BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO48823.1 dred0 ABO48823.1 GIB00494CH01 "acetylornithine
aminotransferase"
         (396 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ARGD_THETN RecName: Full=Acetylornithine aminotransferase;      ...   432   e-123
ARGD_METJA RecName: Full=Acetylornithine aminotransferase;      ...   424   e-121
ARGD_METTH RecName: Full=Acetylornithine aminotransferase;      ...   398   e-113
ARGD_THEEB RecName: Full=Acetylornithine aminotransferase;      ...   393   e-111
ARGD_SYNY3 RecName: Full=Acetylornithine aminotransferase;      ...   385   e-109
ARGD_GLOVI RecName: Full=Acetylornithine aminotransferase;      ...   377   e-107
ARGD_ANASP RecName: Full=Acetylornithine aminotransferase;      ...   370   e-104
ARGD_THEMA RecName: Full=Acetylornithine aminotransferase;      ...   369   e-104
ARGD_CLOAB RecName: Full=Acetylornithine aminotransferase;      ...   355   e-100
ARGD_MYXXA RecName: Full=Acetylornithine aminotransferase;      ...   354   e-100
ARUC_PSEAE RecName: Full=Succinylornithine transaminase/acetylor...   351   7e-99
ARGD_NEIMB RecName: Full=Acetylornithine aminotransferase;      ...   351   7e-99
ARGD_NEIMA RecName: Full=Acetylornithine aminotransferase;      ...   350   9e-99
ARGD_NITEU RecName: Full=Acetylornithine aminotransferase;      ...   341   6e-96
ARGD_PSEPK RecName: Full=Acetylornithine aminotransferase;      ...   340   1e-95
ARGD_PROMA RecName: Full=Acetylornithine aminotransferase;      ...   334   9e-94
ARGD1_PSESM RecName: Full=Acetylornithine aminotransferase 1;   ...   333   1e-93
ARGD_BACST RecName: Full=Acetylornithine aminotransferase;      ...   332   4e-93
ARGD_VIBCH RecName: Full=Acetylornithine aminotransferase;      ...   328   4e-92
ARGD_BACSU RecName: Full=Acetylornithine aminotransferase;      ...   328   6e-92
ASTC_ECOHS RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECOSE RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECOLI RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECOLC RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECODH RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECOBW RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECO8A RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ASTC_ECO24 RecName: Full=Succinylornithine transaminase;        ...   326   2e-91
ARGD_AQUAE RecName: Full=Acetylornithine aminotransferase;      ...   326   2e-91
ASTC_ESCF3 RecName: Full=Succinylornithine transaminase;        ...   325   4e-91
ASTC_ECOSM RecName: Full=Succinylornithine transaminase;        ...   325   5e-91
ASTC_SHISS RecName: Full=Succinylornithine transaminase;        ...   324   7e-91
ASTC_ECO55 RecName: Full=Succinylornithine transaminase;        ...   324   7e-91
ASTC_ECOLU RecName: Full=Succinylornithine transaminase;        ...   324   9e-91
ASTC_ECO27 RecName: Full=Succinylornithine transaminase;        ...   324   9e-91
ARGD_YERPE RecName: Full=Acetylornithine/succinyldiaminopimelate...   324   9e-91
ASTC_CITK8 RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ARGD_ECOL6 RecName: Full=Acetylornithine/succinyldiaminopimelate...   323   2e-90
ARGD_ECO57 RecName: Full=Acetylornithine/succinyldiaminopimelate...   323   2e-90
ASTC_ECOUT RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ASTC_ECOL6 RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ASTC_ECOL5 RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ASTC_ECOK1 RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ASTC_ECO81 RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ASTC_ECO7I RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ASTC_ECO45 RecName: Full=Succinylornithine transaminase;        ...   323   2e-90
ARGD_ECOLI RecName: Full=Acetylornithine/succinyldiaminopimelate...   323   2e-90
ARGD_BACHD RecName: Full=Acetylornithine aminotransferase;      ...   323   2e-90
ASTC_ECO5E RecName: Full=Succinylornithine transaminase;        ...   322   3e-90
ASTC_ECO57 RecName: Full=Succinylornithine transaminase;        ...   322   3e-90
ASTC_SALPK RecName: Full=Succinylornithine transaminase;        ...   321   6e-90
ASTC_SALPA RecName: Full=Succinylornithine transaminase;        ...   321   6e-90
ASTC_SHIBS RecName: Full=Succinylornithine transaminase;        ...   321   8e-90
ASTC_SHIB3 RecName: Full=Succinylornithine transaminase;        ...   321   8e-90
ARGD_LISMF RecName: Full=Acetylornithine aminotransferase;      ...   321   8e-90
ASTC_SALG2 RecName: Full=Succinylornithine transaminase;        ...   320   2e-89
ASTC_SALEP RecName: Full=Succinylornithine transaminase;        ...   320   2e-89
ARGD_PHOLL RecName: Full=Acetylornithine/succinyldiaminopimelate...   320   2e-89
ARGD_OCEIH RecName: Full=Acetylornithine aminotransferase;      ...   320   2e-89
ASTC_SALTY RecName: Full=Succinylornithine transaminase;        ...   319   3e-89
ASTC_SALPB RecName: Full=Succinylornithine transaminase;        ...   319   3e-89
ASTC_SALNS RecName: Full=Succinylornithine transaminase;        ...   318   4e-89
ASTC_SALA4 RecName: Full=Succinylornithine transaminase;        ...   318   4e-89
ASTC_SALPC RecName: Full=Succinylornithine transaminase;        ...   318   5e-89
ASTC_SALHS RecName: Full=Succinylornithine transaminase;        ...   318   5e-89
ASTC_SALDC RecName: Full=Succinylornithine transaminase;        ...   318   5e-89
ARGD_SHIFL RecName: Full=Acetylornithine/succinyldiaminopimelate...   318   5e-89
ASTC_YERPG RecName: Full=Succinylornithine transaminase;        ...   318   7e-89
ASTC_YERPE RecName: Full=Succinylornithine transaminase;        ...   318   7e-89
ASTC_YERPA RecName: Full=Succinylornithine transaminase;        ...   318   7e-89
ASTC_SALTI RecName: Full=Succinylornithine transaminase;        ...   318   7e-89
ASTC_YERP3 RecName: Full=Succinylornithine transaminase;        ...   317   9e-89
ASTC_YERPS RecName: Full=Succinylornithine transaminase;        ...   317   1e-88
ARGD_SALTY RecName: Full=Acetylornithine/succinyldiaminopimelate...   317   1e-88
ASTC_SALCH RecName: Full=Succinylornithine transaminase;        ...   317   1e-88
ARGD_VIBVU RecName: Full=Acetylornithine aminotransferase;      ...   315   6e-88
ARGD_SALTI RecName: Full=Acetylornithine/succinyldiaminopimelate...   315   6e-88
ARGD_PASMU RecName: Full=Acetylornithine aminotransferase;      ...   315   6e-88
ARGD_HAEDU RecName: Full=Acetylornithine aminotransferase;      ...   315   6e-88
ARGD_METKA RecName: Full=Acetylornithine aminotransferase;      ...   314   1e-87
ARGD1_BRAJA RecName: Full=Acetylornithine aminotransferase 1;   ...   314   1e-87
ARGD_VIBVY RecName: Full=Acetylornithine aminotransferase;      ...   313   1e-87
ARGD_STRMU RecName: Full=Acetylornithine aminotransferase;      ...   313   2e-87
ARGD_RHILO RecName: Full=Acetylornithine aminotransferase;      ...   312   3e-87
ARGD_ARCFU RecName: Full=Acetylornithine aminotransferase;      ...   312   3e-87
ARGD_ALNGL RecName: Full=Acetylornithine aminotransferase, mitoc...   311   5e-87
ARGD_PROMM RecName: Full=Acetylornithine aminotransferase;      ...   311   8e-87
ARGD_BRUSU RecName: Full=Acetylornithine aminotransferase;      ...   310   2e-86
ARGD_BRUME RecName: Full=Acetylornithine aminotransferase;      ...   310   2e-86
ARGD_VIBPA RecName: Full=Acetylornithine aminotransferase;      ...   309   2e-86
ASTC_PHOLL RecName: Full=Succinylornithine transaminase;        ...   309   3e-86
ARGD_METMA RecName: Full=Acetylornithine aminotransferase;      ...   307   9e-86
ARGD_LISMO RecName: Full=Acetylornithine aminotransferase;      ...   307   1e-85
ARGD_METAC RecName: Full=Acetylornithine aminotransferase;      ...   306   2e-85
ASTC_YERE8 RecName: Full=Succinylornithine transaminase;        ...   304   1e-84
ASTC_CAUCR RecName: Full=Succinylornithine transaminase;        ...   303   1e-84
ARGD_AGRT5 RecName: Full=Acetylornithine aminotransferase;      ...   303   2e-84
ARGD_SHEON RecName: Full=Acetylornithine aminotransferase;      ...   300   2e-83
ARGD_SYNPX RecName: Full=Acetylornithine aminotransferase;      ...   299   2e-83
ARGD_RHIME RecName: Full=Acetylornithine aminotransferase;      ...   298   4e-83
ARGD2_BRAJA RecName: Full=Acetylornithine aminotransferase 2;   ...   298   5e-83
ARGD_RALSO RecName: Full=Acetylornithine aminotransferase;      ...   296   2e-82
ARGD_PROMP RecName: Full=Acetylornithine aminotransferase;      ...   295   5e-82
ARGD_WOLSU RecName: Full=Acetylornithine aminotransferase;      ...   293   2e-81
ARGD_COREF RecName: Full=Acetylornithine aminotransferase;      ...   293   2e-81
ARGD_CHLTE RecName: Full=Acetylornithine aminotransferase;      ...   292   3e-81
ARGD_LISIN RecName: Full=Acetylornithine aminotransferase;      ...   292   4e-81
ARGD_XANCP RecName: Full=Acetylornithine aminotransferase;      ...   291   9e-81
ARGD2_PSESM RecName: Full=Acetylornithine aminotransferase 2;   ...   291   9e-81
ARGD_BUCAI RecName: Full=Acetylornithine/succinyldiaminopimelate...   288   4e-80
ARGD_XYLFA RecName: Full=Acetylornithine aminotransferase;      ...   287   1e-79
ARGD_BACAN RecName: Full=Acetylornithine aminotransferase;      ...   286   2e-79
ARGD_XYLFT RecName: Full=Acetylornithine aminotransferase;      ...   286   3e-79
ARGD_DEBHA RecName: Full=Acetylornithine aminotransferase, mitoc...   286   3e-79
ARGD_CORGL RecName: Full=Acetylornithine aminotransferase;      ...   286   3e-79
ARGD_NEUCR RecName: Full=Acetylornithine aminotransferase, mitoc...   285   5e-79
ARGD_BACCR RecName: Full=Acetylornithine aminotransferase;      ...   283   1e-78
ARGD_YARLI RecName: Full=Acetylornithine aminotransferase, mitoc...   283   2e-78
ARGD_BUCAP RecName: Full=Acetylornithine/succinyldiaminopimelate...   281   7e-78
OAT2_STAAW RecName: Full=Ornithine aminotransferase 2;         S...   278   4e-77
OAT2_STAAS RecName: Full=Ornithine aminotransferase 2;         S...   278   4e-77
OAT2_STAAR RecName: Full=Ornithine aminotransferase 2;         S...   278   4e-77
OAT2_STAAN RecName: Full=Ornithine aminotransferase 2;         S...   278   4e-77
OAT2_STAAM RecName: Full=Ornithine aminotransferase 2;         S...   278   4e-77
OAT2_STAAC RecName: Full=Ornithine aminotransferase 2;         S...   278   4e-77
ARGD1_BORPA RecName: Full=Acetylornithine aminotransferase 1;   ...   278   4e-77
ARGD1_BORBR RecName: Full=Acetylornithine aminotransferase 1;   ...   278   4e-77
OAT_STACT RecName: Full=Ornithine aminotransferase;         Shor...   278   6e-77
OAT2_STAS1 RecName: Full=Ornithine aminotransferase 2;         S...   278   8e-77
ARGD_DICDI RecName: Full=Probable acetylornithine aminotransfera...   277   1e-76
ARGD_CAMJE RecName: Full=Acetylornithine aminotransferase;      ...   277   1e-76
OAT1_STAAW RecName: Full=Ornithine aminotransferase 1;         S...   273   1e-75
OAT1_STAAS RecName: Full=Ornithine aminotransferase 1;         S...   273   1e-75
OAT1_STAAN RecName: Full=Ornithine aminotransferase 1;         S...   273   1e-75
OAT1_STAAM RecName: Full=Ornithine aminotransferase 1;         S...   273   1e-75
OAT1_STAAC RecName: Full=Ornithine aminotransferase 1;         S...   273   1e-75
ARGD_LEPIN RecName: Full=Acetylornithine aminotransferase;      ...   273   2e-75
ARGD_LEPIC RecName: Full=Acetylornithine aminotransferase;      ...   273   2e-75
ARGD1_BORPE RecName: Full=Acetylornithine aminotransferase 1;   ...   273   2e-75
OAT1_STAAR RecName: Full=Ornithine aminotransferase 1;         S...   272   3e-75
ARGD_XANAC RecName: Full=Acetylornithine aminotransferase;      ...   270   2e-74
ARGD_CAUCR RecName: Full=Acetylornithine aminotransferase;      ...   270   2e-74
OAT_GEOSW RecName: Full=Ornithine aminotransferase;         Shor...   270   2e-74
OAT_BACSU RecName: Full=Ornithine aminotransferase;         Shor...   268   8e-74
OAT_STAES RecName: Full=Ornithine aminotransferase;         Shor...   266   2e-73
OAT_STAEQ RecName: Full=Ornithine aminotransferase;         Shor...   266   2e-73
OAT_MACCJ RecName: Full=Ornithine aminotransferase;         Shor...   263   1e-72
ARGD_STRAW RecName: Full=Acetylornithine aminotransferase;      ...   263   3e-72
ARGD_ASHGO RecName: Full=Acetylornithine aminotransferase, mitoc...   263   3e-72
OAT_DROAN RecName: Full=Ornithine aminotransferase, mitochondria...   262   3e-72
OAT_PLAFD RecName: Full=Ornithine aminotransferase;         EC=2...   262   4e-72
OAT_PLAF7 RecName: Full=Ornithine aminotransferase;         EC=2...   262   4e-72
OAT_DROME RecName: Full=Ornithine aminotransferase, mitochondria...   261   7e-72
ARGD_MYCLE RecName: Full=Acetylornithine aminotransferase;      ...   260   1e-71
ARGD2_BORPE RecName: Full=Acetylornithine aminotransferase 2;   ...   259   2e-71
ARGD_STRCO RecName: Full=Acetylornithine aminotransferase;      ...   259   3e-71
ARGD_LACLA RecName: Full=Acetylornithine aminotransferase;      ...   258   5e-71
ARGD2_BORBR RecName: Full=Acetylornithine aminotransferase 2;   ...   258   5e-71
ARGD_STAEQ RecName: Full=Acetylornithine aminotransferase;      ...   257   1e-70
ARGD_STAES RecName: Full=Acetylornithine aminotransferase;      ...   257   1e-70
ARGD2_BORPA RecName: Full=Acetylornithine aminotransferase 2;   ...   257   1e-70
OAT_PLACH RecName: Full=Ornithine aminotransferase;         EC=2...   254   7e-70
ARGD_MYCTU RecName: Full=Acetylornithine aminotransferase;      ...   254   9e-70
ARGD_MYCBO RecName: Full=Acetylornithine aminotransferase;      ...   254   9e-70
ARGD_STRCL RecName: Full=Acetylornithine aminotransferase;      ...   254   1e-69
ARGD_SCHPO RecName: Full=Probable acetylornithine aminotransfera...   253   3e-69
OAT_OCEIH RecName: Full=Ornithine aminotransferase;         Shor...   252   3e-69
OAT_CAEEL RecName: Full=Probable ornithine aminotransferase, mit...   252   4e-69
ARGD_KLULA RecName: Full=Acetylornithine aminotransferase, mitoc...   252   4e-69
OAT_BRAJA RecName: Full=Ornithine aminotransferase;         Shor...   251   6e-69
OAT1_STAS1 RecName: Full=Ornithine aminotransferase 1;         S...   251   8e-69
OAT_BACCQ RecName: Full=Ornithine aminotransferase;         Shor...   250   2e-68
OAT_BACC3 RecName: Full=Ornithine aminotransferase;         Shor...   247   1e-67
OAT_BACAN RecName: Full=Ornithine aminotransferase;         Shor...   246   2e-67
OAT_BACAC RecName: Full=Ornithine aminotransferase;         Shor...   246   2e-67
OAT_BACAA RecName: Full=Ornithine aminotransferase;         Shor...   246   2e-67
OAT_BORPE RecName: Full=Ornithine aminotransferase;         Shor...   245   4e-67
OAT_BORPA RecName: Full=Ornithine aminotransferase;         Shor...   245   4e-67
OAT_BORBR RecName: Full=Ornithine aminotransferase;         Shor...   245   4e-67
OAT_BACCR RecName: Full=Ornithine aminotransferase;         Shor...   245   4e-67
ARGD_BIFLO RecName: Full=Acetylornithine aminotransferase;      ...   244   7e-67
ARGD_YEAST RecName: Full=Acetylornithine aminotransferase, mitoc...   243   2e-66
ARGD_SULTO RecName: Full=Acetylornithine/acetyl-lysine aminotran...   243   2e-66
OAT_PLAYO RecName: Full=Ornithine aminotransferase;         EC=2...   243   3e-66
ARGD_PYRKO RecName: Full=Acetylornithine aminotransferase;      ...   243   3e-66
ARGD_LACPL RecName: Full=Acetylornithine aminotransferase;      ...   242   4e-66
OAT_BACHD RecName: Full=Ornithine aminotransferase;         Shor...   241   8e-66
OAT_BOVIN RecName: Full=Ornithine aminotransferase, mitochondria...   239   3e-65
ARGD_PYRHO RecName: Full=Acetylornithine/acetyl-lysine aminotran...   239   3e-65
ARGD_PYRFU RecName: Full=Acetylornithine/acetyl-lysine aminotran...   239   3e-65
ARGD_THET8 RecName: Full=Acetylornithine/acetyl-lysine aminotran...   239   4e-65
OAT_RAT RecName: Full=Ornithine aminotransferase, mitochondrial;...   238   5e-65
OAT_BREBN RecName: Full=Ornithine aminotransferase;         Shor...   238   5e-65
ARGD_PYRAB RecName: Full=Acetylornithine/acetyl-lysine aminotran...   238   5e-65
ARGD_THET2 RecName: Full=Acetylornithine/acetyl-lysine aminotran...   238   7e-65
OAT_SCHPO RecName: Full=Probable ornithine aminotransferase;    ...   237   1e-64
OAT_MOUSE RecName: Full=Ornithine aminotransferase, mitochondria...   236   2e-64
OAT_EXISA RecName: Full=Ornithine aminotransferase;         Shor...   235   6e-64
ARGD_DEIRA RecName: Full=Acetylornithine/acetyl-lysine aminotran...   234   1e-63
OAT_HUMAN RecName: Full=Ornithine aminotransferase, mitochondria...   231   1e-62
OAT_DICDI RecName: Full=Probable ornithine aminotransferase;    ...   228   9e-62
PAT_ENTS8 RecName: Full=Putrescine aminotransferase;         EC=...   227   1e-61
PAT_ECOL5 RecName: Full=Putrescine aminotransferase;         EC=...   223   2e-60
ARGD_CANGA RecName: Full=Acetylornithine aminotransferase, mitoc...   223   2e-60
PAT_KLEP3 RecName: Full=Putrescine aminotransferase;         EC=...   222   4e-60
OAT_EMENI RecName: Full=Ornithine aminotransferase;         EC=2...   221   6e-60
PAT_ECOUT RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECOSE RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECOLU RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECOLI RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECOK1 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECOHS RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECODH RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECOBW RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO81 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO5E RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO57 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO55 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO45 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO27 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_ECO24 RecName: Full=Putrescine aminotransferase;         EC=...   221   1e-59
PAT_KLEP7 RecName: Full=Putrescine aminotransferase;         EC=...   220   1e-59
PAT_ECOLC RecName: Full=Putrescine aminotransferase;         EC=...   220   1e-59
PAT_ESCF3 RecName: Full=Putrescine aminotransferase;         EC=...   220   2e-59
OAT_YEAST RecName: Full=Ornithine aminotransferase;         EC=2...   220   2e-59
PAT_SHIFL RecName: Full=Putrescine aminotransferase;         EC=...   219   2e-59
PAT_SHIF8 RecName: Full=Putrescine aminotransferase;         EC=...   219   2e-59
PAT_ECOL6 RecName: Full=Putrescine aminotransferase;         EC=...   219   3e-59
