFDGCY 140

Query: 139 HGRTLATVTATGQTKYQRGLDPLPQGFAYV-PFNDLEALKNTI---GPHTCAVMLEPVQG 194
           HG   A + A G      G+         V P+ND+EAL+      G     V++EPV  
Sbjct: 141 HGSHDAVLVAAGGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIA 200

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GVIP  + +L  +++L  E G LLI DEV  G  R G      ++ +E DII L K +
Sbjct: 201 NAGVIPPRREFLAALQRLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKII 259

Query: 255 GGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
           GGGFP+GA+    +V     P     +A TF  +P+   A LAT++ L ++ V
Sbjct: 260 GGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPV 312


>3bv0B [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 414

 Score =  122 bits (306), Expect = 2e-30
 Identities = 100/298 (33%), Positives = 142/298 (47%), Gaps = 22/298 (7%)

Query: 22  PMALVKGQGAW---VWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS-NI 77
           P+  V   GAW   + D    + LD +S       GH HP + +A+  Q++ + H     
Sbjct: 21  PVVAVAAHGAWLTLIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGG 80

Query: 78  YWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
              EP  +LAKLLV+ + A  D  FF +SG+ + E A K+A +Y +    P K  ++T  
Sbjct: 81  LTHEPAARLAKLLVDITPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWR 140

Query: 136 NSFHGRTLATVTATGQTKYQRGL--DPLP-QGFAYVPFNDLE-----ALKNTIGPHT--- 184
             +HG T   ++          L  D L  Q FA     D +     A +  +  H    
Sbjct: 141 GGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGEL 200

Query: 185 CAVMLEPV-QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
            AV++EPV QG GG+      YL  ++ +C    +LLIFDE+  G GRTG      H GV
Sbjct: 201 AAVVVEPVVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGV 260

Query: 244 EPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            PDI+ + KAL GG+  + A L    VA     G    TF  NPLA   S+A++E LL
Sbjct: 261 SPDIMCVGKALTGGYLSLAATLCTADVAHTISAG---PTFMANPLACAVSVASVELLL 315


>3bv0A [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 410

 Score =  122 bits (306), Expect = 2e-30
 Identities = 100/298 (33%), Positives = 142/298 (47%), Gaps = 22/298 (7%)

Query: 22  PMALVKGQGAW---VWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS-NI 77
           P+  V   GAW   + D    + LD +S       GH HP + +A+  Q++ + H     
Sbjct: 20  PVVAVAAHGAWLTLIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGG 79

Query: 78  YWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
              EP  +LAKLLV+ + A  D  FF +SG+ + E A K+A +Y +    P K  ++T  
Sbjct: 80  LTHEPAARLAKLLVDITPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWR 139

Query: 136 NSFHGRTLATVTATGQTKYQRGL--DPLP-QGFAYVPFNDLE-----ALKNTIGPHT--- 184
             +HG T   ++          L  D L  Q FA     D +     A +  +  H    
Sbjct: 140 GGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGEL 199

Query: 185 CAVMLEPV-QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
            AV++EPV QG GG+      YL  ++ +C    +LLIFDE+  G GRTG      H GV
Sbjct: 200 AAVVVEPVVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGV 259

Query: 244 EPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            PDI+ + KAL GG+  + A L    VA     G    TF  NPLA   S+A++E LL
Sbjct: 260 SPDIMCVGKALTGGYLSLAATLCTADVAHTISAG---PTFMANPLACAVSVASVELLL 314


>3drdB [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 417

 Score =  122 bits (305), Expect = 2e-30
 Identities = 107/407 (26%), Positives = 175/407 (42%), Gaps = 43/407 (10%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----K 69
           M  Y   P+ +  G G  V D +G++Y D  S + +N  GH   E+ +A+ KQ+      
Sbjct: 19  MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHS 78

Query: 70  TLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           TLL  +N+    P  +LA+ L++ S     + F+ +SGAEA E A+K+A +Y K    P+
Sbjct: 79  TLLGMTNV----PATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPE 134

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
           K + I          + +  A     Y+       +                        
Sbjct: 135 KQKFIA---------MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXS 185

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +   VQG  G+I   + YL GV++LC    +L+I DEV  G GRTGK    +H  V+PD+
Sbjct: 186 IESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDL 245

Query: 248 ITLAKALGGGF-PIGAMLAKEQVAQAF-------QPGDHASTFGGNPLAATASLATMETL 299
           +   K + GG+ PI    A E + +AF       +   H  ++ GN L    +L  +   
Sbjct: 246 MAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGNQLGCAVALENLALF 305

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----------- 348
             + ++E   +  +     L  L A +P V ++R              +           
Sbjct: 306 ESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKETKEPYPADRRI 364

Query: 349 --DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
              +     E G+L     G+V+ FLPPL  T +E+ + V I+K+A+
Sbjct: 365 GYKVSLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI 410


>3drdA [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 419

 Score =  122 bits (305), Expect = 2e-30
 Identities = 107/407 (26%), Positives = 175/407 (42%), Gaps = 43/407 (10%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----K 69
           M  Y   P+ +  G G  V D +G++Y D  S + +N  GH   E+ +A+ KQ+      
Sbjct: 20  MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHS 79

Query: 70  TLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           TLL  +N+    P  +LA+ L++ S     + F+ +SGAEA E A+K+A +Y K    P+
Sbjct: 80  TLLGMTNV----PATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPE 135

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
           K + I          + +  A     Y+       +                        
Sbjct: 136 KQKFIA---------MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXS 186

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +   VQG  G+I   + YL GV++LC    +L+I DEV  G GRTGK    +H  V+PD+
Sbjct: 187 IESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDL 246

Query: 248 ITLAKALGGGF-PIGAMLAKEQVAQAF-------QPGDHASTFGGNPLAATASLATMETL 299
           +   K + GG+ PI    A E + +AF       +   H  ++ GN L    +L  +   
Sbjct: 247 MAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGNQLGCAVALENLALF 306

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----------- 348
             + ++E   +  +     L  L A +P V ++R              +           
Sbjct: 307 ESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKETKEPYPADRRI 365

Query: 349 --DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
              +     E G+L     G+V+ FLPPL  T +E+ + V I+K+A+
Sbjct: 366 GYKVSLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI 411


>3dodB [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 416

 Score =  122 bits (305), Expect = 2e-30
 Identities = 107/407 (26%), Positives = 175/407 (42%), Gaps = 43/407 (10%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----K 69
           M  Y   P+ +  G G  V D +G++Y D  S + +N  GH   E+ +A+ KQ+      
Sbjct: 17  MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHS 76

Query: 70  TLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           TLL  +N+    P  +LA+ L++ S     + F+ +SGAEA E A+K+A +Y K    P+
Sbjct: 77  TLLGMTNV----PATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPE 132

