BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO49801.1 dred0 ABO49801.1 GIB00494CH01 "integral membrane
sensor hybrid histidine kinase"
         (916 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3dgeA [x.x.x] SENSOR PROTEIN                                          105   7e-25
2c2aA [x.x.x] SENSOR HISTIDINE KINASE                                  97   2e-22
1w25A [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION C...    75   8e-16
2v0nA [x.x.x] RESPONSE REGULATOR PLED                                  75   8e-16
1m5tA [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK                   75   1e-15
2zwmA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF                  72   6e-15
1nxpA [c.23.1] DNA-BINDING RESPONSE REGULATOR                          71   1e-14
3dgfC [x.x.x] RESPONSE REGULATOR                                       71   1e-14
3dgeC [x.x.x] RESPONSE REGULATOR                                       71   1e-14
2a9oA [x.x.x] RESPONSE REGULATOR                                       71   1e-14
3gt7A [x.x.x] SENSOR PROTEIN                                           67   2e-13
1mvoA [c.23.1] PHOP RESPONSE REGULATOR                                 65   6e-13
2a9rA [x.x.x] DNA-BINDING RESPONSE REGULATOR                           64   2e-12
2ayzA [x.x.x] SENSOR KINASE PROTEIN RCSC                               64   2e-12
2ayxA [x.x.x] SENSOR KINASE PROTEIN RCSC                               64   2e-12
1p6qA [c.23.1] CHEY2                                                   61   1e-11
1mb3A [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK                   60   3e-11
1mavA [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK                   60   3e-11
1zesC [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             58   1e-10
1zesA [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             58   1e-10
2iynB [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             58   1e-10
1b00A [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY            58   1e-10
2r25B [x.x.x] OSMOSENSING HISTIDINE PROTEIN KINASE SLN1                58   1e-10
1oxkB [c.23.1] SLN1                                                    58   1e-10
1oxbB [c.23.1] SLN1                                                    58   1e-10
1m5uA [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK                   58   1e-10
2a9qA [x.x.x] RESPONSE REGULATOR                                       57   2e-10
1sd5A [c.23.1] PUTATIVE ANTITERMINATOR                                 57   3e-10
1s8nA [c.23.1] PUTATIVE ANTITERMINATOR                                 57   3e-10
1nxtA [c.23.1] DNA-BINDING RESPONSE REGULATOR                          57   3e-10
3d36B [x.x.x] SPORULATION KINASE B                                     57   3e-10
3d36A [x.x.x] SPORULATION KINASE B                                     57   3e-10
2oqrA [x.x.x] SENSORY TRANSDUCTION PROTEIN REGX3                       56   4e-10
1zesB [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             56   5e-10
2j8eA [x.x.x] CHEMOTAXIS PROTEIN CHEY                                  55   6e-10
1dc7A [c.23.1] NITROGEN REGULATION PROTEIN                             55   8e-10
2zayA [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN                      55   1e-09
1tmyA [c.23.1 (1u0sY)] CHEY PROTEIN                                    54   2e-09
3f7nA [x.x.x] CHEMOTAXIS PROTEIN CHEY                                  54   2e-09
2jb9B [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             54   2e-09
2jb9A [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             54   2e-09
1mb0A [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK                   53   4e-09
2jvjA [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F              53   4e-09
2jbaA [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             53   4e-09
3fftA [x.x.x] CHEMOTAXIS PROTEIN CHEY                                  53   4e-09
1d4zA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 53   4e-09
3c3mA [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN                      53   4e-09
1xheB [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA                 52   7e-09
1xheA [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA                 52   7e-09
1fspA [c.23.1 (1puxA)] STAGE 0 SPORULATION PROTEIN F                   52   7e-09
3ffxA [x.x.x] CHEMOTAXIS PROTEIN CHEY                                  52   7e-09
2jbaB [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             52   9e-09
1dc8A [c.23.1] NITROGEN REGULATION PROTEIN                             52   9e-09
1dz3A [c.23.1] STAGE 0 SPORULATION PROTEIN A                           51   1e-08
2jvkA [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F              51   2e-08
3ffwA [x.x.x] CHEMOTAXIS PROTEIN CHEY                                  51   2e-08
1srrC [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN                 50   2e-08
1srrB [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN                 50   2e-08
1srrA [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN                 50   2e-08
1peyC [c.23.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F             50   2e-08
1natA [x.x.x] SPORULATION RESPONSE REGULATORY PROTEIN                  50   2e-08
2jviA [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F              50   2e-08
1zgzB [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN         50   3e-08
1zgzA [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN         50   3e-08
1udrA [c.23.1] CHEY PROTEIN                                            50   3e-08
3breB [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR                49   4e-08
3breA [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR                49   4e-08
1udrB [c.23.1] CHEY PROTEIN                                            49   6e-08
3jteA [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN                      49   6e-08
1jlkB [c.23.1] RESPONSE REGULATOR RCP1                                 49   6e-08
1jlkA [c.23.1] RESPONSE REGULATOR RCP1                                 49   6e-08
2qxyB [x.x.x] RESPONSE REGULATOR                                       49   8e-08
2qxyA [x.x.x] RESPONSE REGULATOR                                       49   8e-08
1zh4A [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN            48   1e-07
1zh2B [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN            48   1e-07
1zh2A [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN            48   1e-07
1ys7B [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA                  47   2e-07
1ys7A [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA                  47   2e-07
1ys6B [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA                  47   2e-07
2iynA [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             47   3e-07
1i3cB [c.23.1] RESPONSE REGULATOR RCP1                                 46   4e-07
1i3cA [c.23.1] RESPONSE REGULATOR RCP1                                 46   4e-07
1qmpB [c.23.1] SPO0A                                                   46   5e-07
1kgsA [c.23.1 - a.4.6] DNA BINDING RESPONSE REGULATOR D                46   5e-07
3cwoX [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY         46   5e-07
1bxdA [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))             46   5e-07
1k68A [c.23.1] PHYTOCHROME RESPONSE REGULATOR RCPA                     45   6e-07
3i5aA [x.x.x] RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN                  45   6e-07
3c97A [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE                     45   6e-07
2iynC [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY             45   1e-06
1zitA [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)                  44   1e-06
1qmpA [c.23.1] SPO0A                                                   44   1e-06
1nxoA [c.23.1] DNA-BINDING RESPONSE REGULATOR                          44   2e-06
3cu5B [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC            44   2e-06
2pl1A [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP                  44   2e-06
2pkxB [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP                  44   2e-06
2pkxA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP                  44   2e-06
1nxxA [c.23.1] DNA-BINDING RESPONSE REGULATOR                          44   2e-06
1nxsA [c.23.1] DNA-BINDING RESPONSE REGULATOR                          44   2e-06
2ftkE [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F              44   2e-06
3cfyA [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN                          43   3e-06
1ys6A [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA                  43   4e-06
1mihA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 43   4e-06
1cyeA [x.x.x] CHEY                                                     43   4e-06
2cheA [x.x.x] CHEY                                                     43   4e-06
1f4vC [c.23.1] CHEMOTAXIS CHEY PROTEIN                                 42   5e-06
1djmA [c.23.1] CHEMOTAXIS PROTEIN Y                                    42   5e-06
3chyA [c.23.1 (1a0oA)] CHEY                                            42   5e-06
2qzjA [x.x.x] TWO-COMPONENT RESPONSE REGULATOR                         42   7e-06
1k66A [c.23.1] PHYTOCHROME RESPONSE REGULATOR RCPB                     42   7e-06
1chnA [x.x.x] CHEY                                                     42   7e-06
1qmpD [c.23.1] SPO0A                                                   42   9e-06
3hebA [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN               41   1e-05
1ymuA [c.23.1] CHEY                                                    41   2e-05
1p2fA [c.23.1 - a.4.6] RESPONSE REGULATOR                              41   2e-05
1dcfA [c.23.1] ETR1 PROTEIN                                            41   2e-05
3hdvD [x.x.x] RESPONSE REGULATOR                                       40   2e-05
3hdvC [x.x.x] RESPONSE REGULATOR                                       40   2e-05
3hdvB [x.x.x] RESPONSE REGULATOR                                       40   2e-05
3hdvA [x.x.x] RESPONSE REGULATOR                                       40   2e-05
5chyA [x.x.x] CHEY                                                     40   2e-05
1vlzB [c.23.1] CHEY                                                    40   3e-05
1vlzA [c.23.1] CHEY                                                    40   3e-05
1id0A [d.122.1] PHOQ HISTIDINE KINASE                                  40   3e-05
1e6lA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 40   3e-05
1ymvA [x.x.x] CHEY                                                     40   4e-05
1ehcA [x.x.x] CHEY                                                     40   4e-05
1e6kA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 40   4e-05
3cu5A [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC            40   4e-05
1ab6A [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 40   4e-05
1ab5A [c.23.1] CHEY                                                    40   4e-05
1xhfA [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA                 39   5e-05
1jbeA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 39   5e-05
1e6mA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 39   5e-05
1i5cB [d.122.1] CHEMOTAXIS PROTEIN CHEA                                39   6e-05
1i5bB [d.122.1] CHEMOTAXIS PROTEIN CHEA                                39   6e-05
1i5bA [d.122.1] CHEMOTAXIS PROTEIN CHEA                                39   6e-05
1heyA [x.x.x] CHEY                                                     39   6e-05
1b3qA [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)    39   8e-05
1a2oA [c.23.1 - c.40.1] CHEB METHYLESTERASE                            39   8e-05
3h5iA [x.x.x] RESPONSE REGULATOR/SENSORY BOX PROTEIN/GGDEF             38   1e-04
6chyA [c.23.1] CHEY                                                    38   1e-04
2i6fC [x.x.x] RESPONSE REGULATOR FRZS                                  38   1e-04
2i6fB [x.x.x] RESPONSE REGULATOR FRZS                                  38   1e-04
2i6fA [x.x.x] RESPONSE REGULATOR FRZS                                  38   1e-04
1i5dA [d.122.1] CHEMOTAXIS PROTEIN CHEA                                38   1e-04
2gkgA [x.x.x] RESPONSE REGULATOR HOMOLOG                               38   1e-04
3dzdA [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)                  38   1e-04
2vuiB [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN           37   2e-04
1rnlA [x.x.x] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL          37   2e-04
2nt4A [x.x.x] RESPONSE REGULATOR HOMOLOG                               37   2e-04
2jk1A [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN           37   2e-04
1i59B [d.122.1] CHEMOTAXIS PROTEIN CHEA                                37   2e-04
1i58A [d.122.1] CHEMOTAXIS PROTEIN CHEA                                37   2e-04
3i42A [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-        37   2e-04
2ch4A [x.x.x] CHEMOTAXIS PROTEIN CHEA                                  37   2e-04
1a04A [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEI...    37   2e-04
1i58B [d.122.1] CHEMOTAXIS PROTEIN CHEA                                37   2e-04
3eodA [x.x.x] PROTEIN HNR                                              37   3e-04
1b3qB [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)    37   3e-04
2qr3A [x.x.x] TWO-COMPONENT SYSTEM RESPONSE REGULATOR                  36   4e-04
1qkkA [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL              36   4e-04
1l5zA [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL              36   4e-04
1l5yB [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL              36   4e-04
1l5yA [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL              36   4e-04
1i5aB [d.122.1] CHEMOTAXIS PROTEIN CHEA                                36   4e-04
2vuhB [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN           36   5e-04
3cg4A [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-        36   5e-04
1c4wA [c.23.1] CHEMOTAXIS PROTEIN CHEY                                 36   5e-04
1i5cA [d.122.1] CHEMOTAXIS PROTEIN CHEA                                35   7e-04
1i5aA [d.122.1] CHEMOTAXIS PROTEIN CHEA                                35   7e-04
1i59A [d.122.1] CHEMOTAXIS PROTEIN CHEA                                35   7e-04
3eqzB [x.x.x] RESPONSE REGULATOR                                       35   7e-04
3eqzA [x.x.x] RESPONSE REGULATOR                                       35   7e-04
1dbwB [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ                 35   7e-04
1dbwA [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ                 35   7e-04
3b2nA [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4                           35   7e-04
1d5wB [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ                 35   9e-04
1d5wA [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ                 35   9e-04
2ch4B [x.x.x] CHEMOTAXIS PROTEIN CHEA                                  35   9e-04

>3dgeA [x.x.x] SENSOR PROTEIN
          Length = 237

 Score =  105 bits (261), Expect = 7e-25
 Identities = 78/230 (33%), Positives = 125/230 (54%), Gaps = 4/230 (1%)

Query: 508 KSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQV-EYAETXXXXXXXXXXXXXXX 566
           K+EF++N+SHELRTPL ++   A  +  N  G L    + E+ E                
Sbjct: 7   KTEFIANISHELRTPLTAIKAYAETIY-NSLGELDLSTLKEFLEVIIDQSNHXXXXXXXX 65