PAT_ECO7I RecName: Full=Putrescine aminotransferase;         EC=...   219   3e-59
PAT_ECOSM RecName: Full=Putrescine aminotransferase;         EC=...   219   4e-59
PAT_ECO8A RecName: Full=Putrescine aminotransferase;         EC=...   218   5e-59
PAT_SALPK RecName: Full=Putrescine aminotransferase;         EC=...   218   7e-59
PAT_SALPA RecName: Full=Putrescine aminotransferase;         EC=...   218   7e-59
ARGD_PYRAE RecName: Full=Acetylornithine/acetyl-lysine aminotran...   218   9e-59
PAT_SHISS RecName: Full=Putrescine aminotransferase;         EC=...   217   1e-58
PAT_SALTI RecName: Full=Putrescine aminotransferase;         EC=...   217   1e-58
PAT_SALHS RecName: Full=Putrescine aminotransferase;         EC=...   217   1e-58
PAT_SALTY RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALSV RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALNS RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALG2 RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALEP RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALDC RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALA4 RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_CITK8 RecName: Full=Putrescine aminotransferase;         EC=...   216   3e-58
PAT_SALPC RecName: Full=Putrescine aminotransferase;         EC=...   215   5e-58
PAT_SALCH RecName: Full=Putrescine aminotransferase;         EC=...   215   5e-58
PAT_SALPB RecName: Full=Putrescine aminotransferase;         EC=...   215   6e-58
YKAB_BACPF RecName: Full=Uncharacterized aminotransferase in kat...   214   8e-58
PAT_ERWCT RecName: Full=Putrescine aminotransferase;         EC=...   213   2e-57
ARGD_BACAM RecName: Full=Acetylornithine aminotransferase;      ...   211   9e-57
PAT_SHIBS RecName: Full=Putrescine aminotransferase;         EC=...   211   1e-56
PAT_ENT38 RecName: Full=Putrescine aminotransferase;         EC=...   210   2e-56
PAT_SALAR RecName: Full=Putrescine aminotransferase;         EC=...   209   3e-56
GABT_ECOLI RecName: Full=4-aminobutyrate aminotransferase;      ...   209   4e-56
GABT_BACSU RecName: Full=Probable 4-aminobutyrate aminotransfera...   208   6e-56
YHXA_BACSU RecName: Full=Uncharacterized aminotransferase yhxA; ...   203   2e-54
ARGD_SULSO RecName: Full=Acetylornithine/acetyl-lysine aminotran...   203   2e-54
AGT22_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2...   202   5e-54
PUUE_ECOLI RecName: Full=4-aminobutyrate aminotransferase;      ...   189   4e-50
AGT23_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2...   185   7e-49
DAT_HAEIN RecName: Full=Diaminobutyrate--2-oxoglutarate aminotra...   179   3e-47
Y4UB_RHISN RecName: Full=Uncharacterized aminotransferase y4uB; ...   177   1e-46
Y1815_ARCFU RecName: Full=Uncharacterized aminotransferase AF_18...   176   3e-46
ECTB_NOCFA RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   174   1e-45
OAT_VIGAC RecName: Full=Ornithine aminotransferase;         EC=2...   173   2e-45
YFZ7_SCHPO RecName: Full=Uncharacterized aminotransferase C1039....   171   1e-44
TPA_BILWA RecName: Full=Taurine--pyruvate aminotransferase;     ...   171   1e-44
AGT2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase 2,...   171   1e-44
AGT21_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2...   169   3e-44
AGT2_PONAB RecName: Full=Alanine--glyoxylate aminotransferase 2,...   167   2e-43
AGT2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase 2,...   167   2e-43
AGT2_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase 2,...   165   7e-43
DAT_ACIBA RecName: Full=Diaminobutyrate--2-oxoglutarate aminotra...   164   1e-42
AGT2_RAT RecName: Full=Alanine--glyoxylate aminotransferase 2, m...   163   3e-42
ARGD_AERPE RecName: Full=Acetylornithine/acetyl-lysine aminotran...   162   5e-42
ECTB_CHRSD RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   160   2e-41
GSA2_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   159   5e-41
GSA_METMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   158   7e-41
GSA_SHEAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   157   1e-40
RHBA_RHIME RecName: Full=Diaminobutyrate--2-oxoglutarate aminotr...   157   1e-40
GSA_CHLCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   157   2e-40
GSA_SHEON RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   156   3e-40
GSA_SHESH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   4e-40
GSA_SHEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   4e-40
GSA_NATTJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   4e-40
GSA2_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   155   4e-40
GSA_SHEWM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   6e-40
GSA2_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   155   6e-40
GSA_SHESA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   7e-40
GSA_SHEPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   7e-40
GSA_SHELP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   7e-40
GSA_GEOSF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   155   7e-40
GSA_GEOUR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   154   1e-39
GSA_SHESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   154   1e-39
GSA_CHLPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   154   1e-39
GSA_SHESR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   153   2e-39
GSA_PROA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   153   3e-39
ECTB_VIBCH RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   153   3e-39
DGDA_BURCE RecName: Full=2,2-dialkylglycine decarboxylase;      ...   153   3e-39
GSA_SHEHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   4e-39
GSA_METM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   4e-39
GSA_META3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   4e-39
BIOA_HAEIN RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   152   4e-39
GSA_THERP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   5e-39
GSA_SHEDO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   5e-39
GSA_THISH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   6e-39
GSA_METM6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   152   6e-39
AT2L1_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase 2...   152   6e-39
ECTB_WOLSU RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   151   8e-39
GSA_SHEFN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   151   1e-38
GSA_NITMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   151   1e-38
BIOA_BACSH RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   151   1e-38
GSA_METM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   150   2e-38
GSA_DESAP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   150   2e-38
ECTB_OCEIH RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   150   2e-38
GSA_PELPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   149   3e-38
GSA_PSEA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   149   4e-38
GSA_METVS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   149   4e-38
ECTB_VIRPA RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   149   5e-38
GSA_PSEAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   148   7e-38
GSA_PSEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   148   7e-38
GSA_PSEA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   148   7e-38
GSA_METJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   148   7e-38
GSA_DESRM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   148   7e-38
GABT_MYCTU RecName: Full=4-aminobutyrate aminotransferase;      ...   148   9e-38
GABT_MYCBO RecName: Full=4-aminobutyrate aminotransferase;      ...   148   9e-38
GSA_SYNJB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   1e-37
GSA_GRAFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   1e-37
GSA1_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   147   1e-37
GSA_SYNJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_SHESW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_SHEPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_SHEB9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_SHEB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_SHEB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_SHEB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
GSA_METST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   147   2e-37
YAV5_SCHPO RecName: Full=Uncharacterized aminotransferase C27F1....   147   2e-37
BIOA_AQUAE RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   147   2e-37
GSA_THICR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   146   3e-37
GSA_HELMI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   146   3e-37
GSA1_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   146   3e-37
AT2L1_XENLA RecName: Full=Alanine--glyoxylate aminotransferase 2...   146   3e-37
AGT2L_DROME RecName: Full=Alanine--glyoxylate aminotransferase 2...   145   5e-37
Y4QG_RHISN RecName: Full=Uncharacterized aminotransferase y4qG; ...   145   6e-37
GSA_RUBXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   145   6e-37
GSA_CLOTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   145   6e-37
GSA_DESAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   145   8e-37
GSA_CHLTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   145   8e-37
GSA_CALS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   145   8e-37
GSA2_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   145   8e-37
AT2L1_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase 2...   145   8e-37
GSA_PSEFS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA_CHLL2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA1_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   144   1e-36
GSA1_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   144   1e-36
BIOA_METJA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   144   1e-36
GSA_PROMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA_PROMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA_PROM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA_PELLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA_PELCD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   1e-36
GSA_SYNPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   144   2e-36
GSA1_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   144   2e-36
GSA1_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   144   2e-36
GSA1_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   144   2e-36
GSA_SYNS9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   2e-36
GSA_PERMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   2e-36
GSA_GEOSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   2e-36
GSA2_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   2e-36
GSA2_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   2e-36
ECTB_STRAW RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   143   2e-36
GSA_THEEB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA_SYNS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA_PSEF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA_PROMT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA_PROM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA_METS5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA_CHLT3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   143   3e-36
GSA2_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA2_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   143   3e-36
GSA_PROMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_PROMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_PROM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_PROM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_PROM2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_PROM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_MARMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA_CHLP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   4e-36
GSA2_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   142   4e-36
GSA2_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   142   4e-36
ECTB_BACSK RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   142   4e-36
BIOB_BACTN RecName: Full=Biotin synthase;         EC=2.8.1.6;Alt...   142   4e-36
GSA_SULAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   5e-36
GSA_SOLUE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   5e-36
GSA_PROM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   5e-36
GSA_PELPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   5e-36
GSA_HAES1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   5e-36
GSA2_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   142   5e-36
YGD3_SCHPO RecName: Full=Uncharacterized aminotransferase C1771....   142   7e-36
GSA_PSEMY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   7e-36
GSA_ALTMD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   142   7e-36
AT2L1_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase 2...   142   7e-36
GSA_YERPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_YERP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_THEYD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_PSEU5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_MOOTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_KLEP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   9e-36
GSA_VIBVY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_VIBVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_PSEU2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_PSE14 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_NITSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_HAES2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_FUSNN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA_DESAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   141   1e-35
GSA2_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   141   1e-35
GSA2_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   141   1e-35
ECTB_MARHA RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   141   1e-35
GSA_SYNSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   1e-35
GSA_HERA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   1e-35
GSA_CLOK5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   1e-35
GSA_CLOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   1e-35
ECTB_BACHD RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   140   1e-35
GSA_VIBCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_VIBCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_VIBC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_SULSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_DESPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_CHLPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
ECTB_STRCO RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   140   2e-35
GSA_TOLAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_KLEP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_BORPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_BORBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA_ANATD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   140   2e-35
GSA2_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   140   2e-35
GSA_SYNPX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_MANSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_GEOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_CYAP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_CYAA5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_ANAVT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   3e-35
GSA_SHISS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_PSESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_PSEPF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_NOSP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ERWT9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOUT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOLU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOL6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOL5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECOHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO8A RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO81 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO55 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO45 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO27 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO24 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_DESHY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_DESHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ACTSZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   4e-35
GSA_ECO5E RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   6e-35
GSA_ECO57 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   139   6e-35
GSA_VIBF1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   7e-35
GSA_SERP5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   7e-35
GSA_GLOVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   7e-35
GSA_ERWCT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   7e-35
GSA1_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   138   7e-35
ECTB_HALEL RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   138   7e-35
BIOB_BACFR RecName: Full=Biotin synthase;         EC=2.8.1.6;Alt...   138   7e-35
GSA_VIBPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   9e-35
GSA_PHOLL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   9e-35
GSA_CYAP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   9e-35
GSA_BORPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   9e-35
GSA_ANASP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   138   9e-35
GSA2_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   138   9e-35
GSA_VIBFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   1e-34
GSA_GEOLS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   1e-34
GSA_CITK8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   1e-34
GSA_ALHEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   1e-34
GSA_ACAM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   1e-34
BIOB_BACFN RecName: Full=Biotin synthase;         EC=2.8.1.6;Alt...   137   1e-34