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
           K + I          + +  A     Y+       +                        
Sbjct: 133 KQKFIA---------MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXS 183

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +   VQG  G+I   + YL GV++LC    +L+I DEV  G GRTGK    +H  V+PD+
Sbjct: 184 IESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDL 243

Query: 248 ITLAKALGGGF-PIGAMLAKEQVAQAF-------QPGDHASTFGGNPLAATASLATMETL 299
           +   K + GG+ PI    A E + +AF       +   H  ++ GN L    +L  +   
Sbjct: 244 MAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGNQLGCAVALENLALF 303

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----------- 348
             + ++E   +  +     L  L A +P V ++R              +           
Sbjct: 304 ESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKETKEPYPADRRI 362

Query: 349 --DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
              +     E G+L     G+V+ FLPPL  T +E+ + V I+K+A+
Sbjct: 363 GYKVSLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI 408


>3dodA [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 417

 Score =  122 bits (305), Expect = 2e-30
 Identities = 107/407 (26%), Positives = 175/407 (42%), Gaps = 43/407 (10%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----K 69
           M  Y   P+ +  G G  V D +G++Y D  S + +N  GH   E+ +A+ KQ+      
Sbjct: 18  MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHS 77

Query: 70  TLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           TLL  +N+    P  +LA+ L++ S     + F+ +SGAEA E A+K+A +Y K    P+
Sbjct: 78  TLLGMTNV----PATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPE 133

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
           K + I          + +  A     Y+       +                        
Sbjct: 134 KQKFIA---------MKSYKAPIPYVYRSESGDPDECRDQCXXXXXXXXXXXXXXXXXXS 184

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +   VQG  G+I   + YL GV++LC    +L+I DEV  G GRTGK    +H  V+PD+
Sbjct: 185 IESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDL 244

Query: 248 ITLAKALGGGF-PIGAMLAKEQVAQAF-------QPGDHASTFGGNPLAATASLATMETL 299
           +   K + GG+ PI    A E + +AF       +   H  ++ GN L    +L  +   
Sbjct: 245 MAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGNQLGCAVALENLALF 304

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----------- 348
             + ++E   +  +     L  L A +P V ++R              +           
Sbjct: 305 ESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKETKEPYPADRRI 363

Query: 349 --DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
              +     E G+L     G+V+ FLPPL  T +E+ + V I+K+A+
Sbjct: 364 GYKVSLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI 409


>2zukB [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
          Length = 426

 Score =  120 bits (302), Expect = 5e-30
 Identities = 102/402 (25%), Positives = 174/402 (43%), Gaps = 45/402 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHP-----EVAEAVCKQVKTLLHCSN 76
           P+A+  G+GA + + +GR+ +D         LG+ HP                T+L  SN
Sbjct: 21  PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXXXXXXTILSASN 80

Query: 77  IYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
                P V LA+ L+ +   +   K +F +SG++ANE A +   K         +  +I 
Sbjct: 81  ----APAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAIVK------ATGRSGVIA 130

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV------ 187
              ++HG T+ ++  +G       L               +A+   +     AV      
Sbjct: 131 FAGAYHGCTVGSMAFSGHADGLILLXXXXXXXXXXXXXTGDAILTLLTEKLAAVPAGSIG 190

Query: 188 --MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
              +EP+Q +GG+I     +L     +C   G+L++ DEV+ GL R+G+   ++H G  P
Sbjct: 191 AAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVP 250

Query: 246 DIITLAKALGGGFPIGAMLAKEQV---AQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
           DI              A++A  ++   A AF       T  GNP++A A LA +ET+ + 
Sbjct: 251 DIXXXXXXXXXXXXXSAVIAPAEILDCASAFA----MQTLHGNPISAAAGLAVLETIDRD 306

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD----------IVA 352
            +   A + G   +  L++LA   PL+ ++R              +           ++ 
Sbjct: 307 DLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSREPARAETAKLIY 366

Query: 353 HCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRA 392
              + GL++     NGNVL F PPL IT+ +I +A+ +L RA
Sbjct: 367 RAYQLGLVVYYVGMNGNVLEFTPPLTITETDIHKALDLLDRA 408


>3dxvA [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
          Length = 422

 Score =  120 bits (300), Expect = 9e-30
 Identities = 106/409 (25%), Positives = 177/409 (43%), Gaps = 63/409 (15%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK-----TLLHCSN 76
           P+A+  G+GA + + +GR+ +D         LG+ HP                T+L  SN
Sbjct: 21  PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXXXXXXTILSASN 80

Query: 77  IYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
                P V LA+ L+ +   +   K +F +SG++ANE A +   K         +  +I 
Sbjct: 81  A----PAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAIVK------ATGRSGVIA 130

Query: 134 ATNSFHGRTLATVTATGQTKYQRG---------------LDPLPQGFAYVPFNDLEALKN 178
              ++HG T+ ++  +G                      L  L +  A VP         
Sbjct: 131 FAGAYHGCTVGSMAFSGLILLXXXXXXXXXXXXXTGDAILTLLTEKLAAVP-------AG 183

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           +IG    A  +EP+Q +GG+I     +L     +C   G+L++ DEV+ GL R+G+   +
Sbjct: 184 SIG----AAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCF 239

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQV---AQAFQPGDHASTFGGNPLAATASLAT 295
           +H G  PDI              A++A  ++   A AF       T  GNP++A A LA 
Sbjct: 240 EHEGFVPDIXXXXXXXXXXXXXSAVIAPAEILDCASAFA----MQTLHGNPISAAAGLAV 295

Query: 296 METLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD------ 349
           +ET+ +  +   A + G   +  L++LA   PL+ ++R              +       
Sbjct: 296 LETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSREPARA 355

Query: 350 ----IVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRA 392
               ++    + GL++     NGNVL F PPL IT+ +I +A+ +L RA
Sbjct: 356 ETAKLIYRAYQLGLVVYYVGMNGNVLEFTPPLTITETDIHKALDLLDRA 404


>2gsaA [c.67.1] GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE
          Length = 427

 Score =  119 bits (297), Expect = 2e-29
 Identities = 96/323 (29%), Positives = 135/323 (41%), Gaps = 27/323 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + + A+ WD DG +Y+D+V        GHAHPEV EA    +K  +     +
Sbjct: 32  GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKVAMEKGTSF 87

Query: 79  WIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                ++     + N      +   F NSG EA    ++L R Y     G DK  II   
Sbjct: 88  GAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYT----GRDK--IIKFE 141

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPH---TC 185
             +HG     +   G      GL   P             P+NDLEA+K     +     
Sbjct: 142 GCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIA 201