Query: 567 XXXAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNR 626
              +++E   L +  E++ L +L+ +     +  A    ++   + +   P   + D  R
Sbjct: 66  XDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTR 125

Query: 627 LMQILKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEA 686
           + Q+L NLL+N  K++ +   + +V+    + EK   ++  V D GIGI    +  IFE 
Sbjct: 126 IRQVLLNLLNNGVKYSKKDAPDKYVK--VILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQ 183

Query: 687 FQQGDGTTSRKFGGTGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIP 736
           F + D + + +  GTGLGL+I +E+  L GG I ++S  GKGS F V+IP
Sbjct: 184 FYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP 233


>2c2aA [x.x.x] SENSOR HISTIDINE KINASE
          Length = 240

 Score = 96.7 bits (239), Expect = 2e-22
 Identities = 78/242 (32%), Positives = 125/242 (51%), Gaps = 13/242 (5%)

Query: 496 EQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQV-EYAETXXX 554
           ++   L    + K+EF++N+SHELRTPL ++   A  +  N  G L    + E+ E    
Sbjct: 8   KELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIY-NSLGELDLSTLKEFLEVIID 66

Query: 555 XXXXXXXXXXXXXXXAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDN 614
                          +++E   L +  E++ L +L+ +     +  A    ++   + + 
Sbjct: 67  QSNHXXXXXXXXXDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNV 126

Query: 615 DIPKTFFTDKNRLMQILKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIG 674
             P   + D  R+ Q+L NLL+N  K++ +   + +V+    + EK   ++  V D GIG
Sbjct: 127 PCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVK--VILDEKDGGVLIIVEDNGIG 184

Query: 675 IAKDKQALIFEAFQQGDGTTSRKFGGTGLGLSICRELAGLLGGFIELQSIKGKGSTFSVY 734
           I    +  IFE F + D         TGLGL+I +E+  L GG I ++S  GKGS F V+
Sbjct: 185 IPDHAKDRIFEQFYRVD---------TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVW 235

Query: 735 IP 736
           IP
Sbjct: 236 IP 237


>1w25A [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION
           CONTROLLING PROTEIN
          Length = 454

 Score = 75.1 bits (183), Expect = 8e-16
 Identities = 42/115 (36%), Positives = 69/115 (60%), Gaps = 1/115 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVVDD   NV  + A L  +  EV  A +G  A  +  +    D++L+D+MMP MDG+
Sbjct: 3   RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLP-DIILLDVMMPGMDGF 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
              + ++  P    IP++ +TA   +GDR + L++GASD+++KP+D   L + +R
Sbjct: 62  TVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVR 116



 Score = 48.9 bits (115), Expect = 6e-08
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VL+VDD+ R    + A L  +   V+   +  E  +I    P +DLV+++      DG  
Sbjct: 155 VLIVDDNERQAQRVAAELGVEHRPVI--ESDPEKAKISAGGP-VDLVIVNAAAKNFDGLR 211

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYRK 914
              ++R      ++P++A+     +G   K L+ G +D +S+P+D  +L + ++  + RK
Sbjct: 212 FTAALRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRK 271


>2v0nA [x.x.x] RESPONSE REGULATOR PLED
          Length = 459

 Score = 75.1 bits (183), Expect = 8e-16
 Identities = 42/115 (36%), Positives = 69/115 (60%), Gaps = 1/115 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVVDD   NV  + A L  +  EV  A +G  A  +  +    D++L+D+MMP MDG+
Sbjct: 3   RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLP-DIILLDVMMPGMDGF 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
              + ++  P    IP++ +TA   +GDR + L++GASD+++KP+D   L + +R
Sbjct: 62  TVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVR 116



 Score = 48.9 bits (115), Expect = 6e-08
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VL+VDD+ R    + A L  +   V+   +  E  +I    P +DLV+++      DG  
Sbjct: 155 VLIVDDNERQAQRVAAELGVEHRPVI--ESDPEKAKISAGGP-VDLVIVNAAAKNFDGLR 211

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYRK 914
              ++R      ++P++A+     +G   K L+ G +D +S+P+D  +L + ++  + RK
Sbjct: 212 FTAALRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRK 271


>1m5tA [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
          Length = 123

 Score = 74.7 bits (182), Expect = 1e-15
 Identities = 42/121 (34%), Positives = 67/121 (55%), Gaps = 1/121 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           +VL+V+D+  N+      LE Q  E L    G  A  I  +    DL+LMDI +PE+ G 
Sbjct: 3   KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DLILMDIQLPEISGL 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + +++  +   IP++A+TA AMKGD ++  + G   YISKP+ +   L  ++  L R
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLER 121

Query: 914 K 914
           +
Sbjct: 122 Q 122


>2zwmA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF
          Length = 120

 Score = 72.0 bits (175), Expect = 6e-15
 Identities = 45/122 (36%), Positives = 74/122 (60%), Gaps = 4/122 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++LVVDD+      +   L ++  EV  A +G EA E++ +    DL+L+DIM+P  DG 
Sbjct: 3   KILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQP-DLILLDIMLPNKDGV 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + +RK  +Y+ +PII LTAK  + D+   L+ GA DY++KP    +LL+ ++  L R
Sbjct: 62  EVCREVRK--KYD-MPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR 118

Query: 914 KV 915
           ++
Sbjct: 119 QL 120


>1nxpA [c.23.1] DNA-BINDING RESPONSE REGULATOR
          Length = 118

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 4/120 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD+      I   + ++  EV+ A NGREA E   +    D++++D+M+PE+DG 
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDIIILDLMLPEIDGL 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L R
Sbjct: 61  EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 117


>3dgfC [x.x.x] RESPONSE REGULATOR
          Length = 120

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 41/112 (36%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQ-TPGIDLVLMDIMMPEMDG 852
           +VL+VDD       ++  L+++  EV+ A NG+ A E L + TP  DL+++DIMMP MDG
Sbjct: 3   KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTP--DLIVLDIMMPVMDG 60

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           +  ++ +++  E+++IP+I LTAK  + D    L  GA   + KP   +Q +
Sbjct: 61  FTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFI 112


>3dgeC [x.x.x] RESPONSE REGULATOR
          Length = 122

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 41/112 (36%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQ-TPGIDLVLMDIMMPEMDG 852
           +VL+VDD       ++  L+++  EV+ A NG+ A E L + TP  DL+++DIMMP MDG
Sbjct: 4   KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTP--DLIVLDIMMPVMDG 61

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           +  ++ +++  E+++IP+I LTAK  + D    L  GA   + KP   +Q +
Sbjct: 62  FTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFI 113


>2a9oA [x.x.x] RESPONSE REGULATOR
          Length = 117

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 4/120 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD+      I   + ++  EV+ A NGREA E   +    D++++D+M+PE+DG 
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDIIILDLMLPEIDGL 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L R
Sbjct: 61  EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 117


>3gt7A [x.x.x] SENSOR PROTEIN
          Length = 132

 Score = 67.4 bits (163), Expect = 2e-13
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+V+D       +   LEE   +     NGREA   L  T   DL++ D++MPEMDGY 
Sbjct: 4   ILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRP-DLIISDVLMPEMDGYA 62

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
             + ++  P+   IP+I LT  +   D  + L+ GA D+I+KP
Sbjct: 63  LCRWLKGQPDLRTIPVILLTILSDPRDVVRSLECGADDFITKP 105


>1mvoA [c.23.1] PHOP RESPONSE REGULATOR
          Length = 121

 Score = 65.5 bits (158), Expect = 6e-13
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 3/120 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++LVVDD+   V  +   LE    +V+ A +G EA +   +T   DL+++D+M+P++DG 
Sbjct: 4   KILVVDDEESIVTLLQYNLERSGYDVITASDGEEALK-KAETEKPDLIVLDVMLPKLDGI 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + +R+  +    PI+ LTAK  + D+   L+ GA DY++KP    ++ + ++  L R
Sbjct: 63  EVCKQLRQ--QKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRR 120


>2a9rA [x.x.x] DNA-BINDING RESPONSE REGULATOR
          Length = 117

 Score = 63.9 bits (154), Expect = 2e-12
 Identities = 40/120 (33%), Positives = 70/120 (58%), Gaps = 5/120 (4%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD+      I   + ++  EV+ A NGREA E   +    D++++ +M+PE+DG 
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDIIIL-LMLPEIDGL 59

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L R
Sbjct: 60  EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 116


>2ayzA [x.x.x] SENSOR KINASE PROTEIN RCSC
          Length = 133

 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +LVVDD   N   +   L     +   A +G +A  +L +   ID+VL D+ MP MDGY 
Sbjct: 11  ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNH-IDIVLSDVNMPNMDGYR 69

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
             Q IR++     +P+I +TA A+  ++ +CL++G    +SKP+ ++ +   + ++  R
Sbjct: 70  LTQRIRQLGL--TLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAER 126


>2ayxA [x.x.x] SENSOR KINASE PROTEIN RCSC
          Length = 254

 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +LVVDD   N   +   L     +   A +G +A  +L +   ID+VL D+ MP MDGY 
Sbjct: 132 ILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNH-IDIVLSDVNMPNMDGYR 190

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
             Q IR++     +P+I +TA A+  ++ +CL++G    +SKP+ ++ +   + ++  R
Sbjct: 191 LTQRIRQLGL--TLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAER 247


>1p6qA [c.23.1] CHEY2
          Length = 129

 Score = 61.2 bits (147), Expect = 1e-11
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 2/111 (1%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEI-EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           +VL+VDD + +   +  AL++    ++  AG+G +  +I+ Q P   LV+ D  MP+MDG
Sbjct: 8   KVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPH-HLVISDFNMPKMDG 66

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQL 903
              +Q++R  P  +K   I LTA+  +    K    GA++ ++KP  I ++
Sbjct: 67  LGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKM 117


>1mb3A [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
          Length = 117

 Score = 60.1 bits (144), Expect = 3e-11
 Identities = 37/121 (30%), Positives = 62/121 (51%), Gaps = 7/121 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           +VL+V+D+  N+      LE Q  E L    G  A  I  +    DL+LMDI +PE+ G 
Sbjct: 3   KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DLILMDIQLPEISGL 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + +++  +   IP++A+T      D ++  + G   YISKP+ +   L  ++  L R
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVT------DEERIREGGCEAYISKPISVVHFLETIKRLLER 115

Query: 914 K 914
           +
Sbjct: 116 Q 116


>1mavA [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
          Length = 117

 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 37/121 (30%), Positives = 63/121 (52%), Gaps = 7/121 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           +VL+V+D+  N+      LE Q  E L    G  A  I  +    DL+LMDI +PE+ G 
Sbjct: 3   KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DLILMDIQLPEISGL 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + +++  +   IP++A+TA+      ++  + G   YISKP+ +   L  ++  L R
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVTAE------ERIREGGCEAYISKPISVVHFLETIKRLLER 115

Query: 914 K 914
           +
Sbjct: 116 Q 116


>1zesC [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 120

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+D M+P   G 
Sbjct: 2   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLDWMLPGGSGI 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 61  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 120


>1zesA [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 121

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+D M+P   G 
Sbjct: 2   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLDWMLPGGSGI 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 61  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 120


>2iynB [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 124

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+D M+P   G 
Sbjct: 4   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLDWMLPGGSGI 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 63  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 122


>1b00A [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 122

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+D M+P   G 
Sbjct: 3   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLDWMLPGGSGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 62  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 121


>2r25B [x.x.x] OSMOSENSING HISTIDINE PROTEIN KINASE SLN1
          Length = 133

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 37/119 (31%), Positives = 70/119 (58%), Gaps = 6/119 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIE-VLFAGNGREA----QEILMQTPGIDLVLMDIMMP 848
           ++LVV+D+  N   I   L  + IE +  A +G+EA    +E+  +    +++ MD+ MP
Sbjct: 4   KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMP 63

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           ++DG  + + IR+   Y   PI+ALTA A   +  +CL++G + ++SKP+   +L +++
Sbjct: 64  KVDGLLSTKMIRRDLGYTS-PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 121


>1oxkB [c.23.1] SLN1
          Length = 128

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 37/119 (31%), Positives = 70/119 (58%), Gaps = 6/119 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIE-VLFAGNGREA----QEILMQTPGIDLVLMDIMMP 848
           ++LVV+D+  N   I   L  + IE +  A +G+EA    +E+  +    +++ MD+ MP
Sbjct: 3   KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMP 62

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           ++DG  + + IR+   Y   PI+ALTA A   +  +CL++G + ++SKP+   +L +++
Sbjct: 63  KVDGLLSTKMIRRDLGYTS-PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 120


>1oxbB [c.23.1] SLN1
          Length = 124

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 37/119 (31%), Positives = 70/119 (58%), Gaps = 6/119 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIE-VLFAGNGREA----QEILMQTPGIDLVLMDIMMP 848
           ++LVV+D+  N   I   L  + IE +  A +G+EA    +E+  +    +++ MD+ MP
Sbjct: 3   KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMP 62