GSA_SYNY3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_PELTS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_HAEPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_DESDG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_CELJU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
ECTB_VIBPA RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   137   2e-34
BIOK_BACSU RecName: Full=Lysine-8-amino-7-oxononanoate aminotran...   137   2e-34
GSA_SALTY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_SALPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_SALCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_PECCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_COXBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_COXBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_COXBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_COXB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_COXB1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA_CAMHC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   137   2e-34
GSA2_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   137   2e-34
GSA1_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   137   2e-34
AGT2L_CAEEL RecName: Full=Alanine--glyoxylate aminotransferase 2...   137   2e-34
GSA_SYNR3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_SHIDS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_SHIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_SHIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_SALPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_SALPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_SALHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_NAUPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_ENT38 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_ECOSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_ECOLI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_ECODH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_ECOBW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
GSA_ECO7I RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   3e-34
AT2L1_DANRE RecName: Full=Alanine--glyoxylate aminotransferase 2...   136   3e-34
GSA_PICTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   4e-34
GSA_PASMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   4e-34
GSA_CLOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   136   4e-34
GSA1_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
GSA1_STAAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
GSA1_STAAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
GSA1_STAAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
GSA1_STAA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
GSA1_STAA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
GSA1_STAA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   136   4e-34
AT2L2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase 2...   136   4e-34
GSA_XANOR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   5e-34
GSA_XANOP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   5e-34
GSA_XANOM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   5e-34
GSA_NITEU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   5e-34
GSA_MARAV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   5e-34
GSA1_STAAU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   5e-34
GSA1_STAAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   5e-34
GSA1_STAAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   5e-34
GSA1_STAAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   5e-34
GSA1_STAA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   5e-34
GSA1_STAA3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   5e-34
GSA_SALAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   6e-34
GSA_CHRVO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   6e-34
GSA_BORA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   6e-34
GSA_VIBHB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   8e-34
GSA_PSEHT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   8e-34
GSA_PROMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   8e-34
GSA_METS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   135   8e-34
GSA2_STAS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   8e-34
GSA1_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   135   8e-34
GSA_SULIM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SULIA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SALEP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_LEGPL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_LEGPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_LEGPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA2_BACP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA2_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA1_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA_SULIY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SULIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SULIL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SULIK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SALTI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SALSV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SALPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SALNS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_SALDC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_HAHCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA_ENTS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   1e-33
GSA1_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   134   1e-33
GSA_METTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   2e-33
GSA_LEPCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   2e-33
GSA_CLOBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   2e-33
GSA_ACTPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   2e-33
GSA_ACTP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   2e-33
GSA_ACTP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   134   2e-33
GABT_MYCLE RecName: Full=4-aminobutyrate aminotransferase;      ...   134   2e-33
GSA_WOLSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   2e-33
GSA_SYNFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   2e-33
GSA_SULSO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   2e-33
GSA_SULDN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   2e-33
GSA_METCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   2e-33
GSA_LEGPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   2e-33
GSA_STRMK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_SODGM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_SALG2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_PROVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_IDILO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_HORVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_HAMD5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_ESCF3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_CHLRE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA_AZOSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   133   3e-33
GSA1_STAES RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   133   3e-33
GSA1_STAEQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   133   3e-33
ECTB_BACPA RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   133   3e-33
GSA1_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   132   4e-33
GSA1_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   132   4e-33
GSA1_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   132   4e-33
GSA_SHIFL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   132   5e-33
GSA_SHIF8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   132   5e-33
GSA_SALA4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   132   5e-33
GSA_EDWI9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   132   5e-33
GSA2_EXIS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   132   5e-33
GSA_PHOPR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   132   7e-33
GSA2_BACLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   132   7e-33
GSA_YERE8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   131   9e-33
GSA_NITMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   131   9e-33
GSA_METFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   131   9e-33
GSA2_OCEIH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   131   9e-33
GSA1_CLOPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   131   9e-33
GSA_STRM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   131   1e-32
GSA_SALRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   131   1e-32
GSA_VIBSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   2e-32
GSA_ALISL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   2e-32
GSA1_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   130   2e-32
GSA_FLAPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   2e-32
GSA_CLOPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   2e-32
AT2L2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase 2...   130   2e-32
GSA_HALMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   3e-32
GSA_FRATW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   3e-32
GSA_CARHZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   130   3e-32
GSA1_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   130   3e-32
GSA_SYNAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_ORYSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_MICAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_FRATT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_FRATO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_FRATN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_FRATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_FRATF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_FRAT1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
GSA_AERHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   3e-32
ECTB_STRCH RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   129   3e-32
GSA_RALEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   4e-32
GSA_PSYWF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   4e-32
GSA_HYDS0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   4e-32
GSA_GEOMG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   4e-32
GSA_AERS4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   4e-32
GSA_THIDA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   6e-32
GSA_RALME RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   6e-32
GSA_PSEA6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   6e-32
GSA_CYAP4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   6e-32
GSA_CLOP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   129   6e-32
GSA_CUPTR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_CAMLR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_AZOVD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_ACIBY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_ACIBT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_ACIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_ACIB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_ACIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   7e-32
GSA_FLAJ1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   1e-31
GSA_CAMC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   1e-31
GSA_ARCFU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   1e-31
GSA_ANADF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   1e-31
GSA_ACIBC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   128   1e-31
GSA1_BACP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   128   1e-31
GSA_HALHL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   1e-31
GSA_CLOCE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   1e-31
GSA1_MACCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   127   1e-31
GSA1_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   127   1e-31
GSA_TERTT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
GSA_RUTMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
GSA_FRATM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
GSA_FRASN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
GSA_DECAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
GSA_AQUAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
ECTB_BORPA RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   127   2e-31
ECTB_BORBR RecName: Full=Diaminobutyrate--2-oxoglutarate transam...   127   2e-31
GSA_BURP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   127   2e-31
GSA_PSYIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   126   3e-31
GSA_ACIAD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   126   4e-31
GSA1_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   126   4e-31
GSA_MYCUA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   5e-31
GSA_CAMFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   5e-31
GSA_CAMC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   5e-31
GSA2_STAES RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   125   5e-31
GSA2_STAEQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   125   5e-31
GSA_LACRJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   6e-31
GSA_LACRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   6e-31
GSA_HELAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   6e-31
GSA_BURXL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   6e-31
BIOA_MYCTU RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   125   6e-31
BIOA_MYCBO RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   125   6e-31
GSA_UNCMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   8e-31
GSA_RALPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   8e-31
GSA_CLOAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   125   8e-31
GSA_SYNWW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
GSA_ALKOO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
BIOA_HELPJ RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   124   1e-30
GSA_SYNP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
GSA_RALSO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
GSA_PSEP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
GSA_DICNV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
GSA_CLOPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   1e-30
GSA_XYLFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   2e-30
GSA_PSEPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   2e-30
GSA_NEIM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   2e-30
GSA_AERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   124   2e-30
GSA_NEIMB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   2e-30
GSA_JANMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   2e-30
GSA_FRAP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   2e-30
GSA_BURPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   2e-30
GSA_ANASK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   2e-30
GSA_CLOTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   3e-30
GSA_BURTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   3e-30
GSA_ANAD2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   123   3e-30
GSA_PSYA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_PSEPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_PSEE4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_NITEC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_NEIMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_HERAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_FRAAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSA_CHRSD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   5e-30
GSAB_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   122   5e-30
GSA2_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   122   5e-30
GSA2_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   122   5e-30
GSA1_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   122   5e-30
GSA_XYLFA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   7e-30
GSA_PSYCK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   7e-30
GSA_HALWD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   7e-30
GSA_ACIC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   122   7e-30
OAPT_PSEPU RecName: Full=Omega-amino acid--pyruvate aminotransfe...   121   9e-30
GSA_PSEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   121   9e-30
GSA_HALLT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   121   9e-30
GSA_BORPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   121   9e-30
GSA1_STAHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   121   9e-30
GSA_XYLFT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   121   1e-29
GSA_XYLF2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   121   1e-29
GSA_AZOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   121   1e-29
GSA2_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   121   1e-29
GSA_SYNE7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA_IGNH4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA_HELPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA_HELP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA_ARCB4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA_ACIBL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA2_MACCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   120   2e-29
GSA_HELPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   2e-29
GSA1_STAS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   120   2e-29
GSA_TRIEI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_SALTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_METPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_DIAST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_BURM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_BRANA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_AKKM8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA_ACISJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   120   3e-29
GSA2_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   120   3e-29
GSA_SORC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
GSA_HELPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