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V+LEP+ G  G I     +LEG++++  E   LL+FDEV  G  R       + +GV P
Sbjct: 202 GVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTP 260

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D            P+GA   K ++ Q   P      A T  GNPLA TA + T+E L Q 
Sbjct: 261 DXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQP 320

Query: 303 GVLENAWQMGEYFKAELTKLAAE 325
           G  E   Q+ +     L  +A E
Sbjct: 321 GTYEYLDQITKRLSDGLLAIAQE 343


>2hozA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
          Length = 427

 Score =  118 bits (295), Expect = 3e-29
 Identities = 95/323 (29%), Positives = 135/323 (41%), Gaps = 27/323 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + + A+ WD DG +Y+D+V        GHAHPEV EA    +K  +     +
Sbjct: 32  GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKVAMEKGTSF 87

Query: 79  WIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                ++     + N      +   F NSG EA    +++ R Y     G DK  II   
Sbjct: 88  GAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFE 141

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPH---TC 185
             +HG     +   G      GL   P             P+NDLEA+K     +     
Sbjct: 142 GCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIA 201

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V+LEP+ G  G I     +LEG++++  E   LL+FDEV  G  R       + +GV P
Sbjct: 202 GVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTP 260

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D            P+GA   K ++ Q   P      A T  GNPLA TA + T+E L Q 
Sbjct: 261 DXXXXXXXXXXXXPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQP 320

Query: 303 GVLENAWQMGEYFKAELTKLAAE 325
           G  E   Q+ +     L  +A E
Sbjct: 321 GTYEYLDQITKRLSDGLLAIAQE 343


>2zukA [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
          Length = 422

 Score =  117 bits (293), Expect = 6e-29
 Identities = 107/412 (25%), Positives = 177/412 (42%), Gaps = 70/412 (16%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK-----TLLHCSN 76
           P+A+  G+GA + + +GR+ +D         LG+ HP                T+L  SN
Sbjct: 22  PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXXXXXXTILSASN 81

Query: 77  IYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
                P V LA+ L+ +   +   K +F +SG++ANE A +   K         +  +I 
Sbjct: 82  A----PAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAIVK------ATGRSGVIA 131

Query: 134 ATNSFHGRTLATVT------------------ATGQTKYQRGLDPLPQGFAYVPFNDLEA 175
              ++HG T+ ++                    TG       L  L +  A VP      
Sbjct: 132 FAGAYHGCTVGSMAFGLILLXXXXXXXXXXXXXTGDAI----LTLLTEKLAAVP------ 181

Query: 176 LKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKF 235
              +IG    A  +EP+Q +GG+I     +L     +C   G+L++ DEV+ GL R+G+ 
Sbjct: 182 -AGSIG----AAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRL 236

Query: 236 LGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQV---AQAFQPGDHASTFGGNPLAATAS 292
             ++H G  PDI              A++A  ++   A AF       T  GNP++A A 
Sbjct: 237 HCFEHEGFVPDIXXXXXXXXXXXXXSAVIAPAEILDCASAFA----MQTLHGNPISAAAG 292

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD--- 349
           LA +ET+ +  +   A + G   +  L++LA   PL+ ++R              +    
Sbjct: 293 LAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSREP 352

Query: 350 -------IVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRA 392
                  ++    + GL++     NGNVL F PPL IT+ +I +A+ +L RA
Sbjct: 353 ARAETAKLIYRAYQLGLVVYYVGMNGNVLEFTPPLTITETDIHKALDLLDRA 404


>3dxvB [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
          Length = 434

 Score =  117 bits (292), Expect = 8e-29
 Identities = 106/421 (25%), Positives = 178/421 (42%), Gaps = 75/421 (17%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK-----TLLHCSN 76
           P+A+  G+GA + + +GR+ +D         LG+ HP                T+L  SN
Sbjct: 21  PLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPXXXXXXXXXXXXXXXXTILSASN 80

Query: 77  IYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
                P V LA+ L+ +   +   K +F +SG++ANE A +   K         +  +I 
Sbjct: 81  A----PAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAIVK------ATGRSGVIA 130

Query: 134 ATNSFHGRTLATVTATGQTKYQRG---------------------------LDPLPQGFA 166
              ++HG T+ ++  +G +                                L  L +  A
Sbjct: 131 FAGAYHGCTVGSMAFSGHSVQADAAKADGLILLXXXXXXXXXXXXXTGDAILTLLTEKLA 190

Query: 167 YVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQ 226
            VP         +IG    A  +EP+Q +GG+I     +L     +C   G+L++ DEV+
Sbjct: 191 AVP-------AGSIG----AAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVK 239

Query: 227 CGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQV---AQAFQPGDHASTFG 283
            GL R+G+   ++H G  PDI              A++A  ++   A AF       T  
Sbjct: 240 VGLARSGRLHCFEHEGFVPDIXXXXXXXXXXXXXSAVIAPAEILDCASAFA----MQTLH 295

Query: 284 GNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXX 343
           GNP++A A LA +ET+ +  +   A + G   +  L++LA   PL+ ++R          
Sbjct: 296 GNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMEL 355

Query: 344 XXXXKD----------IVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKR 391
               +           ++    + GL++     NGNVL F PPL IT+ +I +A+ +L R
Sbjct: 356 VCDRQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEFTPPLTITETDIHKALDLLDR 415

Query: 392 A 392
           A
Sbjct: 416 A 416


>2hozB [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
          Length = 420

 Score =  116 bits (291), Expect = 1e-28
 Identities = 92/316 (29%), Positives = 132/316 (41%), Gaps = 20/316 (6%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + + A+ WD DG +Y+D+V        GHAHPEV EA    +K  +     +
Sbjct: 32  GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKVAMEKGTSF 87

Query: 79  WIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                ++     + N      +   F NSG EA    +++ R Y     G DK  II   
Sbjct: 88  GAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFE 141

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH---TCAVMLEPV 192
             +HG     +   G                  P+NDLEA+K     +      V+LEP+
Sbjct: 142 GCYHGHADMFLVKAGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPI 201

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
            G  G I     +LEG++++  E   LL+FDEV  G  R       + +GV PD      
Sbjct: 202 VGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXX 260

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLENAW 309
                 P+GA   K ++ Q   P      A T  GNPLA TA + T+E L Q G  E   
Sbjct: 261 XXXXXXPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLD 320

Query: 310 QMGEYFKAELTKLAAE 325
           Q+ +     L  +A E
Sbjct: 321 QITKRLSDGLLAIAQE 336


>1qj3B [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
          Length = 415

 Score =  115 bits (289), Expect = 2e-28
 Identities = 88/297 (29%), Positives = 142/297 (47%), Gaps = 18/297 (6%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL-DPLPQGFAYVPFNDLEALK 177
           Y  Q  G  +   +T  N +HG T   ++          L  P PQ        D+    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNLPENLFAPAPQSRMEWDERDMVGFA 184