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           ++DG  + + IR+   Y   PI+ALTA A   +  +CL++G + ++SKP+   +L +++
Sbjct: 63  KVDGLLSTKMIRRDLGYTS-PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 120


>1m5uA [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
          Length = 113

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 37/121 (30%), Positives = 61/121 (50%), Gaps = 11/121 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           +VL+V+D+  N+      LE Q  E L    G  A  I  +    DL+LMDI +PE+ G 
Sbjct: 3   KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DLILMDIQLPEISGL 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + +++  +   IP++A+TA          ++ G   YISKP+ +   L  ++  L R
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVTA----------IRGGCEAYISKPISVVHFLETIKRLLER 111

Query: 914 K 914
           +
Sbjct: 112 Q 112


>2a9qA [x.x.x] RESPONSE REGULATOR
          Length = 112

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD+      I   + ++  EV+ A NGREA E        +    DI++ ++DG 
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE------QFEAEQPDIIILDLDGL 55

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L R
Sbjct: 56  EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 112


>1sd5A [c.23.1] PUTATIVE ANTITERMINATOR
          Length = 188

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 5/121 (4%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLF-AGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           RVL+ +D+      +   L E+  E++  AG+G+EA E L +    DLV+MD+ MP  DG
Sbjct: 3   RVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVE-LAELHKPDLVIMDVKMPRRDG 61

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
            +A   I         PI+ LTA + +   ++   AGA  Y+ KP  I+ L+  + + + 
Sbjct: 62  IDAASEIASK---RIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVS 118

Query: 913 R 913
           R
Sbjct: 119 R 119


>1s8nA [c.23.1] PUTATIVE ANTITERMINATOR
          Length = 190

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 5/121 (4%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLF-AGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           RVL+ +D+      +   L E+  E++  AG+G+EA E L +    DLV+MD+ MP  DG
Sbjct: 5   RVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVE-LAELHKPDLVIMDVKMPRRDG 63

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
            +A   I         PI+ LTA + +   ++   AGA  Y+ KP  I+ L+  + + + 
Sbjct: 64  IDAASEIASK---RIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVS 120

Query: 913 R 913
           R
Sbjct: 121 R 121


>1nxtA [c.23.1] DNA-BINDING RESPONSE REGULATOR
          Length = 115

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 39/120 (32%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD+      I   + ++  EV+ A NGREA E   +    D++++ +M+P  DG 
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE-QFEAEQPDIIIL-LMLP--DGL 57

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L R
Sbjct: 58  EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 114


>3d36B [x.x.x] SPORULATION KINASE B
          Length = 221

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 50/225 (22%), Positives = 101/225 (44%), Gaps = 21/225 (9%)

Query: 513 SNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETXXXXXXXXXXXXXXXXXXAKI 572
           +++SHE+R PL +     +++ E      + K+ +YA                    AK 
Sbjct: 14  ASISHEIRNPLTAARGFIQLIEEQPLA--ADKRRQYARIAIEELDRAEAIITDYLTFAKP 71

Query: 573 EAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQILK 632
                   PE++++   I  +    +P+A    +D    L    P +   ++ +  Q L 
Sbjct: 72  APET----PEKLNVKLEIERVIDILRPLANMSCVDIQATL---APFSVIGEREKFRQCLL 124

Query: 633 NLLSNAFK-FTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGD 691
           N++ NA +   N G + ++V      S    +++  ++DTG+G+ K++   + E +    
Sbjct: 125 NVMKNAIEAMPNGGTLQVYV------SIDNGRVLIRIADTGVGMTKEQLERLGEPY---- 174

Query: 692 GTTSRKFGGTGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIP 736
             T++   GTGLG+ +   +   + G I ++S   KG+T S+Y+P
Sbjct: 175 -FTTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP 218


>3d36A [x.x.x] SPORULATION KINASE B
          Length = 217

 Score = 56.6 bits (135), Expect = 3e-10
 Identities = 50/225 (22%), Positives = 101/225 (44%), Gaps = 21/225 (9%)

Query: 513 SNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETXXXXXXXXXXXXXXXXXXAKI 572
           +++SHE+R PL +     +++ E      + K+ +YA                    AK 
Sbjct: 10  ASISHEIRNPLTAARGFIQLIEEQPLA--ADKRRQYARIAIEELDRAEAIITDYLTFAKP 67

Query: 573 EAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQILK 632
                   PE++++   I  +    +P+A    +D    L    P +   ++ +  Q L 
Sbjct: 68  APET----PEKLNVKLEIERVIDILRPLANMSCVDIQATL---APFSVIGEREKFRQCLL 120

Query: 633 NLLSNAFK-FTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGD 691
           N++ NA +   N G + ++V      S    +++  ++DTG+G+ K++   + E +    
Sbjct: 121 NVMKNAIEAMPNGGTLQVYV------SIDNGRVLIRIADTGVGMTKEQLERLGEPY---- 170

Query: 692 GTTSRKFGGTGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIP 736
             T++   GTGLG+ +   +   + G I ++S   KG+T S+Y+P
Sbjct: 171 -FTTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP 214


>2oqrA [x.x.x] SENSORY TRANSDUCTION PROTEIN REGX3
          Length = 226

 Score = 56.2 bits (134), Expect = 4e-10
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VL+V+D+      +   L ++  E     +G  A     +  G D+VL+D+M+P M G +
Sbjct: 4   VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRA-GADIVLLDLMLPGMSGTD 62

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
             + +R       +P+I +TA+  + D+   L+ GA DY++KP    +L++ +R  L R
Sbjct: 63  VCKQLRAR---SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRR 118


>1zesB [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 118

 Score = 55.8 bits (133), Expect = 5e-10
 Identities = 33/120 (27%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A    +    + Q    DL+L+D M+P   G 
Sbjct: 2   RILVVEDEAPIREMVCFVLEQNGFQPVEA---EDYDSAVNQLNWPDLILLDWMLPGGSGI 58

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 59  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 118


>2j8eA [x.x.x] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 55.5 bits (132), Expect = 6e-10
 Identities = 41/116 (35%), Positives = 59/116 (50%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD+      +   L+E     L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D MMP MDG E +++IR       +P++ +TA+A K +     QAGAS Y+ KP
Sbjct: 54  ISDWMMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKP 109


>1dc7A [c.23.1] NITROGEN REGULATION PROTEIN
          Length = 124

 Score = 55.1 bits (131), Expect = 8e-10
 Identities = 38/114 (33%), Positives = 59/114 (51%), Gaps = 5/114 (4%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILM-QTPGIDLVLMDIMMPEMDGY 853
           V VVDDD    + +  AL    +      NG E    L  +TP  D++L DI MP MDG 
Sbjct: 6   VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTP--DVLLSDIRMPGMDGL 63

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
             ++ I++   +  +P+I +TA +         Q GA DY+ KP DI++ ++L+
Sbjct: 64  ALLKQIKQ--RHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALV 115


>2zayA [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
          Length = 123

 Score = 54.7 bits (130), Expect = 1e-09
 Identities = 28/111 (25%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 793 YRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           +R+++VD              ++  +++  GN  EA  + ++T    L++ +  MP++ G
Sbjct: 2   WRIMLVDTQXXXXXXXXXXXXQEGFDIIQCGNAIEAVPVAVKTHP-HLIITEANMPKISG 60

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQL 903
            +   S++K P+   IP+IAL+ +A   +  + L  G  D+I+KP++  +L
Sbjct: 61  MDLFNSLKKNPQTASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRL 111


>1tmyA [c.23.1 (1u0sY)] CHEY PROTEIN
          Length = 118

 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 792 GYRVLVVDDDMRNVFAITAALEEQEIEVLF-AGNGREAQEILMQTPGIDLVLMDIMMPEM 850
           G RVL+VDD       +   + +   EV   A NGREA E   +    D+V MDI MPEM
Sbjct: 1   GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKP-DIVTMDITMPEM 59

Query: 851 DGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           +G +A++ I K+    K  II  +A   +    + ++AGA D+I KP   ++++  +
Sbjct: 60  NGIDAIKEIMKIDPNAK--IIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEAL 114


>3f7nA [x.x.x] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 41/116 (35%), Positives = 58/116 (50%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD+      +   L+E     L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D MMP MDG E +++IR       +P++ +TA A K +     QAGAS Y+ KP
Sbjct: 54  ISDWMMPNMDGLELLKTIRADGAMSALPVLMVTALAKKENIIAAAQAGASGYVVKP 109


>2jb9B [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 122

 Score = 53.5 bits (127), Expect = 2e-09
 Identities = 33/120 (27%), Positives = 65/120 (54%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+ +      +   LE+   + + A +   A   L + P  DL+L++ M+P   G 
Sbjct: 3   RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLEWMLPGGSGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 62  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 121


>2jb9A [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 121

 Score = 53.5 bits (127), Expect = 2e-09
 Identities = 33/120 (27%), Positives = 65/120 (54%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+ +      +   LE+   + + A +   A   L + P  DL+L++ M+P   G 
Sbjct: 2   RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLEWMLPGGSGI 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA DYI+KP    +L++ ++  + R
Sbjct: 61  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR 120


>1mb0A [c.23.1] CELL DIVISION RESPONSE REGULATOR DIVK
          Length = 107

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 34/115 (29%), Positives = 55/115 (47%), Gaps = 14/115 (12%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           +VL+V+D+  N+      LE Q  E L    G  A  I  +    DL+LMDI +PE+ G 
Sbjct: 3   KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKP-DLILMDIQLPEISGL 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           E  + +++  +   IP++A+T              G   YISKP+ +   L  ++
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVT-------------GGCEAYISKPISVVHFLETIK 103


>2jvjA [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
          Length = 132

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 33/123 (26%), Positives = 64/123 (52%), Gaps = 3/123 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 5   KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 63

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L  
Sbjct: 64  EILKRMKVID--ENIRVIIMTAYGELDMAQESKELGALTHFAKPFDIDEIRDAVKKYLPL 121

Query: 914 KVN 916
           K N
Sbjct: 122 KSN 124


>2jbaA [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 125

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+  M+P   G 
Sbjct: 3   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLAWMLPGGSGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +R+      IP++ LTA+  + DR + L+ GA D I+KP    +L++ ++  + R
Sbjct: 62  QFIKHLRRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRR 121


>3fftA [x.x.x] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD+      +   L+E     L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +TA+A K +     QAGAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKP 109


>1d4zA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 39/116 (33%), Positives = 58/116 (50%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +TA+A K +     QAGAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKP 109


>3c3mA [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
          Length = 117

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 42/122 (34%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 793 YRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           Y +LVVDD    +  +   LE      + A +G E  E L  TP  DLVL+DI   E DG
Sbjct: 3   YTILVVDDSP--IVDVFVTLERGGYRPITAFSGEECLEALNATPP-DLVLLDI---EPDG 56

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
           +E ++ I+  P    IP++ LTAK +  +      +   DYI KP   +QL   +   L 
Sbjct: 57  WETLERIKTDPATRDIPVL-LTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLA 115

Query: 913 RK 914
           R+
Sbjct: 116 RR 117


>1xheB [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
          Length = 122

 Score = 52.0 bits (123), Expect = 7e-09
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+V+D++     + +  E +  +V  A +G E  +IL +   I+LV+MDI +P  +G  
Sbjct: 5   ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYD-INLVIMDINLPGKNG-- 61

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
            +   R++ E   + ++ LT +  + D+   L+ GA DYI+KP +  +L    R  L R
Sbjct: 62  -LLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR 119


>1xheA [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
          Length = 121

 Score = 52.0 bits (123), Expect = 7e-09
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+V+D++     + +  E +  +V  A +G E  +IL +   I+LV+MDI +P  +G  
Sbjct: 5   ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYD-INLVIMDINLPGKNG-- 61

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
            +   R++ E   + ++ LT +  + D+   L+ GA DYI+KP +  +L    R  L R
Sbjct: 62  -LLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR 119


>1fspA [c.23.1 (1puxA)] STAGE 0 SPORULATION PROTEIN F
          Length = 124

 Score = 52.0 bits (123), Expect = 7e-09
 Identities = 33/123 (26%), Positives = 64/123 (52%), Gaps = 3/123 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 5   KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 63

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L  
Sbjct: 64  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL 121

Query: 914 KVN 916
           K N
Sbjct: 122 KSN 124


>3ffxA [x.x.x] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 52.0 bits (123), Expect = 7e-09
 Identities = 40/116 (34%), Positives = 57/116 (49%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD+      +   L+E     L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDDESTMRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +TA A K +     QAGAS Y+ KP
Sbjct: 54  ISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAHAKKENIIAAAQAGASGYVVKP 109


>2jbaB [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 121

 Score = 51.6 bits (122), Expect = 9e-09
 Identities = 33/120 (27%), Positives = 64/120 (53%), Gaps = 1/120 (0%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+  M+P   G 
Sbjct: 3   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLAWMLPGGSGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA+  + DR + L+ GA D I+KP    +L++ ++  + R
Sbjct: 62  QFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRR 121