GSA_DESVV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
GSA_DESVH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
GSA_CLONN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
GSA_BURA4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
GSA_ALKMQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   3e-29
BIOA_CORGL RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   119   3e-29
GSA_SULNB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   5e-29
GSA_NEIMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   5e-29
GSA_METTP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   6e-29
GSA_HELPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   6e-29
GSA_BURVG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   119   6e-29
GSA1_CENSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   119   6e-29
GSA1_BACLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   119   6e-29
BIOA_HELPY RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   119   6e-29
GSA_SYNP6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   118   8e-29
GSA_LARHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   118   8e-29
GSA_BURS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   118   8e-29
GSA1_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   118   8e-29
GSA1_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   118   8e-29
GSA_STRGG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   1e-28
GSA_BURCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   1e-28
BIOA_SALTY RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   117   1e-28
GSA_NEIG1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   2e-28
GSA1_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   117   2e-28
GSA_POLNA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   2e-28
GSA_NEIG2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   2e-28
GSA_MAGSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   2e-28
GSA_DESOH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   117   2e-28
GSA1_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   117   2e-28
GSA_ROSS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   3e-28
GSA_GEMAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   3e-28
GSA1_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   116   3e-28
GSA_RHOBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA_PROAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA_MYCSS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA_MYCSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA_DELAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA_DEIDV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA_COLP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   116   4e-28
GSA2_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   116   4e-28
GSA_CAMJR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   5e-28
GSA_CAMJJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   5e-28
GSA_CAMJE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   5e-28
GSA_CAMJD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   5e-28
GSA_CAMJ8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   5e-28
GSA_ACIAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   5e-28
GSA2_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAA3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_STAA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA2_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
GSA1_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   5e-28
BIOA_ESCVU RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   115   5e-28
YODT_BACSU RecName: Full=Uncharacterized aminotransferase yodT; ...   115   7e-28
GSA_MYCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   7e-28
GSA_MYCMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   7e-28
GSA_SALAI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   115   9e-28
GSA2_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   115   9e-28
GSA_OPITP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   114   1e-27
GSA_BURCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   114   2e-27
GSA_BURCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   114   2e-27
GSA_BURCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   114   2e-27
LAT_MYCTU RecName: Full=Probable L-lysine-epsilon aminotransfera...   113   2e-27
LAT_MYCBO RecName: Full=Probable L-lysine-epsilon aminotransfera...   113   2e-27
GSA_BURCC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   113   2e-27
GSA2_STAHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   113   2e-27
GSA2_CLOPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   113   2e-27
GSA_THEM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   113   3e-27
GSA_MYCS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   113   3e-27
GSA_CLOB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   113   3e-27
GSA_ARTAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   113   3e-27
GSA_NATPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   112   4e-27
GSA_METBF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   112   4e-27
GSA_DEIGD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   112   4e-27
GSA1_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   112   4e-27
GSA_STRAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   112   6e-27
GSA_CORDI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   112   6e-27
GSA_SACD2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   112   7e-27
GSA2_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   111   1e-26
GSA_THEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   2e-26
GSA_RALEJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   2e-26
GSA_METMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   2e-26
GSA_HELPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   2e-26
GSA_XANCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   3e-26
GSA_XANAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   3e-26
GSA_SYMTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   3e-26
GSA_STRCO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   110   3e-26
GSA_VESOH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   109   4e-26
GSA_STRSV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   109   4e-26
GSA_POLSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   109   5e-26
GSA_METI4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   109   5e-26
BIOA_ECOLI RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   109   5e-26
GSA_THEVO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   6e-26
GSA_RHOFD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   6e-26
GSA_XANC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   8e-26
GSA_CORA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   8e-26
GSA_ARTCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   8e-26
GSA_POLNS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   1e-25
GSA_ACIF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   1e-25
GSA_ACIF2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   108   1e-25
GSA_ROSCS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   107   1e-25
GSA_POLSQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   107   1e-25
GSA_HYPBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   107   1e-25
GSA_SOLLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   107   2e-25
GSA_ANADE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   107   2e-25
LAT_STRCL RecName: Full=L-lysine-epsilon aminotransferase;      ...   106   3e-25
GSA_SOYBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   106   4e-25
GSA_CYTH3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   106   4e-25
GSA_CHLSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   106   4e-25
GSA_CHLAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   106   4e-25
GSA_ARTS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   106   4e-25
GSA_METB6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   105   5e-25
GSA_BURM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   105   5e-25
BIOA_SERMA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   105   7e-25
BIOA_MYCLE RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   105   7e-25
GSA_TOBAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   105   9e-25
GSA2_CENSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   105   9e-25
GSA_RENSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   104   1e-24
GSA_FRASC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   104   1e-24
GSA1_OCEIH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   104   1e-24
GSA_METAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   2e-24
GSA_KOCRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   2e-24
GSA_BURP0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   2e-24
BIOA_BUCBP RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...   103   2e-24
GSA_HELHP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_CORU7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_BURPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_BURP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_BURMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_BURMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_BURM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA1_EXIS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutas...   103   3e-24
GSA_MYXXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   103   3e-24
GSA_THET8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   102   6e-24
GSA_METHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   102   6e-24
GSA_BURP6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   102   6e-24
GSA_METKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   102   7e-24
GSA_BDEBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   102   7e-24
GSA_DESDA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   101   1e-23
GSA_DEIRA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   101   1e-23
GSA_METPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   101   1e-23
GSA_DESVM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   101   1e-23
GSA_ALCBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   101   1e-23
GSA_NOCFA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   100   2e-23
GSA_CLAM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   100   2e-23
GSA_SULTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   100   2e-23
GSA_PARUW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...   100   3e-23
GSA_PYRIL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    99   5e-23
GSA_METBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    99   5e-23
BIOA_BUCAP RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...    99   5e-23
GSA_NITOC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    99   6e-23
GSA_CALMQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    99   6e-23
GSA_VEREI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    98   1e-22
GSA_MYCLE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    98   1e-22
GSA_MYCLB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    98   1e-22
LAT_NOCLA RecName: Full=L-lysine-epsilon aminotransferase;      ...    97   2e-22
GSA_RHOSR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_LEPBL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_LEPBJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_HALSA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_HALS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_CLAMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_THENV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_THEFY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_MYCVP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   2e-22
GSA_XANCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   3e-22
GSA_XANCB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   3e-22
GSA_XANC8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   3e-22
GSA_PYRAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    97   3e-22
GSA_THEAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    96   4e-22
GSA_MYCA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    96   5e-22
GSA_METMJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    96   5e-22
GSA_CORJK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    96   5e-22
GSA_CORGL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    96   5e-22
GSA_CORGB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    96   5e-22
GSA_METLZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    94   2e-21
GSA_CHLAD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    94   2e-21
GSA_LEIXX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    94   3e-21
GSA_MYCGI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    93   5e-21
GSA_CHLMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    93   5e-21
GSA_SULAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    92   6e-21
GSA_LEPBP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    92   6e-21
GSA_LEPBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    92   6e-21
GATA_EMENI RecName: Full=4-aminobutyrate aminotransferase;      ...    92   8e-21
GABT_CAEEL RecName: Full=Probable 4-aminobutyrate aminotransfera...    92   8e-21
GSA_NOCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    91   2e-20
GSA_COREF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    91   2e-20
GSA_PYRAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    90   3e-20
GSA_CHLCV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    90   4e-20
GSA_PYRCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    89   5e-20
GSA_MYCA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    89   5e-20
GSA_WIGBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    89   7e-20
GABT_DICDI RecName: Full=4-aminobutyrate aminotransferase;      ...    89   7e-20
BIOA_BUCAI RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...    89   7e-20
GSA_CHLTB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    89   9e-20
GSA_CHLT2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    89   9e-20
GSA_MYCPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    88   1e-19
GSA_CHLTR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    88   1e-19
GSA_CHLTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    88   1e-19
GSA_LEPIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    87   2e-19
GSA_PROFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    87   2e-19
GSA_KINRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    87   2e-19
GSA_RHOE4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    86   7e-19
GSA_LEPIC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    86   7e-19
GSA_THET2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    85   9e-19
GSA_CHLFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    85   9e-19
YC7B_SCHPO RecName: Full=Uncharacterized aminotransferase C417.1...    84   2e-18
GSA_SACEN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    84   3e-18
GSA_LAWIP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    83   5e-18
GSA_RHOOB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    82   1e-17
BIOA_YEAST RecName: Full=Adenosylmethionine-8-amino-7-oxononanoa...    82   1e-17
MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;     ...    80   2e-17
ARGD_RHOCA RecName: Full=Acetylornithine aminotransferase;      ...    78   2e-16
GSA_CHLPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    76   4e-16
GSA_ACIC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    76   4e-16
GSA_TROWT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    74   2e-15
GSA_TROW8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    74   2e-15
GATA_USTMA RecName: Full=4-aminobutyrate aminotransferase;      ...    74   2e-15
GABT_PIG RecName: Full=4-aminobutyrate aminotransferase, mitocho...    73   5e-15
GABT_MOUSE RecName: Full=4-aminobutyrate aminotransferase, mitoc...    72   6e-15
GSA_CHLAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    72   1e-14
GABT_RAT RecName: Full=4-aminobutyrate aminotransferase, mitocho...    72   1e-14
GSA_MYCTU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    70   2e-14
GSA_MYCTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    70   2e-14
GSA_MYCBT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    70   2e-14
GSA_MYCBP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    70   2e-14
GSA_MYCBO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase...    70   2e-14
GABT_HUMAN RecName: Full=4-aminobutyrate aminotransferase, mitoc...    68   1e-13
GATA_SCHPO RecName: Full=4-aminobutyrate aminotransferase;      ...    67   3e-13
GATA_YEAST RecName: Full=4-aminobutyrate aminotransferase;      ...    65   1e-12
GABT_BOVIN RecName: Full=4-aminobutyrate aminotransferase, mitoc...    54   3e-09
GCSPB_THET8 RecName: Full=Probable glycine dehydrogenase [decarb...    42   9e-06
GCSPB_THET2 RecName: Full=Probable glycine dehydrogenase [decarb...    42   9e-06
ISCS_RICBR RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     38   1e-04
ISCS_PASMU RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     38   1e-04
TNAA_SALRD RecName: Full=Tryptophanase;         EC=4.1.99.1;AltN...    38   2e-04
ISCS_RICCK RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     38   2e-04
ISCS_RICAE RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     38   2e-04
ISCS_RICB8 RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     37   3e-04
GCSPB_THISH RecName: Full=Probable glycine dehydrogenase [decarb...    37   3e-04
ISCS_RICRS RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     36   5e-04
ISCS_RICRO RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     36   5e-04
ISCS_RICPU RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     36   5e-04
ISCS_RICM5 RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     36   5e-04
ISCS_RICCN RecName: Full=Cysteine desulfurase;         EC=2.8.1.7;     36   5e-04
BIKB_BACSU RecName: Full=Putative 8-amino-7-oxononanoate synthas...    36   5e-04
CTP5A_RAT RecName: Full=Contactin-associated protein like 5-1;Al...    35   9e-04