Query: 178 NTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
             +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI DE+  G GRTG
Sbjct: 185 RLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTG 244

Query: 234 KFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
           K    +H  + PDI+ L KAL GG   + A L   +VA+    G    H  TF GNP
Sbjct: 245 KLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGGCFMHGPTFMGNP 301


>2jjfA [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE
          Length = 435

 Score =  115 bits (289), Expect = 2e-28
 Identities = 109/414 (26%), Positives = 172/414 (41%), Gaps = 46/414 (11%)

Query: 25  LVKGQGAWVWDA-DGRQYLDFVSGIAVNCLG----------HAHPEVAEAVCKQVKTLLH 73
           L +  G+++ DA  GR+YLD  + +A + LG            H E+ +A   +      
Sbjct: 25  LTRSGGSYLVDAITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSN--- 81

Query: 74  CSNIYWIEPQ--VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHL---GPDK 128
            S++Y +     V+    ++ +      FF   GA A E A+K A  +  +H    G D 
Sbjct: 82  -SDVYSVAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNQAHGIDP 140

Query: 129 Y---EIITATNSFHGRTLATVTATG-----------------QTKYQR-GLDPLPQGFAY 167
               +++    +FHGR+  T++ T                     Y R GLD        
Sbjct: 141 ALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMRPGLDEPXXXXXX 200

Query: 168 VPFNDLEALKNTIGPHTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQ 226
                         PH  A  + EP+QGEGG       +   +++LC+E   LLIFDEVQ
Sbjct: 201 XXXXXXXXXXFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQ 260

Query: 227 CGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQ-PGDHASTFGGN 285
            G G TG    YQ   V PDI+   K       +      E     F  P   AST+GGN
Sbjct: 261 TGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLASTWGGN 320

Query: 286 PLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLV---KEVRXXXXXXXXX 342
                 +   +E +  +G+ E A Q G+Y +A L +LAA+ P V      R         
Sbjct: 321 LTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLP 380

Query: 343 XXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                 +++    ++ +++     + +RF PPL ++  EID A+  ++ A+ VV
Sbjct: 381 TTADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV 434


>2hoyA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
          Length = 402

 Score =  115 bits (288), Expect = 2e-28
 Identities = 93/316 (29%), Positives = 132/316 (41%), Gaps = 38/316 (12%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + + A+ WD DG +Y+D+V        GHAHPEV EA    +K  +     +
Sbjct: 32  GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKVAMEKGTSF 87

Query: 79  WIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                ++     + N      +   F NSG EA    +++ R Y     G DK  II   
Sbjct: 88  GAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFE 141

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH---TCAVMLEPV 192
             +HG      T T                   P+NDLEA+K     +      V+LEP+
Sbjct: 142 GCYHGHADMANTLT------------------TPYNDLEAVKALFAENPGEIAGVILEPI 183

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
            G  G I     +LEG++++  E   LL+FDEV  G  R       + +GV PD      
Sbjct: 184 VGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXX 242

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLENAW 309
                 P+GA   K ++ Q   P      A T  GNPLA TA + T+E L Q G  E   
Sbjct: 243 XXXXXXPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLD 302

Query: 310 QMGEYFKAELTKLAAE 325
           Q+ +     L  +A E
Sbjct: 303 QITKRLSDGLLAIAQE 318


>2hp1B [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
          Length = 398

 Score =  114 bits (286), Expect = 4e-28
 Identities = 92/316 (29%), Positives = 131/316 (41%), Gaps = 42/316 (13%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + + A+ WD DG +Y+D+V        GHAHPEV EA    +K  +     +
Sbjct: 32  GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKVAMEKGTSF 87

Query: 79  WIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                ++     + N      +   F NSG EA    +++ R Y     G DK  II   
Sbjct: 88  GAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYT----GRDK--IIKFE 141

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH---TCAVMLEPV 192
             +HG    T                       P+NDLEA+K     +      V+LEP+
Sbjct: 142 GCYHGHNTLT----------------------TPYNDLEAVKALFAENPGEIAGVILEPI 179

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
            G  G I     +LEG++++  E   LL+FDEV  G  R       + +GV PD      
Sbjct: 180 VGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXX 238

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLENAW 309
                 P+GA   K ++ Q   P      A T  GNPLA TA + T+E L Q G  E   
Sbjct: 239 XXXXXXPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLD 298

Query: 310 QMGEYFKAELTKLAAE 325
           Q+ +     L  +A E
Sbjct: 299 QITKRLSDGLLAIAQE 314


>2cinA [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE
          Length = 435

 Score =  113 bits (283), Expect = 8e-28
 Identities = 108/414 (26%), Positives = 171/414 (41%), Gaps = 46/414 (11%)

Query: 25  LVKGQGAWVWDA-DGRQYLDFVSGIAVNCLG----------HAHPEVAEAVCKQVKTLLH 73
           L +  G+++ DA  GR+YLD  + +A + LG            H E+ +A   +      
Sbjct: 25  LTRSGGSYLVDAITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSN--- 81

Query: 74  CSNIYWIEPQ--VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHL---GPDK 128
            S++Y +     V+    ++ +      FF   GA A E A+K A  +  +H    G D 
Sbjct: 82  -SDVYSVAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNQAHGIDP 140

Query: 129 Y---EIITATNSFHGRTLATVTATG-----------------QTKYQR-GLDPLPQGFAY 167
               +++    +FHGR+  T++ T                     Y R GLD        
Sbjct: 141 ALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMRPGLDEPXXXXXX 200

Query: 168 VPFNDLEALKNTIGPHTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQ 226
                         PH  A  + EP+QGEGG       +   +++LC+E   LLIFDEVQ
Sbjct: 201 XXXXXXXXXXFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQ 260

Query: 227 CGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQ-PGDHASTFGGN 285
            G G TG    YQ   V PDI+   K       +      E     F  P    ST+GGN
Sbjct: 261 TGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGN 320

Query: 286 PLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLV---KEVRXXXXXXXXX 342
                 +   +E +  +G+ E A Q G+Y +A L +LAA+ P V      R         
Sbjct: 321 LTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLP 380

Query: 343 XXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                 +++    ++ +++     + +RF PPL ++  EID A+  ++ A+ VV
Sbjct: 381 TTADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV 434


>1qj3A [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
          Length = 416

 Score =  112 bits (281), Expect = 1e-27
 Identities = 88/298 (29%), Positives = 142/298 (47%), Gaps = 19/298 (6%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL-DPLPQG-FAYVPFNDLEAL 176
           Y  Q  G  +   +T  N +HG T   ++          L  P PQ         D+   
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNLPENLFAPAPQSRMGEWDERDMVGF 184