>1dc8A [c.23.1] NITROGEN REGULATION PROTEIN
          Length = 123

 Score = 51.6 bits (122), Expect = 9e-09
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 6/114 (5%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILM-QTPGIDLVLMDIMMPEMDGY 853
           V VVDDD    + +  AL    +      NG E    L  +TP    VL+ I MP MDG 
Sbjct: 6   VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPD---VLLSIRMPGMDGL 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
             ++ I++   +  +P+I +TA +         Q GA DY+ KP DI++ ++L+
Sbjct: 63  ALLKQIKQ--RHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALV 114


>1dz3A [c.23.1] STAGE 0 SPORULATION PROTEIN A
          Length = 123

 Score = 51.2 bits (121), Expect = 1e-08
 Identities = 36/117 (30%), Positives = 65/117 (55%), Gaps = 4/117 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQ-EIEVL-FAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           +V + DD+   V  +   +  Q ++EV+  A NG++  ++L +    D++L+DI+MP +D
Sbjct: 3   KVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRP-DILLLDIIMPHLD 61

Query: 852 GYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           G   ++ IR   E++   +I LTA   +    K ++ GAS +I KP D+  L   +R
Sbjct: 62  GLAVLERIRAGFEHQP-NVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR 117


>2jvkA [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
          Length = 132

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 3/123 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 5   KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 63

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E  + ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L  
Sbjct: 64  EIAKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL 121

Query: 914 KVN 916
           K N
Sbjct: 122 KSN 124


>3ffwA [x.x.x] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD       +   L+E     L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDDQSTMRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +TA A K +     QAGAS Y+ KP
Sbjct: 54  ISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKP 109


>1srrC [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
          Length = 121

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 4   KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L
Sbjct: 63  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 118


>1srrB [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
          Length = 120

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 3   KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L
Sbjct: 62  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 117


>1srrA [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
          Length = 119

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 3   KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L
Sbjct: 62  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 117


>1peyC [c.23.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
          Length = 120

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 4   KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L
Sbjct: 63  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 118


>1natA [x.x.x] SPORULATION RESPONSE REGULATORY PROTEIN
          Length = 119

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 3   KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           E ++ ++ +   E I +I +TA        +  + GA  + +KP DI+++   ++ +L
Sbjct: 62  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 117


>2jviA [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
          Length = 132

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 3/123 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+D+ +P MDG 
Sbjct: 5   KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLLDMKIPGMDGI 63

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           E ++ ++ +   E I +I +TA        +  + GA    +KP DI+++   ++ +L  
Sbjct: 64  EILKRMKVID--ENIRVIIMTAYGELDMIQESKELGALTAFAKPFDIDEIRDAVKKYLPL 121

Query: 914 KVN 916
           K N
Sbjct: 122 KSN 124


>1zgzB [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 117

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 7/121 (5%)

Query: 793 YRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           + +++V+D+      + +   ++   V    +G   +EI  Q   +DL+L+DI +P+ +G
Sbjct: 2   HHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREI--QNQSVDLILLDINLPDENG 59

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
                  R + E   + II +T ++ + DR   L+ GA DY++KPL++ +L+  ++  L+
Sbjct: 60  LLT----RALRERSTVGIILVTGRSDRIDRIVGLE-GADDYVTKPLELRELVVRVKNLLW 114

Query: 913 R 913
           R
Sbjct: 115 R 115


>1zgzA [x.x.x] TORCAD OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 118

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 7/121 (5%)

Query: 793 YRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           + +++V+D+      + +   ++   V    +G   +EI  Q   +DL+L+DI +P+ +G
Sbjct: 2   HHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREI--QNQSVDLILLDINLPDENG 59

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
                  R + E   + II +T ++ + DR   L+ GA DY++KPL++ +L+  ++  L+
Sbjct: 60  LLT----RALRERSTVGIILVTGRSDRIDRIVGLE-GADDYVTKPLELRELVVRVKNLLW 114

Query: 913 R 913
           R
Sbjct: 115 R 115


>1udrA [c.23.1] CHEY PROTEIN
          Length = 126

 Score = 49.7 bits (117), Expect = 3e-08
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 10/112 (8%)

Query: 791 KGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDI 845
           K  + LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V+ D 
Sbjct: 1   KELKFLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDW 55

Query: 846 MMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MP MDG E +++IR       +P++ +TA+A   +     QAGAS Y+ KP
Sbjct: 56  NMPNMDGLELLKTIRADGAMSALPVLMVTAEADAENIKALAQAGASGYVVKP 107


>3breB [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
          Length = 328

 Score = 49.3 bits (116), Expect = 4e-08
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 795 VLVVDDDMRNVFAITAAL-EEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           VL+VDD      A+  +L  E  I+  F  + ++A  +  Q     ++L D++MP +DG 
Sbjct: 9   VLLVDDQAMIGEAVRRSLASEAGIDFHFCSDPQQAVAVANQIKPT-VILQDLVMPGVDGL 67

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             + + R  P    IPII L+ K     +     AGA+DY+ K  D  +L++ +R
Sbjct: 68  TLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIR 122


>3breA [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
          Length = 322

 Score = 49.3 bits (116), Expect = 4e-08
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 795 VLVVDDDMRNVFAITAAL-EEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           VL+VDD      A+  +L  E  I+  F  + ++A  +  Q     ++L D++MP +DG 
Sbjct: 4   VLLVDDQAMIGEAVRRSLASEAGIDFHFCSDPQQAVAVANQIKPT-VILQDLVMPGVDGL 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             + + R  P    IPII L+ K     +     AGA+DY+ K  D  +L++ +R
Sbjct: 63  TLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIR 117


>1udrB [c.23.1] CHEY PROTEIN
          Length = 125

 Score = 48.9 bits (115), Expect = 6e-08
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDIMMP 848
           + LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V+ D  MP
Sbjct: 3   KFLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMP 57

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MDG E +++IR       +P++ +TA+A   +     QAGAS Y+ KP
Sbjct: 58  NMDGLELLKTIRADGAMSALPVLMVTAEADAENIKALAQAGASGYVVKP 106


>3jteA [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
          Length = 126

 Score = 48.9 bits (115), Expect = 6e-08
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQT-PGIDLVLMDIMMPEMDG 852
           ++LV+DD+   +  I   LE    EVL A +  E   I  +    ID+V+ D+ MP++ G
Sbjct: 3   KILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENCNSIDVVITDMKMPKLSG 62

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQA---GASDYISKPLDINQL 903
            + ++ I+K+  +  + +I LT     GD D  + A   GA +Y+ KP+    L
Sbjct: 63  MDILREIKKITPH--MAVIILTG---HGDLDNAILAMKEGAFEYLRKPVTAQDL 111


>1jlkB [c.23.1] RESPONSE REGULATOR RCP1
          Length = 139

 Score = 48.9 bits (115), Expect = 6e-08
 Identities = 28/122 (22%), Positives = 62/122 (50%), Gaps = 8/122 (6%)

Query: 795 VLVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEILMQ------TPGIDLVLMDIM 846
           +L+V+D   +   +   L+   I  E++   +G  A   L Q      +P  +L+L+D+ 
Sbjct: 4   ILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLN 63

Query: 847 MPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSL 906
           +P+ DG E +  I++ P+ ++IP++ LT    + D     +   + Y++K  ++  L  +
Sbjct: 64  LPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKM 123

Query: 907 MR 908
           ++
Sbjct: 124 VQ 125


>1jlkA [c.23.1] RESPONSE REGULATOR RCP1
          Length = 141

 Score = 48.9 bits (115), Expect = 6e-08
 Identities = 28/122 (22%), Positives = 62/122 (50%), Gaps = 8/122 (6%)

Query: 795 VLVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEILMQ------TPGIDLVLMDIM 846
           +L+V+D   +   +   L+   I  E++   +G  A   L Q      +P  +L+L+D+ 
Sbjct: 6   ILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLN 65

Query: 847 MPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSL 906
           +P+ DG E +  I++ P+ ++IP++ LT    + D     +   + Y++K  ++  L  +
Sbjct: 66  LPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKM 125

Query: 907 MR 908
           ++
Sbjct: 126 VQ 127


>2qxyB [x.x.x] RESPONSE REGULATOR
          Length = 116

 Score = 48.5 bits (114), Expect = 8e-08
 Identities = 36/114 (31%), Positives = 60/114 (52%), Gaps = 6/114 (5%)

Query: 796 LVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEA 855
           +VVD+      A+  ALE+    V++A N +EA   L +   IDLV +D+     +G E+
Sbjct: 4   VVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREK-IDLVFVDVF----EGEES 58

Query: 856 MQSIRKM-PEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           +  IR++  E+    +  L+A   K      ++AGA DYI KP  ++ LL  ++
Sbjct: 59  LNLIRRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVK 112


>2qxyA [x.x.x] RESPONSE REGULATOR
          Length = 118

 Score = 48.5 bits (114), Expect = 8e-08
 Identities = 36/114 (31%), Positives = 60/114 (52%), Gaps = 6/114 (5%)

Query: 796 LVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEA 855
           +VVD+      A+  ALE+    V++A N +EA   L +   IDLV +D+     +G E+
Sbjct: 5   VVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREK-IDLVFVDVF----EGEES 59

Query: 856 MQSIRKM-PEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           +  IR++  E+    +  L+A   K      ++AGA DYI KP  ++ LL  ++
Sbjct: 60  LNLIRRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVK 113


>1zh4A [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 121

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 22/55 (40%), Positives = 36/55 (65%)

Query: 859 IRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           IR + ++  +P+I L+A++ + D+   L AGA DY+SKP  I +L + +RV L R
Sbjct: 64  IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRR 118


>1zh2B [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 120

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 22/55 (40%), Positives = 36/55 (65%)

Query: 859 IRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           IR + ++  +P+I L+A++ + D+   L AGA DY+SKP  I +L + +RV L R
Sbjct: 64  IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRR 118


>1zh2A [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 120

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 22/55 (40%), Positives = 36/55 (65%)

Query: 859 IRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           IR + ++  +P+I L+A++ + D+   L AGA DY+SKP  I +L + +RV L R
Sbjct: 63  IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRR 117


>1ys7B [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
          Length = 226

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 818 EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKA 877
           EV  A +G EA     +    D +++DI MP +DG   + ++R M     +P+  L+A++
Sbjct: 27  EVATAVDGAEALRSATENRP-DAIVLDINMPVLDGVSVVTALRAMDN--DVPVCVLSARS 83

Query: 878 MKGDRDKCLQAGASDYISKP 897
              DR   L+AGA DY+ KP
Sbjct: 84  SVDDRVAGLEAGADDYLVKP 103


>1ys7A [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
          Length = 224

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 818 EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKA 877
           EV  A +G EA     +    D +++DI MP +DG   + ++R M     +P+  L+A++
Sbjct: 27  EVATAVDGAEALRSATENRP-DAIVLDINMPVLDGVSVVTALRAMDN--DVPVCVLSARS 83

Query: 878 MKGDRDKCLQAGASDYISKP 897
              DR   L+AGA DY+ KP
Sbjct: 84  SVDDRVAGLEAGADDYLVKP 103


>1ys6B [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
          Length = 227

 Score = 47.0 bits (110), Expect = 2e-07
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 818 EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKA 877
           EV  A +G EA     +    D +++DI MP +DG   + ++R M     +P+  L+A++
Sbjct: 27  EVATAVDGAEALRSATENRP-DAIVLDINMPVLDGVSVVTALRAMDN--DVPVCVLSARS 83

Query: 878 MKGDRDKCLQAGASDYISKP 897
              DR   L+AGA DY+ KP
Sbjct: 84  SVDDRVAGLEAGADDYLVKP 103


>2iynA [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 110

 Score = 46.6 bits (109), Expect = 3e-07
 Identities = 31/115 (26%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+D M+P   G 
Sbjct: 2   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLDWMLPGGSGI 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           + ++ +++      IP++ LTA+          + GA DYI+KP    +L++ ++
Sbjct: 61  QFIKHLKRESMTRDIPVVMLTARG---------ETGADDYITKPFSPKELVARIK 106


>1i3cB [c.23.1] RESPONSE REGULATOR RCP1
          Length = 138

 Score = 46.2 bits (108), Expect = 4e-07
 Identities = 29/127 (22%), Positives = 63/127 (49%), Gaps = 10/127 (7%)

Query: 795 VLVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEILMQ-----TPGIDLVLMDIMM 847
           +L+V+D   +   +   L+   I  E++   +G  A  +  Q     +P  +L+L+D+ +
Sbjct: 5   ILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAAFLQQQGEYENSPRPNLILLDLNL 64

Query: 848 PEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           P+ DG E +  I++ P+ ++IP++ LT    + D     +   + Y++K  ++  L  + 
Sbjct: 65  PKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKVQ 124