>ARGD_THETN RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 393

 Score =  432 bits (1110), Expect = e-123
 Identities = 212/380 (55%), Positives = 271/380 (71%), Gaps = 2/380 (0%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           ++Y+M+TY R P+ LVKG+G  VWD++G  YLDFV+GIAVN LGH HP + EA+ KQ +T
Sbjct: 6   KKYLMDTYNRYPIMLVKGEGTRVWDSEGNAYLDFVAGIAVNSLGHCHPALVEAIKKQAET 65

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           L+HCSN+YW E Q++LA+++ ENS   K FF NSGAEANEGAIKLARKYA    G  +Y+
Sbjct: 66  LIHCSNLYWNEKQIELARMISENSFGGKVFFANSGAEANEGAIKLARKYASLKYGGKRYK 125

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           IITA NSFHGRT   +TATGQ KY +G  PL  GF YVP ND+EAL   +    CA+MLE
Sbjct: 126 IITAKNSFHGRTFGALTATGQEKYHKGFGPLLAGFKYVPLNDIEALYEAVDDEVCAIMLE 185

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
            +QGEGG+  A   Y++ V+++C+E  LL I DEVQ G+GRTGK  GY+HYGV PDI+TL
Sbjct: 186 VIQGEGGIHEATPEYVKAVRKICDENDLLFILDEVQTGIGRTGKLFGYEHYGVVPDIMTL 245

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AK LGGGFPIGA++AKE  A  F+PGDHASTFGGNPLA  A +A +  + + G LE   +
Sbjct: 246 AKGLGGGFPIGAIVAKEDKA-VFKPGDHASTFGGNPLACAAGIAVLNEVTKDGFLEGVDK 304

Query: 311 MGEYFKAELTKLAAEVPLVKEVR-XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVL 369
            G+YF+  L  L  +  +VKE+R                +IV   LE+GLLIN  + NVL
Sbjct: 305 KGKYFREGLETLQKKHKVVKEIRGKGLMVGCEVDLEDASEIVLKALEKGLLINSVSHNVL 364

Query: 370 RFLPPLIITKDEIDQAVQIL 389
           RF+PPLI+T++EID+A+QIL
Sbjct: 365 RFVPPLIVTEEEIDEALQIL 384


>ARGD_METJA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 398

 Score =  424 bits (1089), Expect = e-121
 Identities = 209/389 (53%), Positives = 277/389 (71%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           M+ +  + + ++Y +  YGRLP+ LV+G+G  V+D DG++YLDF++GI VN +GH HP+V
Sbjct: 1   MSQENWIDLEKKYHLQIYGRLPVVLVEGKGMEVYDIDGKKYLDFLAGIGVNNVGHCHPKV 60

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYA 120
            EA+ KQ +TL+H SNIY+  PQ+KLAK LVE S  D+AFFCNSGAEANEGAIK ARKY 
Sbjct: 61  VEAIKKQAETLIHTSNIYYTIPQIKLAKKLVELSGLDRAFFCNSGAEANEGAIKFARKYV 120

Query: 121 KQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
            + LG +  EII+  N+FHGRTL T+ AT + KYQ G  PLP GF YVPFND+EALK  I
Sbjct: 121 SKVLGREGGEIISMYNAFHGRTLTTLAATPKPKYQDGFYPLPPGFKYVPFNDIEALKEAI 180

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
              T A+M+EPVQGEGG+  A + YL+ V+ LC++K ++LIFDEVQCG+GRTG+   ++H
Sbjct: 181 TDKTAAIMIEPVQGEGGIHVADKDYLKAVRDLCDDKNIVLIFDEVQCGMGRTGRMFAFEH 240

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
           YGVEPDI+TLAKALGGG PIGA++ KE++A+A   GDH +TFGGNPLA +A+LA++E + 
Sbjct: 241 YGVEPDILTLAKALGGGVPIGAVVLKEEIAKALSYGDHGTTFGGNPLACSAALASVEVIE 300

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLL 360
           +    +   + G+YF  +L  L  +   +KEVR               DIV   LE+G L
Sbjct: 301 ELIKDDKVIEKGKYFIRKLENLIEKYNFIKEVRGLGLMIGAELEFNGADIVKKMLEKGFL 360

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQIL 389
           INCT+  VLRFLPPLI+ K+ ID  +  L
Sbjct: 361 INCTSDTVLRFLPPLIVEKEHIDALINAL 389


>ARGD_METTH RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 390

 Score =  398 bits (1023), Expect = e-113
 Identities = 199/389 (51%), Positives = 264/389 (67%), Gaps = 6/389 (1%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           M+++EI+ + ++++M TY R P+ L  G+GA VWD +G  Y+D  +G+AVN +GHAHP+V
Sbjct: 1   MDSEEIIELERKFIMQTYTRQPIVLSHGKGATVWDIEGNSYIDCFAGVAVNSIGHAHPKV 60

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYA 120
           A A+C Q + L+H SNIY+   QV+LAKLL   S  D+ FF NSGAEANEGAIKLARK+ 
Sbjct: 61  ALAICHQAQRLIHSSNIYYTREQVELAKLLTAISPHDRVFFANSGAEANEGAIKLARKFT 120

Query: 121 KQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
                  K EII A NSFHGRTLATVTATGQ KY     PLP+GF +VP+ D+ A+ + +
Sbjct: 121 ------GKSEIIAAENSFHGRTLATVTATGQKKYSEPFRPLPEGFKHVPYGDIGAMADAV 174

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
           G  T A++LEPVQGEGGVI   + YL+ V++L  +  +LLI DEVQ G GRTG     Q 
Sbjct: 175 GDETAAIILEPVQGEGGVIIPPEGYLKDVQELARQNDVLLILDEVQTGFGRTGAMFASQL 234

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
           +GVEPDI T+AKA+GGG+PIGA+LA E+VA AF+PGDH STFGGNP    A++AT+E L+
Sbjct: 235 FGVEPDITTVAKAMGGGYPIGAVLANERVAMAFEPGDHGSTFGGNPWGCAAAIATIEVLM 294

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLL 360
            + + E A +MG YF   L ++      V+++R                +V    E G+L
Sbjct: 295 DEKLPERAAKMGSYFLGRLRQVLHGCDAVRDIRGVGLMIGIEIDGECAGVVDAAREMGVL 354

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQIL 389
           INCT G V+R +PPL+I K+EID AV +L
Sbjct: 355 INCTAGKVIRIVPPLVIKKEEIDAAVDVL 383


>ARGD_THEEB RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 412

 Score =  393 bits (1010), Expect = e-111
 Identities = 213/393 (54%), Positives = 261/393 (66%), Gaps = 12/393 (3%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q VM+TYGR P+ LV+G+G  VWD  GR YLDFV+GIA   LGHAHP + E V +Q++TL
Sbjct: 16  QVVMSTYGRFPITLVRGEGCRVWDDQGRSYLDFVAGIATCTLGHAHPALVETVSRQMQTL 75