Query: 177 KNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
              +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI DE+  G GRT
Sbjct: 185 ARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRT 244

Query: 233 GKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
           GK    +H  + PDI+ L KAL GG   + A L   +VA+    G    H  TF GNP
Sbjct: 245 GKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGGCFMHGPTFMGNP 302


>2hoyB [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
          Length = 393

 Score =  112 bits (281), Expect = 1e-27
 Identities = 94/316 (29%), Positives = 132/316 (41%), Gaps = 47/316 (14%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + + A+ WD DG +Y+D+V        GHAHPEV EA    +K  +     +
Sbjct: 32  GGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEA----LKVAMEKGTSF 87

Query: 79  WIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                ++     + N      +   F NSG EA    +++ R Y     G DK  II   
Sbjct: 88  GAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYT----GRDK--II--- 138

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH---TCAVMLEPV 192
             F G TL T                       P+NDLEA+K     +      V+LEP+
Sbjct: 139 -KFEGNTLTT-----------------------PYNDLEAVKALFAENPGEIAGVILEPI 174

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
            G  G I     +LEG++++  E   LL+FDEV  G  R       + +GV PD      
Sbjct: 175 VGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDXXXXXX 233

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLENAW 309
                 P+GA   K ++ Q   P      A T  GNPLA TA + T+E L Q G  E   
Sbjct: 234 XXXXXXPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLD 293

Query: 310 QMGEYFKAELTKLAAE 325
           Q+ +     L  +A E
Sbjct: 294 QITKRLSDGLLAIAQE 309


>2jjeA [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE
          Length = 435

 Score =  112 bits (279), Expect = 2e-27
 Identities = 107/414 (25%), Positives = 171/414 (41%), Gaps = 46/414 (11%)

Query: 25  LVKGQGAWVWDA-DGRQYLDFVSGIAVNCLG----------HAHPEVAEAVCKQVKTLLH 73
           L +  G+++ DA  GR+YLD  + +A + LG            H E+ +A   +      
Sbjct: 25  LTRSGGSYLVDAITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSN--- 81

Query: 74  CSNIYWIEPQ--VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHL---GPDK 128
            S++Y +     V+    ++ +      FF   GA A E A+K A  +  +H    G D 
Sbjct: 82  -SDVYSVAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNQAHGIDP 140

Query: 129 Y---EIITATNSFHGRTLATVTATG-----------------QTKYQR-GLDPLPQGFAY 167
               +++    +FHGR+  T++ T                     Y R GLD        
Sbjct: 141 ALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMRPGLDEPXXXXXX 200

Query: 168 VPFNDLEALKNTIGPHTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQ 226
                         PH  A  + EP+QGEGG       +   +++LC+E   LLIFDEVQ
Sbjct: 201 XXXXXXXXXXFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQ 260

Query: 227 CGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQ-PGDHASTFGGN 285
            G G TG    YQ   V PDI+   K       +      E     F  P    S++GGN
Sbjct: 261 TGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSSWGGN 320

Query: 286 PLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLV---KEVRXXXXXXXXX 342
                 +   +E +  +G+ E A Q G+Y +A L +LAA+ P V      R         
Sbjct: 321 LTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLP 380

Query: 343 XXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                 +++    ++ +++     + +RF PPL ++  EID A+  ++ A+ VV
Sbjct: 381 TTADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV 434


>2jjhA [x.x.x] L-LYSINE EPSILON AMINOTRANSFERASE
          Length = 435

 Score =  111 bits (277), Expect = 4e-27
 Identities = 107/414 (25%), Positives = 170/414 (41%), Gaps = 46/414 (11%)

Query: 25  LVKGQGAWVWDA-DGRQYLDFVSGIAVNCLG----------HAHPEVAEAVCKQVKTLLH 73
           L +  G+++ DA  GR+YLD  + +A + LG            H E+ +A   +      
Sbjct: 25  LTRSGGSYLVDAITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSN--- 81

Query: 74  CSNIYWIEPQ--VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHL---GPDK 128
            S++Y +     V+    ++ +      FF   GA A E A+K A  +  +H    G D 
Sbjct: 82  -SDVYSVAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNQAHGIDP 140

Query: 129 Y---EIITATNSFHGRTLATVTATG-----------------QTKYQR-GLDPLPQGFAY 167
               +++    +FHGR+  T++ T                     Y R GLD        
Sbjct: 141 ALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMRPGLDEPXXXXXX 200

Query: 168 VPFNDLEALKNTIGPHTCAVML-EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQ 226
                         PH  A  + EP+QG GG       +   +++LC+E   LLIFDEVQ
Sbjct: 201 XXXXXXXXXXFETRPHDIACFVAEPIQGAGGDRHFRPEFFAAMRELCDEFDALLIFDEVQ 260

Query: 227 CGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQ-PGDHASTFGGN 285
            G G TG    YQ   V PDI+   K       +      E     F  P    ST+GGN
Sbjct: 261 TGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGN 320

Query: 286 PLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLV---KEVRXXXXXXXXX 342
                 +   +E +  +G+ E A Q G+Y +A L +LAA+ P V      R         
Sbjct: 321 LTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLP 380

Query: 343 XXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
                 +++    ++ +++     + +RF PPL ++  EID A+  ++ A+ VV
Sbjct: 381 TTADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV 434


>1qj5A [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
          Length = 428

 Score =  110 bits (276), Expect = 5e-27
 Identities = 90/309 (29%), Positives = 147/309 (47%), Gaps = 30/309 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMGE 184

Query: 172 ----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFD 223
               D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI D
Sbjct: 185 WDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIAD 244

Query: 224 EVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD----- 277
           E+  G GRTGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+     
Sbjct: 245 EIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCFM 304

Query: 278 HASTFGGNP 286
           H  TF GNP
Sbjct: 305 HGPTFMGNP 313


>1mlyA [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
          Length = 427

 Score =  110 bits (276), Expect = 5e-27
 Identities = 90/309 (29%), Positives = 147/309 (47%), Gaps = 30/309 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMGE 184

Query: 172 ----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFD 223
               D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI D
Sbjct: 185 WDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIAD 244

Query: 224 EVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD----- 277
           E+  G GRTGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+     
Sbjct: 245 EIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCFM 304

Query: 278 HASTFGGNP 286
           H  TF GNP
Sbjct: 305 HGPTFMGNP 313


>1s09A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 426

 Score =  110 bits (275), Expect = 7e-27
 Identities = 88/308 (28%), Positives = 144/308 (46%), Gaps = 29/308 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N FHG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGFHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMGE 184

Query: 172 ----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFD 223
               D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI D
Sbjct: 185 WDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIAD 244