Query: 908 RV---WL 911
            +   WL
Sbjct: 125 GIESFWL 131


>1i3cA [c.23.1] RESPONSE REGULATOR RCP1
          Length = 142

 Score = 46.2 bits (108), Expect = 4e-07
 Identities = 29/127 (22%), Positives = 63/127 (49%), Gaps = 10/127 (7%)

Query: 795 VLVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEILMQ-----TPGIDLVLMDIMM 847
           +L+V+D   +   +   L+   I  E++   +G  A  +  Q     +P  +L+L+D+ +
Sbjct: 6   ILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAAFLQQQGEYENSPRPNLILLDLNL 65

Query: 848 PEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           P+ DG E +  I++ P+ ++IP++ LT    + D     +   + Y++K  ++  L  + 
Sbjct: 66  PKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKVQ 125

Query: 908 RV---WL 911
            +   WL
Sbjct: 126 GIESFWL 132


>1qmpB [c.23.1] SPO0A
          Length = 120

 Score = 45.8 bits (107), Expect = 5e-07
 Identities = 35/117 (29%), Positives = 62/117 (52%), Gaps = 9/117 (7%)

Query: 794 RVLVVDDDMRNVFAITAALEEQ-EIEVL-FAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           +V + DD+   V  +   +  Q ++EV+  A NG++  ++L +    D++L+ I+MP +D
Sbjct: 3   KVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRP-DILLL-IIMPHLD 60

Query: 852 GYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           G   ++ IR  P      +I LTA   +    K ++ GAS +I KP D+  L   +R
Sbjct: 61  GLAVLERIRAQPN-----VIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR 112


>1kgsA [c.23.1 - a.4.6] DNA BINDING RESPONSE REGULATOR D
          Length = 211

 Score = 45.8 bits (107), Expect = 5e-07
 Identities = 40/122 (32%), Positives = 66/122 (54%), Gaps = 12/122 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQ-EIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           RVLVV+D+      IT AL+++  ++V + G     +E        D+V++DI+ P  DG
Sbjct: 3   RVLVVEDERDLADLITEALKKEFTVDVCYDG-----EEGYALNEPFDVVILDIL-PVHDG 56

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
           +E ++S          P++ LTA +    R K L  GA DY+ KP D+ +L++ +R  + 
Sbjct: 57  WEILKS---RESGVNTPVL-LTALSDVEYRVKGLN-GADDYLPKPFDLRELIARVRALIR 111

Query: 913 RK 914
           RK
Sbjct: 112 RK 113


>3cwoX [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
          Length = 236

 Score = 45.8 bits (107), Expect = 5e-07
 Identities = 36/103 (34%), Positives = 50/103 (48%), Gaps = 24/103 (23%)

Query: 792 GYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           G RVL+VDD                     A NGREA E   +    D+V MDI MPEM+
Sbjct: 1   GKRVLIVDD---------------------ATNGREAVEKYKELKP-DIVTMDITMPEMN 38

Query: 852 GYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYI 894
           G +A++ I K+    K  II  +A   +    + ++AGA D+I
Sbjct: 39  GIDAIKEIMKIDPNAK--IIVCSAMGQQAMVIEAIKAGAKDFI 79


>1bxdA [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
          Length = 161

 Score = 45.8 bits (107), Expect = 5e-07
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 666 FSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGGTGLGLSICRELAGLLGGFIELQSIK 725
           F V D G GIA +++  +F+ F +GD  ++R   GTGLGL+I + +     G +EL + +
Sbjct: 80  FQVEDDGPGIAPEQRKHLFQPFVRGD--SARTISGTGLGLAIVQRIVDNHNGMLELGTSE 137

Query: 726 GKGSTFSVYIP 736
             G +   ++P
Sbjct: 138 RGGLSIRAWLP 148


>1k68A [c.23.1] PHYTOCHROME RESPONSE REGULATOR RCPA
          Length = 139

 Score = 45.4 bits (106), Expect = 6e-07
 Identities = 30/123 (24%), Positives = 61/123 (49%), Gaps = 9/123 (7%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEILMQTPGI------DLVLMDI 845
           ++ +V+D+  ++  I  AL    +  EV+   +G EA   L Q          DL+L+ +
Sbjct: 4   KIFLVEDNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYANASRPDLILL-L 62

Query: 846 MMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLS 905
            +P+ DG E +  I+  P  ++IP++ L+    + D         + YI+K  +++QL  
Sbjct: 63  NLPKKDGREVLAEIKSDPTLKRIPVVVLSTSINEDDIFHSYDLHVNCYITKSANLSQLFQ 122

Query: 906 LMR 908
           +++
Sbjct: 123 IVK 125


>3i5aA [x.x.x] RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN
          Length = 319

 Score = 45.4 bits (106), Expect = 6e-07
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 795 VLVVDDDMRNVFAITAALEEQE-IEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           VL+VDD      A+   L   E I+  F  +  +A    +Q     ++L D++MP +DG 
Sbjct: 4   VLLVDDQAMIGEAVRRGLAGHESIDFHFCADPHQAIAQAVQIKPT-VILQDLVMPGLDGL 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             ++  R  P    IPII L+ K     +     AGA+DY+ K  D  +L++ +R
Sbjct: 63  TLVREYRSNPLTRDIPIIVLSTKEDPLIKSAAFAAGANDYLVKLPDNIELVARIR 117


>3c97A [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
          Length = 120

 Score = 45.4 bits (106), Expect = 6e-07
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 1/109 (0%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VL+ +D+         ALE+   ++    NG +A +   Q    D+++MDI MP MDG E
Sbjct: 4   VLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAY-QNRQFDVIIMDIQMPVMDGLE 62

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQL 903
           A+  IR           +               A   +Y+SKPL+ NQL
Sbjct: 63  AVSEIRNYERTHNTKRASXXXXXXXXXXXXRPGAELDEYVSKPLNPNQL 111


>2iynC [x.x.x] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
          Length = 108

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 13/120 (10%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           R+LVV+D+      +   LE+   + + A +   A   L + P  DL+L+D M+P   G 
Sbjct: 2   RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLDWMLPGGSGI 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
           + ++ +++      IP++ LTA             GA DYI+KP    +L++ ++  + R
Sbjct: 61  QFIKHLKRESMTRDIPVVMLTA------------TGADDYITKPFSPKELVARIKAVMRR 108


>1zitA [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
          Length = 121

 Score = 44.3 bits (103), Expect = 1e-06
 Identities = 29/111 (26%), Positives = 56/111 (50%), Gaps = 3/111 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           RVLVVDD+     +++A LEE+      A   REA++ + +     ++++D+ MP+ DG 
Sbjct: 3   RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKEL-FFPVIVLDVWMPDGDGV 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
             +  I++        +I +T         K ++ GA +++ KP  + + L
Sbjct: 62  NFIDFIKE--NSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFL 110


>1qmpA [c.23.1] SPO0A
          Length = 125

 Score = 44.3 bits (103), Expect = 1e-06
 Identities = 35/117 (29%), Positives = 64/117 (54%), Gaps = 5/117 (4%)

Query: 794 RVLVVDDDMRNVFAITAALEEQ-EIEVL-FAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           +V + DD+   V  +   +  Q ++EV+  A NG++  ++L +    D++L+ I+MP +D
Sbjct: 3   KVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRP-DILLL-IIMPHLD 60

Query: 852 GYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           G   ++ IR   E++   +I LTA   +    K ++ GAS +I KP D+  L   +R
Sbjct: 61  GLAVLERIRAGFEHQP-NVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR 116


>1nxoA [c.23.1] DNA-BINDING RESPONSE REGULATOR
          Length = 116

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 9/121 (7%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREA-QEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+VDD+      I   + ++  EV+ A NGREA ++   + P            E+  
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPXXXXXXXXXXXXEV-- 59

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
               ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L 
Sbjct: 60  ---AKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 113

Query: 913 R 913
           R
Sbjct: 114 R 114


>3cu5B [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
          Length = 129

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 29/118 (24%), Positives = 63/118 (53%), Gaps = 6/118 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEI---EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEM 850
           R+L+VDD+      + A +  + +   ++  A +G  A +I ++ P  +++L D+ MP M
Sbjct: 3   RILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALKHPP-NVLLTDVRMPRM 61

Query: 851 DGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           DG E + +I K+  Y    +I ++  + K      ++  A  Y+ KP+D ++++  ++
Sbjct: 62  DGIELVDNILKL--YPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIMDALK 117


>2pl1A [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
          Length = 117

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 839 DLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPL 898
           D+ ++D+ +P+ DG   ++  R       +PI+ LTA+    D+ + L AGA DY++KP 
Sbjct: 45  DIAIVDLGLPDEDGLSLIRRWRSNDV--SLPILVLTARESWQDKVEVLSAGADDYVTKPF 102

Query: 899 DINQL 903
            I ++
Sbjct: 103 HIEEV 107


>2pkxB [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
          Length = 116

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 839 DLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPL 898
           D+ ++D+ +P+ DG   ++  R       +PI+ LTA+    D+ + L AGA DY++KP 
Sbjct: 45  DIAIVDLGLPDEDGLSLIRRWRSNDV--SLPILVLTARESWQDKVEVLSAGADDYVTKPF 102

Query: 899 DINQL 903
            I ++
Sbjct: 103 HIEEV 107


>2pkxA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PHOP
          Length = 115

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 839 DLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPL 898
           D+ ++D+ +P+ DG   ++  R       +PI+ LTA+    D+ + L AGA DY++KP 
Sbjct: 45  DIAIVDLGLPDEDGLSLIRRWRSNDV--SLPILVLTARESWQDKVEVLSAGADDYVTKPF 102

Query: 899 DINQL 903
            I ++
Sbjct: 103 HIEEV 107


>1nxxA [c.23.1] DNA-BINDING RESPONSE REGULATOR
          Length = 114

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 10/121 (8%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREA-QEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+VDD+      I   + ++  EV+ A NGREA ++   + P                
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPXXXXXXXXXXX----- 56

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLY 912
            E  ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L 
Sbjct: 57  -EVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 112

Query: 913 R 913
           R
Sbjct: 113 R 113


>1nxsA [c.23.1] DNA-BINDING RESPONSE REGULATOR
          Length = 117

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 6/120 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD+      I   + ++  EV+ A NGREA E   Q                   
Sbjct: 2   KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALE---QFEAEQXXXXXXXXXXXXXX 58

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
              ++IRK      +PI+ L+AK  + D+   L+ GA DY++KP    +L + ++  L R
Sbjct: 59  XVAKTIRKT---SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 115


>2ftkE [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
          Length = 118

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L+VDD       +     ++  +   A NG +A +I+ +    DLVL+ + +P MDG 
Sbjct: 3   KILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERP-DLVLL-MKIPGMDGI 60

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           E ++ ++ + E   I +I +TA        +  + GA  + +KP DI+++   ++ +L
Sbjct: 61  EILKRMKVIDE--NIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 116


>3cfyA [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
          Length = 130

 Score = 43.1 bits (100), Expect = 3e-06
 Identities = 28/122 (22%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           RVL+V+D           ++++  ++     GR+A + + ++    L+++D+ +P+M G 
Sbjct: 4   RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKP-QLIILDLKLPDMSGE 62

Query: 854 EAMQSIRKMPEYEKIP--IIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           + +  I +      IP  +I  TA          +Q GA D++ KP++ ++L + + + L
Sbjct: 63  DVLDWINQ----NDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHL 118

Query: 912 YR 913
            R
Sbjct: 119 KR 120


>1ys6A [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA
          Length = 225

 Score = 42.7 bits (99), Expect = 4e-06
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 818 EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKA 877
           EV  A +G EA     +    D +++DI MP +DG   + ++R M     +P+  L+A+ 
Sbjct: 27  EVATAVDGAEALRSATENRP-DAIVLDINMPVLDGVSVVTALRAMD--NDVPVCVLSARV 83

Query: 878 MKGDRDKCLQAGASDYISKP 897
              DR   L+AGA DY+ KP
Sbjct: 84  --DDRVAGLEAGADDYLVKP 101


>1mihA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 42.7 bits (99), Expect = 4e-06
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISDWRMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 109


>1cyeA [x.x.x] CHEY
          Length = 129

 Score = 42.7 bits (99), Expect = 4e-06
 Identities = 34/118 (28%), Positives = 52/118 (44%), Gaps = 13/118 (11%)

Query: 785 QGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGID 839
           + DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G  
Sbjct: 1   RSDKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYG 52

Query: 840 LVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            V+ D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 53  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 110


>2cheA [x.x.x] CHEY
          Length = 128

 Score = 42.7 bits (99), Expect = 4e-06
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   +
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFI 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADSAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 109


>1f4vC [c.23.1] CHEMOTAXIS CHEY PROTEIN
          Length = 126

 Score = 42.4 bits (98), Expect = 5e-06
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 109


>1djmA [c.23.1] CHEMOTAXIS PROTEIN Y
          Length = 129

 Score = 42.4 bits (98), Expect = 5e-06
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 3   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 54

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 55  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 110