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN+Y+I  Q  LA+ LV +SC D+ FFCNSGAEANE AIKLARKYA          I
Sbjct: 76  HHVSNLYYIPQQGALAQWLVAHSCGDRVFFCNSGAEANEAAIKLARKYAHTVRHIANPII 135

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG------PHTC 185
           ITA  SFHGRTLAT+TATGQ KYQ+  DPL  GFAYVP+NDL AL+  +       P   
Sbjct: 136 ITAQASFHGRTLATITATGQPKYQKYFDPLVPGFAYVPYNDLGALEALVASLDQPQPQVA 195

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           A++LEP+QGEGGV P  +AY E V+QLC EKG+LLIFDEVQ G+GRTG   GY+  GVEP
Sbjct: 196 AILLEPLQGEGGVRPGDRAYFEQVRQLCTEKGILLIFDEVQVGMGRTGSLWGYETLGVEP 255

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           DI T AK L GG PIGAM+AKE  A  FQPGDHASTFGGNPLA  A+L   ETL ++ +L
Sbjct: 256 DIFTSAKGLAGGVPIGAMIAKEFCA-VFQPGDHASTFGGNPLATAAALTVCETLEKENLL 314

Query: 306 ENAWQMGEYFKAELTKLAAEVP-LVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLL 360
           EN    G+  +  L +LAA  P ++ EVR                   ++V   L +GLL
Sbjct: 315 ENVRDRGQQLRTGLQELAAAYPQVIAEVRGWGLINGLELQPDTPLTAAEVVKAALAEGLL 374

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +      V+RF+PPLI++  EID A+  + RA+
Sbjct: 375 LVPAGPKVVRFVPPLIVSATEIDMALGAMSRAL 407


>ARGD_SYNY3 RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 429

 Score =  385 bits (989), Expect = e-109
 Identities = 201/393 (51%), Positives = 265/393 (67%), Gaps = 13/393 (3%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           YVMNTYGR P+A+ +GQG+ +WD +G+ YLDFV+GIA   LGHAHP +  AV  Q++ L 
Sbjct: 34  YVMNTYGRFPIAIARGQGSTLWDTEGKSYLDFVAGIATCTLGHAHPALVRAVSDQIQKLH 93

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG-PDKYEI 131
           H SN+Y+I  Q +LAK +VE+SCAD+ FFCNSGAEANE AIKL RKYA   L   ++  I
Sbjct: 94  HVSNLYYIPEQGELAKWIVEHSCADRVFFCNSGAEANEAAIKLVRKYAHTVLDFLEQPVI 153

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTC 185
           +TA  SFHGRTLAT+TATGQ KYQ+  DPL  GF YVP+ND+ +L+N +           
Sbjct: 154 LTAKASFHGRTLATITATGQPKYQQYFDPLVPGFDYVPYNDIRSLENKVADLDEGNSRVA 213

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           A+ LEP+QGEGGV P   AY + V+++C++  +LL+FDEVQ G+GRTGK  GY+H GVEP
Sbjct: 214 AIFLEPLQGEGGVRPGDLAYFKRVREICDQNDILLVFDEVQVGVGRTGKLWGYEHLGVEP 273

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           DI T AK L GG PIGAM+ K +    F+PG+HASTFGGNPLA  A LA ++T+    +L
Sbjct: 274 DIFTSAKGLAGGVPIGAMMCK-KFCDVFEPGNHASTFGGNPLACAAGLAVLKTIEGDRLL 332

Query: 306 ENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLL 360
           +N    GE  ++ L ++  + P L  EVR                   +IV   +EQGLL
Sbjct: 333 DNVQARGEQLRSGLAEIKNQYPTLFTEVRGWGLINGLEISAESSLTSVEIVKAAMEQGLL 392

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +      VLRF+PPL++T+ EI QAV+IL++A+
Sbjct: 393 LAPAGPKVLRFVPPLVVTEAEIAQAVEILRQAI 425


>ARGD_GLOVI RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 400

 Score =  377 bits (968), Expect = e-107
 Identities = 192/382 (50%), Positives = 262/382 (68%), Gaps = 3/382 (0%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           +Q+VM+TY R  +   +G+G ++ D++GR+YLDFV+GIA   LGHAHP ++ AV +Q +T
Sbjct: 8   EQHVMHTYARFSVVFERGEGCYLEDSEGRRYLDFVAGIATCVLGHAHPVLSAAVAEQART 67

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           L+H SN+Y+   Q  LA+ L  +S AD+ FFCNSGAEANEGAIKLARKY +  LG  + +
Sbjct: 68  LIHVSNLYYTPQQACLAEWLTAHSAADQVFFCNSGAEANEGAIKLARKYGRTVLGIAEPQ 127

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           II A  SFHGRT+ATVTATGQ KYQ+   PL  GF +VP+ND EAL+  +   T AV++E
Sbjct: 128 IICAHQSFHGRTMATVTATGQPKYQKHFHPLVPGFVHVPYNDFEALRAQVTDATAAVLIE 187

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+QGEGGV+P    + + +++ C E+ +LL+ DEVQ G+GRTG+  GY+H G+EPD+ TL
Sbjct: 188 PIQGEGGVVPGDVEFFQKLRRFCSERRILLMLDEVQTGMGRTGRLFGYEHLGIEPDVFTL 247

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AKALGGG PIGA+ AKE  A  F+PGDHASTFGGNPLA  A+LA  +TL  + +++NA +
Sbjct: 248 AKALGGGVPIGALCAKEAFA-IFEPGDHASTFGGNPLACAAALAVCQTLEAEQLVDNARE 306

Query: 311 MGEYFKAELTKLAAEV-PLVKEVR-XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNV 368
            G    A L +L     PLV+  R                +IV   +EQGLL+      V
Sbjct: 307 RGAQLAAGLGRLVERFKPLVRTARGRGLMQGLVLSEPRAAEIVRLAMEQGLLLVSAGPEV 366

Query: 369 LRFLPPLIITKDEIDQAVQILK 390
           +RF+PPLI++  E+D+A+ IL+
Sbjct: 367 IRFVPPLIVSAIEVDEALAILE 388


>ARGD_ANASP RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 427

 Score =  370 bits (949), Expect = e-104
 Identities = 190/381 (49%), Positives = 257/381 (67%), Gaps = 12/381 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           VM+TYGR P+AL +G G  VWD  G++YLDFV+GIA   LGHAHP + EAV +Q++ L H
Sbjct: 33  VMSTYGRFPLALERGAGCRVWDTQGKEYLDFVAGIATCTLGHAHPAMVEAVTRQIQKLHH 92

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN+Y+I  Q +LA+ ++++SCAD+ FFCNSGAEANE AIKLARKYA   L  +K  I+T
Sbjct: 93  VSNLYYIPEQGELAQWIIQHSCADRVFFCNSGAEANEAAIKLARKYAHTVLDIEKPIILT 152

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGP------HTCAV 187
           A  SFHGRTLAT+TATGQ KYQ+  DPL  GF YV +ND+ A++  I           A+
Sbjct: 153 ANASFHGRTLATITATGQAKYQKYFDPLVPGFHYVNYNDISAVEAAISELDEGDYRVAAI 212

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EP+QGEGGV P    Y + ++Q+C++ G+LL+FDEVQ G+GR+GK  GY++ GVEPDI
Sbjct: 213 LIEPLQGEGGVRPGDVEYFQKLRQICDDTGILLMFDEVQVGMGRSGKLWGYEYLGVEPDI 272

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            T AK LGGG PIGAM++K +    FQPG+HASTFGGNP A   +LA  +TL ++ +L+N
Sbjct: 273 FTSAKGLGGGIPIGAMMSK-KFCDVFQPGEHASTFGGNPFACGVALAVCQTLERENILQN 331

Query: 308 AWQMGEYFKAELTKLAAEVP-LVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
               GE  ++ L  +AA+ P  + EVR                   D+V   + +GLL+ 
Sbjct: 332 VQDRGEQLRSGLRAIAAKYPHHLTEVRGWGLINGLELAADIPLTAADVVKAAINEGLLLV 391

Query: 363 CTNGNVLRFLPPLIITKDEID 383
                V+RF+PPLI+T+ EI+
Sbjct: 392 PAGPKVVRFVPPLIVTEAEIN 412


>ARGD_THEMA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 385

 Score =  369 bits (948), Expect = e-104
 Identities = 179/383 (46%), Positives = 245/383 (63%), Gaps = 4/383 (1%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y+MNTY R P   V G+G+W++D  G  YLDF SGIAVN LGH+HP + EA+  Q + L+
Sbjct: 2   YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLI 61

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           HCSN++W  PQ++LA+LL +N+   K FF N+G EANE AIK+AR           Y I+
Sbjct: 62  HCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARXXXXXXXXXX-YRIL 120

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
           +A NSFHGRTL ++TATGQ KYQ+  +PL  GF Y  FN++E L+  +    CAV LEP+
Sbjct: 121 SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPI 180

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGE G++PA + +LE  ++LC+E   LL+FDEVQCG+GRTGK   YQ YGV PD++T AK
Sbjct: 181 QGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAK 240

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
            LGGG PIGA++  E+ A   +PGDH +TFGGNPLA  A +  ++ L ++G LE   + G
Sbjct: 241 GLGGGVPIGAVIVNER-ANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 299

Query: 313 EYFKAELTKLAAEVPLVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLR 370
            Y   +L ++  E  +V +VR                +++   C E  LL+     N +R
Sbjct: 300 NYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIR 359

Query: 371 FLPPLIITKDEIDQAVQILKRAM 393
           FLPPL +   EID AV+ LK+ +
Sbjct: 360 FLPPLTVEYGEIDLAVETLKKVL 382


>ARGD_CLOAB RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 387

 Score =  355 bits (912), Expect = e-100
 Identities = 179/386 (46%), Positives = 242/386 (62%), Gaps = 1/386 (0%)

Query: 9   MGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV 68
           M + Y+MNTYGR  +   KG+G  ++D DG +Y+DFVSG+AVNCLGH +P + +A+ +Q 
Sbjct: 1   MSKSYLMNTYGRFNVTFDKGEGTKLYDKDGNEYIDFVSGVAVNCLGHCNPSIVKAIEEQS 60

Query: 69  KTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDK 128
             L+H SN YW E  ++L ++L +NS  DK F CNSG EA E  +KLARKYA  H   +K
Sbjct: 61  SKLMHVSNYYWNENAMELTEILCKNSEFDKVFMCNSGTEAIEAGLKLARKYALLHGDENK 120

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVM 188
            EII   NSFHGRT+  ++ TGQ KYQ    PL      V FNDL+ +K  I   T AV+
Sbjct: 121 KEIIYMDNSFHGRTMGALSVTGQPKYQESFKPLIGAVKSVKFNDLDDIKQKISSKTAAVI 180

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+QGEGG+IPA + YL+ ++ LC+E   LLIFDEVQCG+GR G    YQ + V PDI+
Sbjct: 181 VEPIQGEGGIIPAKKEYLKLLRDLCDENNALLIFDEVQCGMGRVGSLFAYQKFEVVPDIV 240

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLE-N 307
            +AKALGGGFPIGAMLAKE VA +F PGDH +T+GGNPLA   ++A             N
Sbjct: 241 CIAKALGGGFPIGAMLAKESVASSFVPGDHGNTYGGNPLACAVAIAXXXXXXXXXXXXIN 300

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
             +  +Y   +L  L  +  ++ +VR              K I+  C E  LL+     N
Sbjct: 301 VNEKSKYLFDKLMTLKEKYKVINDVRGMGLLIGVEVACDVKKIINKCFESKLLLITAGKN 360

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RFLPPL ++ +EID+A+ I + ++
Sbjct: 361 VVRFLPPLNVSFEEIDKALGIFEESI 386