Query: 224 EVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD-----H 278
           E+  G GRTGK    +H  + PDI+ L    GG   + A L   +VA+    G+     H
Sbjct: 245 EIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEAGCFMH 304

Query: 279 ASTFGGNP 286
             TF GNP
Sbjct: 305 GPTFMGNP 312


>1qj5B [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
          Length = 429

 Score =  110 bits (275), Expect = 7e-27
 Identities = 90/310 (29%), Positives = 147/310 (47%), Gaps = 31/310 (10%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---- 277
           DE+  G GRTGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+    
Sbjct: 245 DEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCF 304

Query: 278 -HASTFGGNP 286
            H  TF GNP
Sbjct: 305 MHGPTFMGNP 314


>1mlyB [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
          Length = 428

 Score =  110 bits (275), Expect = 7e-27
 Identities = 90/310 (29%), Positives = 147/310 (47%), Gaps = 31/310 (10%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---- 277
           DE+  G GRTGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+    
Sbjct: 245 DEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCF 304

Query: 278 -HASTFGGNP 286
            H  TF GNP
Sbjct: 305 MHGPTFMGNP 314


>1mgvA [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
          Length = 428

 Score =  110 bits (275), Expect = 7e-27
 Identities = 90/310 (29%), Positives = 147/310 (47%), Gaps = 31/310 (10%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---- 277
           DE+  G GRTGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+    
Sbjct: 245 DEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCF 304

Query: 278 -HASTFGGNP 286
            H  TF GNP
Sbjct: 305 MHGPTFMGNP 314


>1s09B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 427

 Score =  110 bits (274), Expect = 9e-27
 Identities = 88/309 (28%), Positives = 144/309 (46%), Gaps = 30/309 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N FHG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGFHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD----- 277
           DE+  G GRTGK    +H  + PDI+ L    GG   + A L   +VA+    G+     
Sbjct: 245 DEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEAGCFM 304

Query: 278 HASTFGGNP 286
           H  TF GNP
Sbjct: 305 HGPTFMGNP 313


>1s08A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 410

 Score =  110 bits (274), Expect = 9e-27
 Identities = 84/294 (28%), Positives = 138/294 (46%), Gaps = 18/294 (6%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQG-FAYVPFNDLEALK 177
           Y  Q  G  +   +T  N +HG T   ++            P PQ         D+    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGNTFGAMSVCDPENL---FAPAPQSRMGEWDERDMVGFA 181

Query: 178 NTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
             +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI DE+  G GRTG
Sbjct: 182 RLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTG 241

Query: 234 KFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPG-DHASTFGGNP 286
           K    +H  + PDI+ L    GG   + A L   +VA+    G  H  TF GNP
Sbjct: 242 KLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGFMHGPTFMGNP 295


>1s07B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 428

 Score =  108 bits (269), Expect = 3e-26
 Identities = 89/310 (28%), Positives = 146/310 (47%), Gaps = 31/310 (10%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---- 277
           DE+  G G TGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+    
Sbjct: 245 DEIATGFGATGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCF 304

Query: 278 -HASTFGGNP 286
            H  TF GNP
Sbjct: 305 MHGPTFMGNP 314


>1s07A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 429

 Score =  108 bits (269), Expect = 3e-26
 Identities = 89/310 (28%), Positives = 146/310 (47%), Gaps = 31/310 (10%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---- 277
           DE+  G G TGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+    
Sbjct: 245 DEIATGFGATGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCF 304

Query: 278 -HASTFGGNP 286
            H  TF GNP
Sbjct: 305 MHGPTFMGNP 314


>1s06A [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 427

 Score =  108 bits (269), Expect = 3e-26
 Identities = 86/308 (27%), Positives = 144/308 (46%), Gaps = 29/308 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMGE 184

Query: 172 ----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFD 223
               D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI D
Sbjct: 185 WDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIAD 244

Query: 224 EVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD-----H 278
           E+  G G+TGK    +H  + PDI+ L    GG   + A L   +VA+    G+     H
Sbjct: 245 EIATGFGKTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEAGCFMH 304

Query: 279 ASTFGGNP 286
             TF GNP
Sbjct: 305 GPTFMGNP 312


>1s0aA [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 427

 Score =  107 bits (268), Expect = 5e-26
 Identities = 86/308 (27%), Positives = 144/308 (46%), Gaps = 29/308 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ +  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPFTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMGE 184

Query: 172 ----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFD 223
               D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI D
Sbjct: 185 WDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIAD 244

Query: 224 EVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD-----H 278
           E+  G GRTGK    +H  + PDI+ L    GG   + A L   +VA+    G+     H
Sbjct: 245 EIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEAGCFMH 304

Query: 279 ASTFGGNP 286
             TF GNP
Sbjct: 305 GPTFMGNP 312


>1s06B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 427

 Score =  107 bits (268), Expect = 5e-26
 Identities = 86/309 (27%), Positives = 144/309 (46%), Gaps = 30/309 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD----- 277
           DE+  G G+TGK    +H  + PDI+ L    GG   + A L   +VA+    G+     
Sbjct: 245 DEIATGFGKTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEAGCFM 304

Query: 278 HASTFGGNP 286
           H  TF GNP
Sbjct: 305 HGPTFMGNP 313


>1s0aB [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 427

 Score =  107 bits (267), Expect = 6e-26
 Identities = 86/309 (27%), Positives = 144/309 (46%), Gaps = 30/309 (9%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ +  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPFTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y  Q  G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD----- 277
           DE+  G GRTGK    +H  + PDI+ L    GG   + A L   +VA+    G+     
Sbjct: 245 DEIATGFGRTGKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNGEAGCFM 304

Query: 278 HASTFGGNP 286
           H  TF GNP
Sbjct: 305 HGPTFMGNP 313


>1s08B [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 409

 Score =  107 bits (267), Expect = 6e-26
 Identities = 83/295 (28%), Positives = 140/295 (47%), Gaps = 20/295 (6%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  Q+++++ Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN--DLEAL 176
           Y  Q  G  +   +T  N +HG T   ++      +     P PQ      ++  D+   
Sbjct: 126 YW-QAKGEARQRFLTFRNGYHGNTFGAMSVCDPNLFA----PAPQSRMDGEWDERDMVGF 180

Query: 177 KNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
              +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI DE+  G GRT
Sbjct: 181 ARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRT 240

Query: 233 GKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQP-GDHASTFGGNP 286
           GK    +H  + PDI+ L    GG   + A L   +VA+       H  TF GNP
Sbjct: 241 GKLFACEHAEIAPDILCLGALTGGTMTLSATLTTREVAETISNCFMHGPTFMGNP 295


>1dtyA [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
          Length = 429