>3chyA [c.23.1 (1a0oA)] CHEY
          Length = 128

 Score = 42.4 bits (98), Expect = 5e-06
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 109


>2qzjA [x.x.x] TWO-COMPONENT RESPONSE REGULATOR
          Length = 119

 Score = 42.0 bits (97), Expect = 7e-06
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           ++L++D D  N   +   LEE+ I +  A N  EA   +      DL+ ++I++ + DG+
Sbjct: 3   KILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNK-YDLIFLEIILSDGDGW 61

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
              + IR +      PI+       +   +  L +G  DY+ KPL++  L + ++  L R
Sbjct: 62  TLCKKIRNV---TTCPIVYTYINEDQSILN-ALNSGGDDYLIKPLNLEILYAKVKAILRR 117


>1k66A [c.23.1] PHYTOCHROME RESPONSE REGULATOR RCPB
          Length = 149

 Score = 42.0 bits (97), Expect = 7e-06
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 11/128 (8%)

Query: 795 VLVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEILMQT---------PGIDLVLM 843
           +LVV+D   +       L+ + +   +     G +A + L QT         P   ++L+
Sbjct: 9   LLVVEDSDEDFSTFQRLLQREGVVNPIYRCITGDQALDFLYQTGSYCNPDIAPRPAVILL 68

Query: 844 DIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQL 903
           D+ +P  DG E +Q I++    +KIP++ +T  +   D              KPL+I++L
Sbjct: 69  DLNLPGTDGREVLQEIKQDEVLKKIPVVIMTTSSNPKDXXXXXXXXXXXXXVKPLEIDRL 128

Query: 904 LSLMRVWL 911
              ++ ++
Sbjct: 129 TETVQTFI 136


>1chnA [x.x.x] CHEY
          Length = 126

 Score = 42.0 bits (97), Expect = 7e-06
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 10/112 (8%)

Query: 791 KGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDI 845
           K  + LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V+ D 
Sbjct: 1   KELKFLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDW 55

Query: 846 MMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 56  NMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 107


>1qmpD [c.23.1] SPO0A
          Length = 124

 Score = 41.6 bits (96), Expect = 9e-06
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 794 RVLVVDDDMRNVFAITAALEEQ-EIEVL-FAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           +V + DD+   V  +   +  Q ++EV+  A NG++  ++L +    D++L+ I+MP +D
Sbjct: 3   KVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRP-DILLL-IIMPHLD 60

Query: 852 GYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           G   ++ IR   +     +I LTA   +    K ++ GAS +I KP D+  L   +R
Sbjct: 61  GLAVLERIRAGHQPN---VIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIR 114


>3hebA [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN
          Length = 139

 Score = 41.2 bits (95), Expect = 1e-05
 Identities = 26/123 (21%), Positives = 59/123 (47%), Gaps = 11/123 (8%)

Query: 796 LVVDDDMRNVFAITAALEEQEI--EVLFAGNGREAQEIL--------MQTPGIDLVLMDI 845
           +V++DD+ +   I   +    +  E++   +G  A   L        +      LVL+D+
Sbjct: 3   IVIEDDLGHARLIEKNIRRAGVNNEIIAFTDGTSALNYLFGDDKSGRVSAGRAQLVLLDL 62

Query: 846 MMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLS 905
            +P+  G + ++ +++ P   + P++ LT    + +  +C   GA+ YI+KP++     +
Sbjct: 63  NLPDT-GIDILKLVKENPHTRRSPVVILTTTDDQREIQRCYDLGANVYITKPVNYENFAN 121

Query: 906 LMR 908
            +R
Sbjct: 122 AIR 124


>1ymuA [c.23.1] CHEY
          Length = 125

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 10/109 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDIMMP 848
           + LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V+ D  MP
Sbjct: 3   KFLVVDD-----FSTGRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMP 57

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 58  NMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 106


>1p2fA [c.23.1 - a.4.6] RESPONSE REGULATOR
          Length = 212

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 10/123 (8%)

Query: 793 YRVLVVDDDMRNVFAITAALEEQ-EIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           +++ VVDDD   +  ++  L++   ++    G     ++ L       +V++D++ P+  
Sbjct: 1   WKIAVVDDDKNILKKVSEKLQQLGRVKTFLTG-----EDFLNDEEAFHVVVLDVL-PDYS 54

Query: 852 GYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
           GYE  +     PE     +I LT  +      K  +AGA DY++KP +   LL+ ++ +L
Sbjct: 55  GYEICRIKETRPETW---VILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFL 111

Query: 912 YRK 914
            R+
Sbjct: 112 ERE 114


>1dcfA [c.23.1] ETR1 PROTEIN
          Length = 133

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 26/118 (22%), Positives = 56/118 (47%), Gaps = 4/118 (3%)

Query: 792 GYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMD 851
           G +VLV+D++  +       L     EV    +  E   ++     +  V MD+ MP ++
Sbjct: 7   GLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKV--VFMDVCMPGVE 64

Query: 852 GYE-AMQSIRKMPEYEKIPI-IALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
            Y+ A++   K  +  + P+ +AL+    K  ++KC+  G    + KP+ ++ +  ++
Sbjct: 65  NYQIALRIHEKFTQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVL 122


>3hdvD [x.x.x] RESPONSE REGULATOR
          Length = 114

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VLVVDD+  N  A+   L+ + I+ + A    EA+  L     I L+  D+  PE  G +
Sbjct: 3   VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLI-TDLRQPE-SGLD 60

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRD----KCLQAGASDYISKPLDINQLLSLM 907
            +++IR           AL+   + GD D      +  G  D++ KP+D+ +LL L+
Sbjct: 61  LIRTIRASER------AALSIIVVSGDTDVEEAVDVHLGVVDFLLKPVDLGKLLELV 111


>3hdvC [x.x.x] RESPONSE REGULATOR
          Length = 118

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VLVVDD+  N  A+   L+ + I+ + A    EA+  L     I L+  D+  PE  G +
Sbjct: 7   VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLI-TDLRQPE-SGLD 64

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRD----KCLQAGASDYISKPLDINQLLSLM 907
            +++IR           AL+   + GD D      +  G  D++ KP+D+ +LL L+
Sbjct: 65  LIRTIRASER------AALSIIVVSGDTDVEEAVDVHLGVVDFLLKPVDLGKLLELV 115


>3hdvB [x.x.x] RESPONSE REGULATOR
          Length = 123

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VLVVDD+  N  A+   L+ + I+ + A    EA+  L     I L+  D+  PE  G +
Sbjct: 9   VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLI-TDLRQPE-SGLD 66

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRD----KCLQAGASDYISKPLDINQLLSLM 907
            +++IR           AL+   + GD D      +  G  D++ KP+D+ +LL L+
Sbjct: 67  LIRTIRASER------AALSIIVVSGDTDVEEAVDVHLGVVDFLLKPVDLGKLLELV 117


>3hdvA [x.x.x] RESPONSE REGULATOR
          Length = 117

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           VLVVDD+  N  A+   L+ + I+ + A    EA+  L     I L+  D+  PE  G +
Sbjct: 4   VLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLI-TDLRQPE-SGLD 61

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRD----KCLQAGASDYISKPLDINQLLSLM 907
            +++IR           AL+   + GD D      +  G  D++ KP+D+ +LL L+
Sbjct: 62  LIRTIRASER------AALSIIVVSGDTDVEEAVDVHLGVVDFLLKPVDLGKLLELV 112


>5chyA [x.x.x] CHEY
          Length = 128

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS ++ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGWVVKP 109


>1vlzB [c.23.1] CHEY
          Length = 127

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 1   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 52

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +               GAS Y+ KP
Sbjct: 53  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVXXXXXXXXXXXXXXXGASGYVVKP 108


>1vlzA [c.23.1] CHEY
          Length = 128

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +               GAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVXXXXXXXXXXXXXXXGASGYVVKP 109


>1id0A [d.122.1] PHOQ HISTIDINE KINASE
          Length = 146

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 33/123 (26%), Positives = 66/123 (53%), Gaps = 13/123 (10%)

Query: 589 LIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQILKNLLSNAFKFTNEGCVN 648
           L+  L      + ++K ++ ++ +  +I  +F  ++N  ++++ N+L NA K+  E    
Sbjct: 9   LLDNLTSALNKVYQRKGVNISLDISPEI--SFVGEQNDFVEVMGNVLDNACKYCLE---- 62

Query: 649 LHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGGTGLGLSIC 708
             V+ + + +++   IV  V D G GI   K+ +IF+  Q+ D  T R   G G+GL++ 
Sbjct: 63  -FVEISARQTDEHLYIV--VEDDGPGIPLSKREVIFDRGQRVD--TLRP--GQGVGLAVA 115

Query: 709 REL 711
           RE+
Sbjct: 116 REI 118


>1e6lA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 127

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVD      F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 1   DKELK---FLVVD-----AFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 52

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 53  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 108


>1ymvA [x.x.x] CHEY
          Length = 124

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 10/109 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDIMMP 848
           + LVVDD       +   L+E     L   N  EA++ +     +Q  G   V+ D  MP
Sbjct: 2   KFLVVDDGGTGRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMP 56

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 57  NMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 105


>1ehcA [x.x.x] CHEY
          Length = 128

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVD      F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDK-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 109


>1e6kA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 130

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 33/118 (27%), Positives = 51/118 (43%), Gaps = 13/118 (11%)

Query: 785 QGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGID 839
           + DK LK    LVV D     F+    +    ++ L   N  EA++ +     +Q  G  
Sbjct: 2   RSDKELK---FLVVAD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYG 53

Query: 840 LVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            V+ D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 111


>3cu5A [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
          Length = 124

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 32/118 (27%), Positives = 61/118 (51%), Gaps = 12/118 (10%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEI---EVLFAGNGREAQEILMQTPGIDLVLMDIMMPEM 850
           R+L+VDD+      + A +  + +   ++  A +G  A +I ++ P  +++L D+ MP M
Sbjct: 3   RILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALKHPP-NVLLTDVRMPRM 61

Query: 851 DGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           DG E + +I K+  Y    +I      M G  DK     A  Y+ KP+D ++++  ++
Sbjct: 62  DGIELVDNILKL--YPDCSVI-----FMSGYSDK-EYLRAIRYVEKPIDPSEIMDALK 111


>1ab6A [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 125

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 10/109 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDIMMP 848
           + LVVDD+      +   L+E     L   N  EA++ +     +Q  G   V+ D  MP
Sbjct: 3   KFLVVDDNSTMRRIVRNLLKE-----LGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMP 57

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MDG E +++IR       +P++  T              GAS Y+ KP
Sbjct: 58  NMDGLELLKTIRADGAMSALPVLMTTXXXXXXXXXXXXXXGASGYVVKP 106


>1ab5A [c.23.1] CHEY
          Length = 125

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 10/109 (9%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLVLMDIMMP 848
           + LVVDD+   +  IT  L    ++ L   N  EA++ +     +Q  G   V+ D  MP
Sbjct: 3   KFLVVDDNS-TMRRITRNL----LKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMP 57

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 58  NMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 106


>1xhfA [x.x.x] AEROBIC RESPIRATION CONTROL PROTEIN ARCA
          Length = 117

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 32/119 (26%), Positives = 59/119 (49%), Gaps = 7/119 (5%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+V+D++     + +  E +  +V  A +G E Q  ++    I+LV+ DI +P  +G  
Sbjct: 5   ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEHQ--ILSEYDINLVI-DINLPGKNGLL 61

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWLYR 913
             + +R+         + LT +  + D+   L+ GA DYI+KP +  +L    R  L R
Sbjct: 62  LARELREQANVA----LFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR 116


>1jbeA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 126

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIR--AAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 107


>1e6mA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 128

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           +    MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  ISAWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 109


>1i5cB [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 178

 Score = 38.9 bits (89), Expect = 6e-05
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 22/144 (15%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 35  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 94

Query: 669 SDTGIGIAKDKQALIFEAFQQGDGTTSRK----------------FGGTGLGLSICRELA 712
            D G GI  DK+ +I +A ++G    S+                 F   G+G+ + + + 
Sbjct: 95  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVV 152

Query: 713 GLLGGFIELQSIKGKGSTFSVYIP 736
             L G I ++S K KG+  ++ +P
Sbjct: 153 ESLNGSISIESEKDKGTKVTIRLP 176


>1i5bB [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 179

 Score = 38.9 bits (89), Expect = 6e-05
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 22/144 (15%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 36  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 95

Query: 669 SDTGIGIAKDKQALIFEAFQQGDGTTSRK----------------FGGTGLGLSICRELA 712
            D G GI  DK+ +I +A ++G    S+                 F   G+G+ + + + 
Sbjct: 96  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVV 153

Query: 713 GLLGGFIELQSIKGKGSTFSVYIP 736
             L G I ++S K KG+  ++ +P
Sbjct: 154 ESLNGSISIESEKDKGTKVTIRLP 177


>1i5bA [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 180

 Score = 38.9 bits (89), Expect = 6e-05
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 22/144 (15%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 37  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 96