>ARGD_MYXXA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 401

 Score =  354 bits (909), Expect = e-100
 Identities = 174/380 (45%), Positives = 238/380 (62%), Gaps = 2/380 (0%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           ++   +++++  Y + P  L +GQGA VWD DGR+YLD + GIA   LGH HPEV  A  
Sbjct: 22  LVQKAKRHLLQNYKQPPFVLARGQGARVWDMDGREYLDLIGGIATCALGHCHPEVVAAAK 81

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
            Q+ +L H SN+++ +PQ+ LA  L E S   +AFFCNSGAEANE  +KL RK  K    
Sbjct: 82  AQLDSLWHVSNVFYSQPQIDLAAQLTEWSGLSRAFFCNSGAEANEALLKLTRKVMKDRGT 141

Query: 126 PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
           P+++E+I+  +SFHGRTLATVTATGQ KYQ+G +PLP GF +VP+ DLEA++  +GP T 
Sbjct: 142 PERFEVISFDSSFHGRTLATVTATGQAKYQKGFEPLPAGFTHVPYGDLEAVRKAVGPATA 201

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           A+++EP+QGEGGV  A   +L G++ LC+E GLLL+ DEVQ G+GRTGK  G+ H G+ P
Sbjct: 202 AILVEPIQGEGGVRMAPLGFLVGLRALCDEHGLLLLVDEVQTGMGRTGKPFGFMHEGIVP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D I++AKALG G PIGAML KE++  +  PG H STFGGNP            L + G L
Sbjct: 262 DGISVAKALGNGLPIGAMLCKEELGASLTPGTHGSTFGGNPXXXXXXXXXXRILRRPGFL 321

Query: 306 ENAWQMGEYFKAELTKLAAEVPL--VKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINC 363
           +   + G Y  A   +L   +P   ++ VR                ++A   E+GLL+N 
Sbjct: 322 DEVQEKGAYLLARARELQGRLPAGRIQAVRGQGLLVGVQLDHKVAPVIAQVHEEGLLVNP 381

Query: 364 TNGNVLRFLPPLIITKDEID 383
                + F PP I+T  E+D
Sbjct: 382 AGDRTMLFAPPFIVTVRELD 401


>ARUC_PSEAE RecName: Full=Succinylornithine
           transaminase/acetylornithine aminotransferase;       
           Short=Succinylornithine aminotransferase;
          Length = 406

 Score =  351 bits (900), Expect = 7e-99
 Identities = 175/386 (45%), Positives = 246/386 (63%), Gaps = 4/386 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y++  Y       V+G+G+ VWD  GR+ +DF  GIAV  LGHAHP + +A+ +Q + +
Sbjct: 15  RYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRI 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++LA+ LV+ + A++ F  NSGAEANE A KLAR+YA    GP KYEI
Sbjct: 75  WHVSNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I A+NSFHGRTL TV   GQ KY  G  P  +G  +VP+NDLEALK  I   TCAV+LEP
Sbjct: 135 IAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA QAYLEG ++LC+E   LL+FDEVQ G+GR G+   Y HYGV PDI++ A
Sbjct: 195 IQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K+LGGGFPIGAML   ++A+    G H +T+GGNPLA+  + A ++ +    VL+     
Sbjct: 255 KSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            E FK+ L K+  E  +  E+R              K    D++    ++ +++   + +
Sbjct: 315 HERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RF P L+I   EID+ ++  +RA+
Sbjct: 375 VVRFAPSLVIDDAEIDEGLERFERAV 400


>ARGD_NEIMB RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 398

 Score =  351 bits (900), Expect = 7e-99
 Identities = 174/387 (44%), Positives = 238/387 (61%), Gaps = 4/387 (1%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Q Y+   +   PM   +  G+ VWD  GR+Y+DF  GIAVN LGH HP + +A+  Q+  
Sbjct: 2   QNYLTPNFAFAPMIPERASGSRVWDTKGREYIDFSGGIAVNALGHCHPALVDALNAQMHK 61

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           L H SNIY   P  +LA+ LV NS ADK FFCNSG+EANE A+KLARKYA+   G  K E
Sbjct: 62  LWHISNIYTTRPAQELAQKLVANSFADKVFFCNSGSEANEAALKLARKYARDRFGGGKSE 121

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           I+   NSFHGRTL TV+  GQ KY +   PLPQG  +VPFND+ AL+  +G  TCAV++E
Sbjct: 122 IVACINSFHGRTLFTVSVGGQPKYSKDYAPLPQGITHVPFNDIAALEAAVGEQTCAVIIE 181

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+QGE G++PA   YL+  ++LC+    LLI DEVQ G+G TG+   Y+HYG+ PDI++ 
Sbjct: 182 PIQGESGILPATAEYLQTARRLCDRHNALLILDEVQTGMGHTGRLFAYEHYGIVPDILSS 241

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AKALG GFPIGAMLA E++A AFQPG H STFGGNP+A        + +     L +  +
Sbjct: 242 AKALGCGFPIGAMLATEKIAAAFQPGTHGSTFGGNPMACAVGSRAFDIINTPETLNHVRE 301

Query: 311 MGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNG 366
            G+  +  L  L  +  L  +VR              +    +I A  L+ G++I     
Sbjct: 302 QGQKLQTALLDLCRKTGLFSQVRGMGLLLGCVLDEAYRGRASEITAAALKHGVMILVAGA 361

Query: 367 NVLRFLPPLIITKDEIDQAVQILKRAM 393
           +VLRF P L++  +++ + ++ L+ A+
Sbjct: 362 DVLRFAPSLLLNDEDMAEGLRRLEHAL 388


>ARGD_NEIMA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 397

 Score =  350 bits (899), Expect = 9e-99
 Identities = 175/387 (45%), Positives = 235/387 (60%), Gaps = 4/387 (1%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Q Y+   +   PM   +  G+ VWD +GR+Y+DF  GIAVN LGH HP + +A+  Q+  
Sbjct: 2   QNYLTPNFAFAPMIPERASGSRVWDTEGREYIDFSGGIAVNALGHCHPALVDALNAQMHK 61

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           L H SNIY   P  +LA+ LV NS ADK FFCNSG+EANE A+KLARKYA+   G  K E
Sbjct: 62  LWHISNIYTTRPAQELAQKLVANSFADKVFFCNSGSEANEAALKLARKYARDRFGGGKSE 121

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           I+   NSFHGRTL TV+  GQ KY +   PLPQG  +VPFND+ AL+  +G  TCAV++E
Sbjct: 122 IVACINSFHGRTLFTVSVGGQPKYSKDYAPLPQGITHVPFNDIAALEAAVGEQTCAVIIE 181

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+QGE G++PA   YL+  ++LC+    LLI DEVQ G+G TG+   Y+HYGV PDI++ 
Sbjct: 182 PIQGESGILPATAEYLQTARRLCDRHNALLILDEVQTGMGHTGRLFAYEHYGVVPDILSS 241

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AKALG GFPIGAMLA E +A AFQPG H STFGGNP+A        + +     L N   
Sbjct: 242 AKALGCGFPIGAMLATETIAAAFQPGTHGSTFGGNPMACAVGSRAFDIINAPETLHNVRS 301

Query: 311 MGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNG 366
            G+  +  L  L  +  L  +VR              +    +I A  L+ G++I     
Sbjct: 302 QGQKLQTALLDLGRKTGLFSQVRGMGLLLGCVLDAPYRGRASEITAAALKHGVMILVAGA 361

Query: 367 NVLRFLPPLIITKDEIDQAVQILKRAM 393
           +VLRF P L++  ++  + ++ L+  +
Sbjct: 362 DVLRFAPSLLLNDEDTAEGLRRLEHVL 388


>ARGD_NITEU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 393

 Score =  341 bits (875), Expect = 6e-96
 Identities = 178/376 (47%), Positives = 242/376 (64%), Gaps = 3/376 (0%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           +VMNTY RLP+  VKG+G W+WD  G +YLD +SGIAV  +GH HP + +A+C+QV TL+
Sbjct: 3   HVMNTYARLPVTFVKGEGVWLWDDQGNRYLDALSGIAVCGVGHCHPVLVKALCEQVSTLI 62

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H SN+Y I+ Q +LA  L   S  +KAFFCNSGAEANE AIKLAR Y     G +   II
Sbjct: 63  HTSNVYHIQHQERLADRLTSLSGLEKAFFCNSGAEANEAAIKLARLYGHNQ-GINLPTII 121

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHT--CAVMLE 190
               SFHGRT+AT+TATG  K Q G +PL  GF  VP++DLEA+      +    A++LE
Sbjct: 122 VMERSFHGRTMATLTATGNRKTQAGFEPLLTGFVRVPYDDLEAVNKVAANNREIVAILLE 181

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
             QGEGGV      YL+G++++C++ G LL+ DEVQCGLGRTGK+  +QH  V PD +TL
Sbjct: 182 TYQGEGGVNFPQANYLQGLRRICDQNGWLLMLDEVQCGLGRTGKWFAFQHSEVMPDAMTL 241

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AK LG G PIGA LA  + A+ F+PG+HASTFGGNPLA  A+L T++ + Q+G+++NA  
Sbjct: 242 AKGLGSGVPIGACLAGGKAAEVFKPGNHASTFGGNPLACRAALTTLDIIEQEGLMDNAVT 301

Query: 311 MGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLR 370
           +G +   E  +       V ++R               ++V   L++ +L+N T+  V+R
Sbjct: 302 IGNFMWEEFGRRLQAWQDVLKIRGQGMMIGIELPVPCSELVPEALKRRVLVNVTSEKVVR 361

Query: 371 FLPPLIITKDEIDQAV 386
            LP L + K E +Q V
Sbjct: 362 LLPALNMQKAEAEQVV 377


>ARGD_PSEPK RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 406

 Score =  340 bits (873), Expect = 1e-95
 Identities = 178/386 (46%), Positives = 243/386 (62%), Gaps = 4/386 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q ++  Y       V+G+G+ VWD  GR+ +DF  GIAVN LGH HP + +A+ +Q  TL
Sbjct: 15  QVMVPNYSPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++LA  LV+ + AD+AFFCNSGAE+NE A KLAR+ A    GP K+EI
Sbjct: 75  WHVSNVFTNEPALRLAHKLVDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGPQKHEI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   NSFHGRTL TV+  GQ KY  G  P   G ++VP+NDLEALK  I   TCAV++EP
Sbjct: 135 IATVNSFHGRTLFTVSVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGE GV+PA +AYLEG ++LC+E   LLIFDEVQ G+GRTG    YQHYGV PDI+T A
Sbjct: 195 IQGESGVVPADKAYLEGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVIPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K+LGGGFPIGAML   ++A+    G H +T+GGNPL    + A ++ +     L      
Sbjct: 255 KSLGGGFPIGAMLTTTELAKHLAVGTHGTTYGGNPLGCAVACAVLDVVNTPETLAGIKAK 314

Query: 312 GEYFKAELTKLAAEVPLVKE----VRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            E FK  L ++  +  L  +                    KD++    ++G+++     +
Sbjct: 315 HERFKTRLEQIGQQYNLFSQXXXXXXXXXXXXTEAWKGKAKDVLNAAEKEGVMVLQAGPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RF P L++   +ID+ +   +RA+
Sbjct: 375 VVRFAPSLVVEDADIDEGLDRFERAV 400


>ARGD_PROMA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 419

 Score =  334 bits (856), Expect = 9e-94
 Identities = 174/382 (45%), Positives = 242/382 (63%), Gaps = 12/382 (3%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           ++++TY RLP+ +VKG G W+WD  G++YLD V+GIA   LGH+  ++++ + +Q++ + 
Sbjct: 24  FLLDTYKRLPLKIVKGNGCWLWDETGKKYLDAVAGIATCSLGHSDKKLSKVLSQQLRKIQ 83