 Score =  106 bits (265), Expect = 1e-25
 Identities = 88/310 (28%), Positives = 145/310 (46%), Gaps = 31/310 (10%)

Query: 7   LAMGQQYVMNTYGRLPMAL-----VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           LA  ++++ + Y  +   L     V  +G  +  +DGR+ +D +S       G+ HP++ 
Sbjct: 6   LAFDERHIWHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLN 65

Query: 62  EAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARK 118
            A+  Q+  + H         P ++L + LV  +    +  F  +SG+ A E A+K+A +
Sbjct: 66  AAMKSQIDAMSHVMFGEITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQ 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQG-FAYVPFN---- 171
           Y     G  +   +T  N +HG T   ++          L    LP+  FA  P +    
Sbjct: 126 YWDAK-GEARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG 184

Query: 172 -----DLEALKNTIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                D+      +  H     AV++EP VQG GG+      +L+ ++++C+ +G+LLI 
Sbjct: 185 EWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIA 244

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL-GGGFPIGAMLAKEQVAQAFQPGD---- 277
           DE+  G GRTGK    +H  + PDI+ L KAL GG   + A L   +VA+    G+    
Sbjct: 245 DEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEAGCF 304

Query: 278 -HASTFGGNP 286
            H  TF GNP
Sbjct: 305 MHGPTFMGNP 314


>2e7uA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 424

 Score =  102 bits (254), Expect = 2e-24
 Identities = 84/282 (29%), Positives = 129/282 (45%), Gaps = 24/282 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  LV+G+GA+VWDADG +YLD+V       LGHAHP+V   V + ++  L      
Sbjct: 32  GGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPS 91

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  V LAK +       D   F NSG EA   A++LAR Y        +  I+    +
Sbjct: 92  PLE--VALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYT------GRPYIVKFRGN 143

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFA----YVPFNDLEALKNTI---GPHTCAV 187
           +HG     +   G      G+     +P+ +A     + +ND E L+  +   G    A+
Sbjct: 144 YHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           + EPV G  GV+   + +L+ + +  +  G+LLI DEV  G  R       +  G++PD+
Sbjct: 204 IFEPVVGNAGVLVPTEDFLKALHE-AKAYGVLLIADEVMTGF-RLAFGGATELLGLKPDL 261

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
           +TL K             + ++ +   P      A T  GNP
Sbjct: 262 VTLGKIXXXXXXXXXXXXRREIMEKVAPLGPVYQAGTLSGNP 303


>3i4jB [x.x.x] AMINOTRANSFERASE, CLASS III
          Length = 386

 Score = 96.3 bits (238), Expect = 1e-22
 Identities = 85/282 (30%), Positives = 128/282 (45%), Gaps = 16/282 (5%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL--LHCSNI---YWI 80
           V+G+G +++D  GR+YLD  SG  V  +GH   EV E +  Q   L  +H S        
Sbjct: 14  VRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSQFSSDVLE 73

Query: 81  EPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
           E   +LA+ +       + +  + G+EA E A+KLAR+Y  +   P ++++IT   S   
Sbjct: 74  EYAGRLARFV--GLPTFRFWAVSGGSEATESAVKLARQYHVERGEPGRFKVITRVPS--- 128

Query: 141 RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHT-CAVMLEPVQG-EGGV 198
           R L T     +  + +   P P          L AL    GP T  A M EPV G     
Sbjct: 129 RELYTPLMRPEA-WPKLPKPDPARNGAEDAEGLRALLEREGPETVAAFMAEPVVGASDAA 187

Query: 199 IPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY-GVEPDI-ITLAKALGG 256
           +  A  Y E V+ +C+E G++ I DEV  G+GR G  L    + GV PDI +        
Sbjct: 188 LAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWSGVTPDIAVXXXXXXXX 247

Query: 257 GFPIGAMLAKEQVAQAFQPG-DHASTFGGNPLAATASLATME 297
                      QV +    G  H  T+ G+P++  A L+ ++
Sbjct: 248 XXXXXXXXXXPQVYETVMGGFMHGFTYAGHPVSVAAGLSVLD 289


>3i4jA [x.x.x] AMINOTRANSFERASE, CLASS III
          Length = 379

 Score = 93.2 bits (230), Expect = 1e-21
 Identities = 82/285 (28%), Positives = 124/285 (43%), Gaps = 27/285 (9%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL--LHCSNI---YWI 80
           V+G+G +++D  GR+YLD  SG  V  +GH   EV E +  Q   L  +H S        
Sbjct: 14  VRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSQFSSDVLE 73

Query: 81  EPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
           E   +LA+ +       + +  + G+EA E A+KLAR+Y  +   P ++++IT   S   
Sbjct: 74  EYAGRLARFV--GLPTFRFWAVSGGSEATESAVKLARQYHVERGEPGRFKVITRVPS--- 128

Query: 141 RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHT-CAVMLEPVQG-EGGV 198
                        + +   P P          L AL    GP T  A M EPV G     
Sbjct: 129 ---------RPEAWPKLPKPDPARNGAEDAEGLRALLEREGPETVAAFMAEPVVGASDAA 179

Query: 199 IPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY-GVEPDI-ITLAKALGG 256
           +  A  Y E V+ +C+E G++ I DEV  G+GR G  L    + GV PDI +        
Sbjct: 180 LAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWSGVTPDIAVXXXXXXXX 239

Query: 257 GFPIGAMLAKEQVAQAFQPGD----HASTFGGNPLAATASLATME 297
                      QV +    G     H  T+ G+P++  A L+ ++
Sbjct: 240 XXXXXXXXXXPQVYETVMGGSGAFMHGFTYAGHPVSVAAGLSVLD 284


>1ohvA [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE
          Length = 461

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 87/407 (21%), Positives = 164/407 (40%), Gaps = 63/407 (15%)

Query: 27  KGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCK--QVKTLLHCSNIYWIEPQV 84
           + +G ++ D DG + LD  S I+   +G++HP + + V +   V T ++   +  + P+ 
Sbjct: 41  ESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALGILPPEN 100

Query: 85  KLAKLL-----VENSCADKAFFCNSGAEANEGAIKLA-----------RKYAKQHL---- 124
            + KL      V      +      G+ +NE A K               ++K+ L    
Sbjct: 101 FVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYRSKERGQSAFSKEELETCM 160

Query: 125 -----GPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPF--------- 170
                G   Y I++   +FHGRT+  + AT  +K    +D     +   PF         
Sbjct: 161 INQAPGCPDYSILSFMGAFHGRTMGCL-ATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEE 219

Query: 171 ----------NDLEALKNTIGPH------TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCE 214
                       LE +++ I  +         +++EP+Q EGG   A+  +   ++ +  
Sbjct: 220 FVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISR 279