Query: 669 SDTGIGIAKDKQALIFEAFQQGDGTTSRK----------------FGGTGLGLSICRELA 712
            D G GI  DK+ +I +A ++G    S+                 F   G+G+ + + + 
Sbjct: 97  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKGVGMDVVKNVV 154

Query: 713 GLLGGFIELQSIKGKGSTFSVYIP 736
             L G I ++S K KG+  ++ +P
Sbjct: 155 ESLNGSISIESEKDKGTKVTIRLP 178


>1heyA [x.x.x] CHEY
          Length = 127

 Score = 38.9 bits (89), Expect = 6e-05
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 833 MQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASD 892
           +Q  G   V+ D  MP MDG E +++IR       +P++ +T              GAS 
Sbjct: 44  LQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASG 103

Query: 893 YISKP 897
           Y+ KP
Sbjct: 104 YVVKP 108


>1b3qA [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
          Length = 368

 Score = 38.5 bits (88), Expect = 8e-05
 Identities = 37/186 (19%), Positives = 85/186 (45%), Gaps = 23/186 (12%)

Query: 572 IEAGKLIVKPEQISLTELIYTLERQFQPIARQ--KLLDFTIQ-LDNDIPKTFFTDKNR-L 627
           ++   +++K   + ++ +     R  + +A++  K ++F ++  D ++ +TF  +    L
Sbjct: 52  LDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPL 111

Query: 628 MQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSVSDTGIGIAKDKQALIF 684
           + +L+N + +  +   E          T I     +G  +V  V D G GI  DK+ +I 
Sbjct: 112 LHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGI--DKEKIIR 169

Query: 685 EAFQQGDGTTSRKF--------------GGTGLGLSICRELAGLLGGFIELQSIKGKGST 730
           +A ++G    S+                G +G+G+ + + +   L G + ++S K KG+ 
Sbjct: 170 KAIEKGLIDESKAATLSDQEILNFLFVPGFSGVGMDVVKNVVESLNGSMGIESEKDKGTK 229

Query: 731 FSVYIP 736
            ++ +P
Sbjct: 230 VTIRLP 235


>1a2oA [c.23.1 - c.40.1] CHEB METHYLESTERASE
          Length = 347

 Score = 38.5 bits (88), Expect = 8e-05
 Identities = 25/105 (23%), Positives = 52/105 (49%), Gaps = 2/105 (1%)

Query: 794 RVLVVDDDMRNVFAITAALEEQ-EIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDG 852
           RVL VDD       +T  +    ++E++           L++    D++ +D+ MP MDG
Sbjct: 5   RVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDG 64

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
            + ++ + ++     + + +LT K  +    + L+ GA D+++KP
Sbjct: 65  LDFLEKLMRLRPMPVVMVSSLTGKGSEVTL-RALELGAIDFVTKP 108


>3h5iA [x.x.x] RESPONSE REGULATOR/SENSORY BOX PROTEIN/GGDEF
          Length = 125

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 4/119 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPE-MDG 852
           ++L+V+D       I   L +    V  A  G  A E +      DL+LMDI + E MDG
Sbjct: 2   KILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVSGGWYPDLILMDIELGEGMDG 61

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVWL 911
            +   +I+++ E   +P++ LTA       +K     A  Y+ K      L++++ + L
Sbjct: 62  VQTALAIQQISE---LPVVFLTAHTEPAVVEKIRSVTAYGYVMKSATEQVLITIVEMAL 117


>6chyA [c.23.1] CHEY
          Length = 128

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           + D  MP MDG E +++IR       +P++ +               GAS ++ KP
Sbjct: 54  ISDWNMPNMDGLELLKTIRADGAMSALPVLMVXXXXXXXXXXXXXXXGASGWVVKP 109


>2i6fC [x.x.x] RESPONSE REGULATOR FRZS
          Length = 118

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 26/112 (23%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGR-EAQEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+V+ D      + +ALE +   V    +G+   ++I    P + ++ +D+   + +G
Sbjct: 2   KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQ-NG 60

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           Y     ++K  + + +PI+ +          K L+A A +Y++KP+D +QL+
Sbjct: 61  YLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV 111


>2i6fB [x.x.x] RESPONSE REGULATOR FRZS
          Length = 121

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 26/112 (23%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGR-EAQEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+V+ D      + +ALE +   V    +G+   ++I    P + ++ +D+   + +G
Sbjct: 2   KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQ-NG 60

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           Y     ++K  + + +PI+ +          K L+A A +Y++KP+D +QL+
Sbjct: 61  YLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV 111


>2i6fA [x.x.x] RESPONSE REGULATOR FRZS
          Length = 124

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 26/112 (23%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGR-EAQEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+V+ D      + +ALE +   V    +G+   ++I    P + ++ +D+   + +G
Sbjct: 4   KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQ-NG 62

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           Y     ++K  + + +PI+ +          K L+A A +Y++KP+D +QL+
Sbjct: 63  YLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV 113


>1i5dA [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 190

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 38/189 (20%), Positives = 80/189 (42%), Gaps = 30/189 (15%)

Query: 578 IVKPEQISLTELIYTLERQFQPIARQ--KLLDFTIQ-LDNDIPKTFFTDKNR-LMQILKN 633
           ++K   + ++ +     R  + +A++  K ++F ++  D ++ +TF  +    L+ +L+N
Sbjct: 1   VMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRN 60

Query: 634 LLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSVSDTGIGIAKDK----------- 679
            + +  +   E          T I     +G  +V  V D G GI K+K           
Sbjct: 61  AIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLI 120

Query: 680 ----------QALIFEAFQQGDGTTSR--KFGGTGLGLSICRELAGLLGGFIELQSIKGK 727
                     Q ++   F  G  T  +  +  G G+G+ + + +   L G I ++S K K
Sbjct: 121 DESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDK 180

Query: 728 GSTFSVYIP 736
           G+  ++ +P
Sbjct: 181 GTKVTIRLP 189


>2gkgA [x.x.x] RESPONSE REGULATOR HOMOLOG
          Length = 122

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 26/112 (23%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGR-EAQEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+V+ D      + +ALE +   V    +G+   ++I    P + ++ +D+   + +G
Sbjct: 2   KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQ-NG 60

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           Y     ++K  + + +PI+ +          K L+A A +Y++KP+D +QL+
Sbjct: 61  YLICGKLKKDDDLKNVPIVIIGNPDGFAQHRK-LKAHADEYVAKPVDADQLV 111


>3dzdA [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
          Length = 366

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           RVLVVDD+     +++A LEE+      A   REA++ + +     ++++D+  P+ DG 
Sbjct: 2   RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKEL-FFPVIVLDV-WPDGDGV 59

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
             +  I++        +I +T         K ++ GA +++ KP  + + L
Sbjct: 60  NFIDFIKE--NSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFL 108


>2vuiB [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 137

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+VDD+  ++ A+  ALE+ + +VL A  G            + +++ D  MP   G +
Sbjct: 4   ILLVDDEPHSLAAMKLALED-DFDVLTA-QGXXXXXXXXXXXWVQVIICDQRMPGRTGVD 61

Query: 855 AMQSIR-KMPEYEKIPIIALT--AKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
            +  +R + PE  +I I   T  A  M    D    AG   +++KP    QLLS  R
Sbjct: 62  FLTEVRERWPETVRIIITGYTDSASMMAAIND----AGIHQFLTKPWHPEQLLSSAR 114


>1rnlA [x.x.x] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
          Length = 200

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 822 AGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGD 881
           A NG +  E L ++   DL+L+D+ MP M+G E +  +R+     +I + +++    + D
Sbjct: 34  ASNGEQGIE-LAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNH--EED 90

Query: 882 RDKCLQAGASDYISKPLDINQLLSLM 907
               L+ GA  Y+ K ++   LL  +
Sbjct: 91  VVTALKRGADGYLLKDMEPEDLLKAL 116


>2nt4A [x.x.x] RESPONSE REGULATOR HOMOLOG
          Length = 126

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 27/117 (23%), Positives = 61/117 (52%), Gaps = 13/117 (11%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGR-EAQEILMQTPGIDLVLMDIMMPEMDG 852
           ++L+V+ D      + +ALE +   V    +G+   ++I    P + ++ +D+   + +G
Sbjct: 6   KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQ-NG 64

Query: 853 YEAMQSIRKMPEYEKIPIIALTAKAMKGDRD-----KCLQAGASDYISKPLDINQLL 904
           Y     ++K  + + +PI+ +      G+ D     + L+A A +Y++KP+D +QL+
Sbjct: 65  YLICGKLKKDDDLKNVPIVII------GNPDGFAQFRKLKAHADEYVAKPVDADQLV 115


>2jk1A [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 138

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+VDD+  ++ A+  ALE+ + +VL A  G            + +++ D  MP   G +
Sbjct: 3   ILLVDDEPHSLAAMKLALED-DFDVLTA-QGXXXXXXXXXXXWVQVIICDQRMPGRTGVD 60

Query: 855 AMQSIR-KMPEYEKIPIIALT--AKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
            +  +R + PE  +I I   T  A  M    D    AG   +++KP    QLLS  R
Sbjct: 61  FLTEVRERWPETVRIIITGYTDSASMMAAIND----AGIHQFLTKPWHPEQLLSSAR 113


>1i59B [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 188

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 33/151 (21%), Positives = 61/151 (40%), Gaps = 27/151 (17%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 36  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 95

Query: 669 SDTGIGIAKDK---------------------QALIFEAFQQGDGTTSR--KFGGTGLGL 705
            D G GI K+K                     Q ++   F  G  T  +  +  G G+G+
Sbjct: 96  EDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGM 155

Query: 706 SICRELAGLLGGFIELQSIKGKGSTFSVYIP 736
            + + +   L G I ++S K KG+  ++ +P
Sbjct: 156 DVVKNVVESLNGSISIESEKDKGTKVTIRLP 186


>1i58A [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 189

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 33/151 (21%), Positives = 61/151 (40%), Gaps = 27/151 (17%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 37  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 96

Query: 669 SDTGIGIAKDK---------------------QALIFEAFQQGDGTTSR--KFGGTGLGL 705
            D G GI K+K                     Q ++   F  G  T  +  +  G G+G+
Sbjct: 97  EDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGM 156

Query: 706 SICRELAGLLGGFIELQSIKGKGSTFSVYIP 736
            + + +   L G I ++S K KG+  ++ +P
Sbjct: 157 DVVKNVVESLNGSISIESEKDKGTKVTIRLP 187


>3i42A [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
          Length = 118

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 3/115 (2%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGY 853
           + L+V+D           LE    +  +  +G +A    M T G D V +D+ +P+  G 
Sbjct: 4   QALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHA-MSTRGYDAVFIDLNLPDTSGL 62

Query: 854 EAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             ++ +R +P  +    +A++    K D  K        Y+ KP+DI  L  +++
Sbjct: 63  ALVKQLRALPMEKTSKFVAVS--GFKNDLGKEACELFDFYLEKPIDIASLEPILQ 115


>2ch4A [x.x.x] CHEMOTAXIS PROTEIN CHEA
          Length = 320

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 33/151 (21%), Positives = 61/151 (40%), Gaps = 27/151 (17%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 37  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 96

Query: 669 SDTGIGIAKDK---------------------QALIFEAFQQGDGTTSR--KFGGTGLGL 705
            D G GI K+K                     Q ++   F  G  T  +  +  G G+G+
Sbjct: 97  EDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGM 156

Query: 706 SICRELAGLLGGFIELQSIKGKGSTFSVYIP 736
            + + +   L G I ++S K KG+  ++ +P
Sbjct: 157 DVVKNVVESLNGSISIESEKDKGTKVTIRLP 187


>1a04A [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
           NARL
          Length = 205

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 822 AGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGD 881
           A NG +  E L ++   DL+L+D+ MP M+G E +  +R+     +I + +++    + D
Sbjct: 34  ASNGEQGIE-LAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNH--EED 90

Query: 882 RDKCLQAGASDYISKPLDINQLLSLM 907
               L+ GA  Y+ K ++   LL  +
Sbjct: 91  VVTALKRGADGYLLKDMEPEDLLKAL 116


>1i58B [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 175

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 32/141 (22%), Positives = 61/141 (43%), Gaps = 19/141 (13%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 35  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 94

Query: 669 SDTGIGIAKDKQALIFEAFQQGDGTTSRK-------------FGGTGLGLSICRELAGLL 715
            D G GI  DK+ +I +A ++G    S+                G  +G+ + + +   L
Sbjct: 95  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSVGMDVVKNVVESL 152

Query: 716 GGFIELQSIKGKGSTFSVYIP 736
            G I ++S K KG+  ++ +P
Sbjct: 153 NGSISIESEKDKGTKVTIRLP 173


>3eodA [x.x.x] PROTEIN HNR
          Length = 115

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 12/124 (9%)