Query: 215 EKGLLLIFDEVQCGLGRTGKFLGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQA 272
           + G   + DEVQ G G TGKF  ++H+G++   D++T +K +      G    KE+  + 
Sbjct: 280 KHGCAFLVDEVQTGGGSTGKFWAHEHWGLDDPADVMTFSKKM----MTGGFFHKEEF-RP 334

Query: 273 FQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKE 331
             P    +T+ G+P         +  + ++ +L NA   G+     L  L A  P  +  
Sbjct: 335 NAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISR 394

Query: 332 V--RXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLI 376
           V  R                +++    +G+++       +RF P L+
Sbjct: 395 VRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGDKSIRFRPTLV 441


>1gtxA [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
          Length = 462

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 87/407 (21%), Positives = 164/407 (40%), Gaps = 63/407 (15%)

Query: 27  KGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCK--QVKTLLHCSNIYWIEPQV 84
           + +G ++ D DG + LD  S I+   +G++HP + + V +   V T ++   +  + P+ 
Sbjct: 41  ESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALGILPPEN 100

Query: 85  KLAKLL-----VENSCADKAFFCNSGAEANEGAIKLA-----------RKYAKQHL---- 124
            + KL      V      +      G+ +NE A K               ++K+ L    
Sbjct: 101 FVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYRSKERGQSAFSKEELETCM 160

Query: 125 -----GPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPF--------- 170
                G   Y I++   +FHGRT+  + AT  +K    +D     +   PF         
Sbjct: 161 INQAPGCPDYSILSFMGAFHGRTMGCL-ATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEE 219

Query: 171 ----------NDLEALKNTIGPH------TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCE 214
                       LE +++ I  +         +++EP+Q EGG   A+  +   ++ +  
Sbjct: 220 FVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISR 279

Query: 215 EKGLLLIFDEVQCGLGRTGKFLGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQA 272
           + G   + DEVQ G G TGKF  ++H+G++   D++T +K +      G    KE+  + 
Sbjct: 280 KHGCAFLVDEVQTGGGSTGKFWAHEHWGLDDAADVMTFSKKM----MTGGFFHKEEF-RP 334

Query: 273 FQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKE 331
             P    +T+ G+P         +  + ++ +L NA   G+     L  L A  P  +  
Sbjct: 335 NAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISR 394

Query: 332 V--RXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLI 376
           V  R                +++    +G+++       +RF P L+
Sbjct: 395 VRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGDKSIRFRPTLV 441


>2cy8A [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
          Length = 402

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 67/304 (22%), Positives = 102/304 (33%), Gaps = 49/304 (16%)

Query: 29  QGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK-----TLLHCSNIYWIEPQ 83
           QG    D DG  YLDF             P V  A+ + +         H   + W E  
Sbjct: 40  QGVHKTDVDGNVYLDFFXXXXXXXXXXXXPRVNAAIAEALSHGVQYAASHPLEVRWAE-- 97

Query: 84  VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTL 143
               +++       K  F  SG E    A+++AR +  + +             F G T 
Sbjct: 98  ----RIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRM----------ILRFEGTTA 143

Query: 144 ATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH---TCAVMLEPVQGEGGVIP 200
            T+                     +  +D+E ++     H     A + EPV    GV P
Sbjct: 144 NTLL--------------------IRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTP 183

Query: 201 AAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPI 260
            + ++L    +L  + G L I DEV  G  R G         V+PD+  LAKA       
Sbjct: 184 VSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAXXXXX 242

Query: 261 GAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELT 320
                +E V      G    +F GNP             L+  V      +G++ +  + 
Sbjct: 243 XXXXXREDVMGVLSRG----SFTGNPXXXXXXXXXXXXXLEDDVCAKINDLGQFAREAMN 298

Query: 321 KLAA 324
            L A
Sbjct: 299 HLFA 302


>1wyuB [x.x.x] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN)
          Length = 473

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 13/121 (10%)

Query: 104 SGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQ-RGLDPLP 162
           +GA      I + R Y +         ++   +S HG   AT +  G   YQ R +   P
Sbjct: 130 AGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAG---YQVREIPSGP 186

Query: 163 QGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
           +G       DLEALK  +GPH  A+ML         +   +  +  + +LC+E G+ L +
Sbjct: 187 EGEV-----DLEALKRELGPHVAALMLT----NPNTLGLFERRILEISRLCKEAGVQLYY 237

Query: 223 D 223
           D
Sbjct: 238 D 238


>1wytB [x.x.x] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN)
          Length = 471

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 13/121 (10%)

Query: 104 SGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQ-RGLDPLP 162
           +GA      I + R Y +         ++   +S HG   AT +  G   YQ R +   P
Sbjct: 130 AGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAG---YQVREIPSGP 186

Query: 163 QGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
           +G       DLEALK  +GPH  A+ML         +   +  +  + +LC+E G+ L +
Sbjct: 187 EGEV-----DLEALKRELGPHVAALMLT----NPNTLGLFERRILEISRLCKEAGVQLYY 237

Query: 223 D 223
           D
Sbjct: 238 D 238


>1o4sB [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 384

 Score = 34.7 bits (78), Expect = 5e-04
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 6/130 (4%)

Query: 173 LEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
           LE ++  +   T AV++       GV+   + +LEG+ +L +++   +I DEV   L  T
Sbjct: 160 LEEVEGLLVGKTKAVLINSPNNPTGVVYRRE-FLEGLVRLAKKRNFYIISDEVYDSLVYT 218

Query: 233 GKFLGYQHYGVEPDIITLAKALG-----GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPL 287
            +F          D I             G+ +G +++ E+VA A       +T   N +
Sbjct: 219 DEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTV 278

Query: 288 AATASLATME 297
           A  A+L  +E
Sbjct: 279 AQYAALKALE 288


>1o4sA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 375

 Score = 34.7 bits (78), Expect = 5e-04
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 6/130 (4%)

Query: 173 LEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
           LE ++  +   T AV++       GV+   + +LEG+ +L +++   +I DEV   L  T
Sbjct: 151 LEEVEGLLVGKTKAVLINSPNNPTGVVYRRE-FLEGLVRLAKKRNFYIISDEVYDSLVYT 209

Query: 233 GKFLGYQHYGVEPDIITLAKALG-----GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPL 287
            +F          D I             G+ +G +++ E+VA A       +T   N +
Sbjct: 210 DEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTV 269

Query: 288 AATASLATME 297
           A  A+L  +E
Sbjct: 270 AQYAALKALE 279


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 979,422,137
Number of extensions: 40523465
Number of successful extensions: 107571
Number of sequences better than 1.0e-03: 1896
Number of HSP's gapped: 104844
Number of HSP's successfully gapped: 2411
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)