Query: 790 LKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQ-TPGIDLVLMDIMMP 848
           L G ++L+V+D+      + +         + A +G +A E+L   TP       D+M+ 
Sbjct: 3   LVGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTP-------DLMIC 55

Query: 849 EMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
           ++ G + ++ IR   +  + P++ ++A     D  K L+ G  D + KP  +N+L  ++ 
Sbjct: 56  DIAGLKLLEHIRNRGD--QTPVLVISATENMADIAKALRLGVEDVLLKP--VNRLREMVF 111

Query: 909 VWLY 912
             LY
Sbjct: 112 ACLY 115


>1b3qB [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
          Length = 370

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 37/195 (18%), Positives = 83/195 (42%), Gaps = 30/195 (15%)

Query: 572 IEAGKLIVKPEQISLTELIYTLERQFQPIARQ--KLLDFTIQ-LDNDIPKTFFTDKNR-L 627
           ++   +++K   + ++ +     R  + +A++  K ++F ++  D ++ +TF  +    L
Sbjct: 52  LDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPL 111

Query: 628 MQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSVSDTGIGIAKDK----- 679
           + +L+N + +  +   E          T I     +G  +V  V D G GI K+K     
Sbjct: 112 LHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKA 171

Query: 680 ----------------QALIFEAFQQGDGTTSR--KFGGTGLGLSICRELAGLLGGFIEL 721
                           Q ++   F  G  T  +  +  G G+G+ + + +   L G + +
Sbjct: 172 IEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSMGI 231

Query: 722 QSIKGKGSTFSVYIP 736
           +S K KG+  ++ +P
Sbjct: 232 ESEKDKGTKVTIRLP 246


>2qr3A [x.x.x] TWO-COMPONENT SYSTEM RESPONSE REGULATOR
          Length = 121

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 23/112 (20%), Positives = 49/112 (43%), Gaps = 2/112 (1%)

Query: 796 LVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEA 855
           +++ DD + V      L +     +             +    ++VL+D+     +G   
Sbjct: 5   IIIVDDNKGVLTAVQLLLKNHFSKVIXXXXXXXXXXXXREENPEVVLLDMNFTSNEGLFW 64

Query: 856 MQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLM 907
           +  I++  +Y  +P++  TA A      + ++ GASD++ KP D  +LL  +
Sbjct: 65  LHEIKR--QYRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETL 114


>1qkkA [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
          Length = 139

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           V ++DDD     A+   LE     V    +  EA   L       +V+ DI MP MDG  
Sbjct: 3   VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGIVISDIRMPGMDGLA 61

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             + I  +     +P+I +T         + +Q GA D+I+KP   ++L+   R
Sbjct: 62  LFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR 113


>1l5zA [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
          Length = 146

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           V ++DDD     A+   LE     V    +  EA   L       +V+ DI MP MDG  
Sbjct: 6   VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGIVISDIRMPGMDGLA 64

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             + I  +     +P+I +T         + +Q GA D+I+KP   ++L+   R
Sbjct: 65  LFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR 116


>1l5yB [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
          Length = 151

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           V ++DDD     A+   LE     V    +  EA   L       +V+ DI MP MDG  
Sbjct: 5   VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGIVISDIRMPGMDGLA 63

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             + I  +     +P+I +T         + +Q GA D+I+KP   ++L+   R
Sbjct: 64  LFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR 115


>1l5yA [c.23.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
          Length = 143

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           V ++DDD     A+   LE     V    +  EA   L       +V+ DI MP MDG  
Sbjct: 3   VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGL-SADFAGIVISDIRMPGMDGLA 61

Query: 855 AMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
             + I  +     +P+I +T         + +Q GA D+I+KP   ++L+   R
Sbjct: 62  LFRKILALDP--DLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSAR 113


>1i5aB [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 177

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 20/142 (14%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 36  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 95

Query: 669 SDTGIGIAKDKQALIFEAFQQGDGTTSRKF--------------GGTGLGLSICRELAGL 714
            D G GI  DK+ +I +A ++G    S+                G + +G+ + + +   
Sbjct: 96  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTVGMDVVKNVVES 153

Query: 715 LGGFIELQSIKGKGSTFSVYIP 736
           L G I ++S K KG+  ++ +P
Sbjct: 154 LNGSISIESEKDKGTKVTIRLP 175


>2vuhB [x.x.x] HYDROGENASE TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 135

 Score = 35.8 bits (81), Expect = 5e-04
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 795 VLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYE 854
           +L+VDD+  ++ A+  ALE+ + +VL A  G            + +++ +  MP   G +
Sbjct: 4   ILLVDDEPHSLAAMKLALED-DFDVLTA-QGXXXXXXXXXXXWVQVIICEQRMPGRTGVD 61

Query: 855 AMQSIR-KMPEYEKIPIIALT--AKAMKGDRDKCLQAGASDYISKPLDINQLLSLMR 908
            +  +R + PE  +I I   T  A  M    D    AG   +++KP    QLLS  R
Sbjct: 62  FLTEVRERWPETVRIIITGYTDSASMMAAIND----AGIHQFLTKPWHPEQLLSSAR 114


>3cg4A [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
          Length = 119

 Score = 35.8 bits (81), Expect = 5e-04
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 6/109 (5%)

Query: 796 LVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDLVLMDIMMPEMDGYEA 855
           ++VDDD     A+   L +    ++ A +G +  ++L +     +VL+DI     DG++ 
Sbjct: 5   VIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFS-GVVLLDI---PGDGWDT 60

Query: 856 MQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLL 904
           +++I      + I I+ LTAK    D    LQ    DYI+KP D   L+
Sbjct: 61  IRAILDNSLEQGIAIV-LTAKNAP-DAKIGLQEYVVDYITKPFDNEDLI 107


>1c4wA [c.23.1] CHEMOTAXIS PROTEIN CHEY
          Length = 127

 Score = 35.8 bits (81), Expect = 5e-04
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 14/116 (12%)

Query: 787 DKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEIL-----MQTPGIDLV 841
           DK LK    LVVDD     F+    +    ++ L   N  EA++ +     +Q  G   V
Sbjct: 2   DKELK---FLVVDD-----FSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFV 53

Query: 842 LMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKP 897
           +    MP MDG E +++IR       +P++ +T              GAS Y+ KP
Sbjct: 54  I-SWNMPNMDGLELLKTIRADGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKP 108


>1i5cA [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 181

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 33/149 (22%), Positives = 59/149 (39%), Gaps = 30/149 (20%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 36  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 95

Query: 669 SDTGIGIAKDK---------------------QALIFEAFQQGDGTTSRKFGGTGLGLSI 707
            D G GI K+K                     Q ++   F  G  T  R     G+G+ +
Sbjct: 96  EDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKER-----GVGMDV 150

Query: 708 CRELAGLLGGFIELQSIKGKGSTFSVYIP 736
            + +   L G I ++S K KG+  ++ +P
Sbjct: 151 VKNVVESLNGSISIESEKDKGTKVTIRLP 179


>1i5aA [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 181

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 23/145 (15%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 37  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 96

Query: 669 SDTGIGIAKDKQALIFEAFQQG--DGTTSRKFGGT---------------GLGLSICREL 711
            D G GI  DK+ +I +A ++G  D + +                     G+G+ + + +
Sbjct: 97  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEGVGMDVVKNV 154

Query: 712 AGLLGGFIELQSIKGKGSTFSVYIP 736
              L G I ++S K KG+  ++ +P
Sbjct: 155 VESLNGSISIESEKDKGTKVTIRLP 179


>1i59A [d.122.1] CHEMOTAXIS PROTEIN CHEA
          Length = 180

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 32/149 (21%), Positives = 64/149 (42%), Gaps = 31/149 (20%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 36  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 95

Query: 669 SDTGIGIAKDKQALIFEAFQQG---------------------DGTTSRKFGGTGLGLSI 707
            D G GI  DK+ +I +A ++G                      G ++++    G+G+ +
Sbjct: 96  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKR----GVGMDV 149

Query: 708 CRELAGLLGGFIELQSIKGKGSTFSVYIP 736
            + +   L G I ++S K KG+  ++ +P
Sbjct: 150 VKNVVESLNGSISIESEKDKGTKVTIRLP 178


>3eqzB [x.x.x] RESPONSE REGULATOR
          Length = 125

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 10/70 (14%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQE----ILMQTPGIDLVLMDIMMPE 849
           RV +VDDD      +T  L +  +E +F GN    Q     + +     D++++D+MMP+
Sbjct: 4   RVFIVDDD-----TLTCNLLKTIVEPIF-GNVEAFQHPRAFLTLSLNKQDIIILDLMMPD 57

Query: 850 MDGYEAMQSI 859
           MDG E ++ +
Sbjct: 58  MDGIEVIRHL 67


>3eqzA [x.x.x] RESPONSE REGULATOR
          Length = 124

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 10/70 (14%)

Query: 794 RVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQE----ILMQTPGIDLVLMDIMMPE 849
           RV +VDDD      +T  L +  +E +F GN    Q     + +     D++++D+MMP+
Sbjct: 3   RVFIVDDD-----TLTCNLLKTIVEPIF-GNVEAFQHPRAFLTLSLNKQDIIILDLMMPD 56

Query: 850 MDGYEAMQSI 859
           MDG E ++ +
Sbjct: 57  MDGIEVIRHL 66


>1dbwB [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
          Length = 125

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 790 LKGYRVLVVDDD--MRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGI--DLVLMDI 845
           ++ Y V +VDD+  +R   A    +    +++      + A+  L   P +   +++ D+
Sbjct: 1   MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVRNGVLVTDL 55

Query: 846 MMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLD 899
            MP+M G E ++++  +     IP I +T         + ++AGA D+I KP +
Sbjct: 56  RMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE 107


>1dbwA [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
          Length = 123

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 790 LKGYRVLVVDDD--MRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGI--DLVLMDI 845
           ++ Y V +VDD+  +R   A    +    +++      + A+  L   P +   +++ D+
Sbjct: 1   MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVRNGVLVTDL 55

Query: 846 MMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLD 899
            MP+M G E ++++  +     IP I +T         + ++AGA D+I KP +
Sbjct: 56  RMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE 107


>3b2nA [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
          Length = 120

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 824 NGREAQEILMQTPGIDLVLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRD 883
           NG +A + L++    ++V++DI MP M G E +  IRK  ++  I +I +T     G  +
Sbjct: 35  NGLDAMK-LIEEYNPNVVILDIEMPGMTGLEVLAEIRK--KHLNIKVIIVTTFKRPGYFE 91

Query: 884 KCLQAGASDYISKPLDINQLL 904
           K +      Y+ K   I +L+
Sbjct: 92  KAVVNDVDAYVLKERSIEELV 112


>1d5wB [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
          Length = 121

 Score = 35.0 bits (79), Expect = 9e-04
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 790 LKGYRVLVVDDD--MRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGI-DLVLMDIM 846
           ++ Y V +VDD+  +R   A    +    +++      + A+  L   P + + VL+ + 
Sbjct: 1   MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVRNGVLVTLR 55

Query: 847 MPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLD 899
           MP+M G E ++++  +     IP I +T         + ++AGA D+I KP +
Sbjct: 56  MPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE 106


>1d5wA [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
          Length = 122

 Score = 35.0 bits (79), Expect = 9e-04
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 790 LKGYRVLVVDDD--MRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGI-DLVLMDIM 846
           ++ Y V +VDD+  +R   A    +    +++      + A+  L   P + + VL+ + 
Sbjct: 1   MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKM-----HQSAEAFLAFAPDVRNGVLVTLR 55

Query: 847 MPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLD 899
           MP+M G E ++++  +     IP I +T         + ++AGA D+I KP +
Sbjct: 56  MPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFE 106


>2ch4B [x.x.x] CHEMOTAXIS PROTEIN CHEA
          Length = 305

 Score = 35.0 bits (79), Expect = 9e-04
 Identities = 31/139 (22%), Positives = 58/139 (41%), Gaps = 17/139 (12%)

Query: 613 DNDIPKTFFTDKNR-LMQILKNLLSNAFKFTNEGCVNLHVQRATKI---SEKGTQIVFSV 668
           D ++ +TF  +    L+ +L+N + +  +   E          T I     +G  +V  V
Sbjct: 36  DTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEV 95

Query: 669 SDTGIGIAKDKQALIFEAFQQG-----------DGTTSRKFGGTGLGLSICRELAGLLGG 717
            D G GI  DK+ +I +A ++G           D          G  + + + +   L G
Sbjct: 96  EDDGRGI--DKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSMDVVKNVVESLNG 153

Query: 718 FIELQSIKGKGSTFSVYIP 736
            I ++S K KG+  ++ +P
Sbjct: 154 SISIESEKDKGTKVTIRLP 172


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.137    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 996,163,665
Number of extensions: 40705306
Number of successful extensions: 104718
Number of sequences better than 1.0e-03: 1295
Number of HSP's gapped: 103791
Number of HSP's successfully gapped: 1866
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)