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H SN+Y I  Q  LA+ LV  SCAD  FFCNSGAEANE AIKLARKY +   G  +  I+
Sbjct: 84  HVSNLYRIPEQEDLAQWLVNQSCADSVFFCNSGAEANEAAIKLARKYGQIKRGIKRPIIL 143

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCA 186
           +A +SFHGRTLA ++ATGQTKYQ+G +PL +GF +  FND  ++++         P   A
Sbjct: 144 SAKSSFHGRTLAALSATGQTKYQKGFEPLVEGFEFFSFNDSNSVQDLYENLEKDEPRVAA 203

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           +++EP+QGEGG+    Q +   ++  C +  +LL+FDEVQ G+GRTGK  GY+H+ VEPD
Sbjct: 204 ILIEPIQGEGGLNLGDQKFFYFLRDYCNKNNILLLFDEVQSGMGRTGKLWGYEHFNVEPD 263

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLE 306
             TLAK LGGG  IGA+L KE  A  F+PGDHASTFGGNP A  A L   + +  + +LE
Sbjct: 264 AFTLAKGLGGGHSIGALLVKEN-ASIFEPGDHASTFGGNPFACKAGLTVAKEIQNRNLLE 322

Query: 307 NAWQMGEYFKAELTKLAAEVP-LVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
           N +  G   +  L KL    P  ++EVR                  + IV   +++GLL+
Sbjct: 323 NTYCRGNQLREGLQKLINNYPHHLEEVRGIGLMLGLAIKKNSNLTSQKIVELAIKEGLLV 382

Query: 362 NCTNGNVLRFLPPLIITKDEID 383
                 V+R LPPLIITK EI+
Sbjct: 383 IGAGEKVIRMLPPLIITKREIE 404


>ARGD1_PSESM RecName: Full=Acetylornithine aminotransferase 1;      
             Short=ACOAT 1;         EC=2.6.1.11;
          Length = 405

 Score =  333 bits (855), Expect = 1e-93
 Identities = 172/386 (44%), Positives = 235/386 (60%), Gaps = 4/386 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q ++  Y       V+G G+ VWD  GR+ +DF  GIAVN LGH HP +  A+ +Q   L
Sbjct: 15  QVMVPNYAPAGFIPVRGAGSRVWDQAGRELVDFSGGIAVNVLGHCHPALVGALTEQANNL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++LAK LV+++ A++ FFCNSGAEANE A KLAR+ A    GP+KYEI
Sbjct: 75  WHVSNVFTNEPTLRLAKKLVDSTFAERVFFCNSGAEANEAAFKLARRVAHDLYGPEKYEI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I A NSFHGRTL TV+  GQ KY  G  P   G ++VP+NDLEALK  +   TCAV+LEP
Sbjct: 135 IAAVNSFHGRTLFTVSVGGQPKYSDGFGPKITGISHVPYNDLEALKAAVTDKTCAVVLEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+P    YL+G ++LC+E   LL+FDEVQ G+GR+G    Y HYGV PDI++ A
Sbjct: 195 IQGEGGVLPGELDYLQGARKLCDEHNALLVFDEVQSGMGRSGHLFAYMHYGVTPDILSSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K++GGGFP+ AML  E++A+ F  G H +T+GGNPLA     A ++ +    VL    + 
Sbjct: 255 KSIGGGFPLAAMLTTEKLAKHFAVGVHGTTYGGNPLACAVGEAVIDVINTPEVLAGVQRK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + FK  L  +  +  +  EVR                  KDI      Q L+I     +
Sbjct: 315 HQQFKTRLESIGQQYGVFTEVRGLGLLIGCVLSDAWKGKAKDIFNAAEAQDLMILQAGPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RF P L+I   +I++ +   +RA+
Sbjct: 375 VIRFAPSLVIEDADIEEGLNRFERAI 400


>ARGD_BACST RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 385

 Score =  332 bits (850), Expect = 4e-93
 Identities = 177/373 (47%), Positives = 232/373 (62%), Gaps = 7/373 (1%)

Query: 17  TYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSN 76
           TY R  +A+   +G  V D +G+QYLDFVSGIAV  LGH HP V +++ +Q+    H SN
Sbjct: 7   TYNRWNIAVQSAEGTVVTDVNGKQYLDFVSGIAVCNLGHRHPHVQKSIEQQLNQYWHVSN 66

Query: 77  IYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
           ++ I  Q ++A LLV +S  D  FFCNSGAEANE A+KLARK+  +H      ++IT   
Sbjct: 67  LFTIPIQEEVASLLVAHSAGDYVFFCNSGAEANEAALKLARKHTGRH------KVITFRQ 120

Query: 137 SFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEG 196
           SFHGRT AT+ ATGQ K   G  PL   F ++P ND++ALK  +     AVMLE VQGEG
Sbjct: 121 SFHGRTFATMAATGQEKVHSGFGPLLPEFIHLPLNDVDALKQAMSEEVAAVMLEVVQGEG 180

Query: 197 GVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGG 256
           GV P   A+L+   +LC++ G LLI DEVQ G+GRTGK   YQH+ VEPDIIT AK LG 
Sbjct: 181 GVRPVDPAFLQTASELCQQHGALLIIDEVQTGIGRTGKPFAYQHFDVEPDIITAAKGLGS 240

Query: 257 GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFK 316
           G P+GAM+ K  + ++F PG H STFGGNP+A  A+ AT+E +     L++  + G YF 
Sbjct: 241 GIPVGAMIGKAFLKESFGPGVHGSTFGGNPIAMAAAKATLEVVFDPAFLQDVQEKGRYFL 300

Query: 317 AELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLI 376
           A L    A + +VK+VR                ++    E GLL+     NV+R L PL+
Sbjct: 301 ARLHDALASLDIVKDVRGLGLLVGIECQTDVAPLLPLIHENGLLVLSAGPNVIRLL-PLV 359

Query: 377 ITKDEIDQAVQIL 389
           +TK EID+AV IL
Sbjct: 360 VTKAEIDEAVDIL 372


>ARGD_VIBCH RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  328 bits (842), Expect = 4e-92
 Identities = 167/380 (43%), Positives = 233/380 (61%), Gaps = 4/380 (1%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y  +    VKG G+ +WD  G +Y+DF  GIAV+CLGH HP + +A+  Q   L H SN+
Sbjct: 20  YNPMEFIPVKGFGSRIWDQQGHEYIDFAGGIAVSCLGHCHPVMVQALTTQANKLWHLSNV 79

Query: 78  YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
              EP ++LAK L + S A+K FF NSGAEANE A+KLAR+YA    GP+K EII     
Sbjct: 80  MTNEPALRLAKKLTQVSFAEKVFFANSGAEANEAALKLARRYAADVYGPEKSEIIAFNQG 139

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGG 197
           FHGRT  TV+  GQ  Y  G  P P    ++P+NDL AL+  I   TCAVM+EP+QGEGG
Sbjct: 140 FHGRTFFTVSVGGQATYSDGFGPKPGDIVHLPYNDLAALQAQISDRTCAVMMEPLQGEGG 199

Query: 198 VIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG 257
           ++  +  +++ V++LC++   LLIFDEVQ G GRTG F  YQ  GV PDI+  AK+LGGG
Sbjct: 200 IVSPSAEFVQAVRELCDKHNALLIFDEVQTGNGRTGDFYAYQGIGVTPDILATAKSLGGG 259

Query: 258 FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKA 317
           FPIGAML   ++A+  + G H ST+GGNPLA   + A ++ + Q  +L    Q  ++ +A
Sbjct: 260 FPIGAMLTTAKIAEHMKVGVHGSTYGGNPLACAVAEAVVDFVAQPEILAGVKQREQWMRA 319

Query: 318 ELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
           EL K+  +  L KE+R                  +DI+    +QGL++     +V+RF P
Sbjct: 320 ELEKINQKYQLFKEIRGKGLLLGAALNDEWQGRARDILVAAGKQGLMVLVAGASVVRFTP 379

Query: 374 PLIITKDEIDQAVQILKRAM 393
            LII++ EI++ +  L +A+
Sbjct: 380 SLIISQQEIEEGMARLDKAI 399


>ARGD_BACSU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 385

 Score =  328 bits (840), Expect = 6e-92
 Identities = 179/382 (46%), Positives = 237/382 (62%), Gaps = 10/382 (2%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +  TYGR  + + K +G +V D +G+ YLDF+ GIAV+ LGH H  V EAV KQ+ ++ H
Sbjct: 4   LFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDSVWH 63

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN++    Q + A+ L  +S  D  FFCNSGAEANEGAIKLARK         K +IIT
Sbjct: 64  VSNLFQNSLQEQAAQKLAAHSAGDLVFFCNSGAEANEGAIKLARK------ATGKTKIIT 117

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH--TCAVMLEP 191
              SFHGRT A + ATGQ K + G  P+  GF Y+P+ND  A K  +G      AVMLE 
Sbjct: 118 FLQSFHGRTYAGMAATGQDKIKTGFGPMLGGFHYLPYNDPSAFK-ALGEEGDIAAVMLET 176

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGV PA+  +L  V+  C+EK  LLI DE+Q G+GRTGK   Y+H+G+ PDIIT+A
Sbjct: 177 VQGEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHFGLSPDIITVA 236

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K LG GFP+GA++ K+Q+ +AF PG H +TFGGN LA  A  AT++ + Q   L+ A   
Sbjct: 237 KGLGNGFPVGAVIGKKQLGEAFTPGSHGTTFGGNMLAMAAVNATLQIVFQPDFLQEAADK 296

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRF 371
           G + K +L +   + P VK++R               DI+A     GLL+     NV+R 
Sbjct: 297 GAFLKEQL-EAELKSPFVKQIRGKGLMLGIECDGPVADIIAELQTLGLLVLPAGPNVIRL 355

Query: 372 LPPLIITKDEIDQAVQILKRAM 393
           LPPL +TKDEI +AV  LK+A+
Sbjct: 356 LPPLTVTKDEIAEAVSKLKQAI 377


>ASTC_ECOHS RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (836), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  L     L  E+R                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTLNHRYGLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOSE RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOLI RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOLC RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECODH RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOBW RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO8A RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO24 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  326 bits (835), Expect = 2e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC     LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ARGD_AQUAE RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 376

 Score =  326 bits (835), Expect = 2e-91
 Identities = 183/382 (47%), Positives = 256/382 (67%), Gaps = 9/382 (2%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y+MN Y RLP+  V+G+G +++D +G++YLDFVSGI VN LGHA+P++ EA+ +QV+ LL
Sbjct: 3   YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLL 62

Query: 73  HCSNIYWIEPQVKLAKLLVENSCAD-KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
           H SN+Y    Q +LA  LV++   + K FF NSG E+ E AIKLARKY +   G +K++ 
Sbjct: 63  HVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYWRDK-GKNKWKF 121

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I+  NSFHGRT  +++ATGQ K+ +G +PL  GF+Y   ND++++   +   T       
Sbjct: 122 ISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAXXXXXX 181

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
                    A++ +L  ++++C+EK +LLI DEVQ G+GRTG+F  YQH+ ++PD+I LA
Sbjct: 182 XXXXXXXNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALA 241

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K LGGG PIGA+LA+E+VAQ+F PG H STFGGNPLA  A    ++ +  + +L +  ++
Sbjct: 242 KGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREV 299

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRF 371
           G YFK                               KD V   LE+GLLINCT G VLRF
Sbjct: 300 GNYFKE-----XXXXXXXXXXXXXXXXXXXXXXXXCKDYVLKALEKGLLINCTAGKVLRF 354

Query: 372 LPPLIITKDEIDQAVQILKRAM 393
           LPPLII K+ ID+A+ +L+  +
Sbjct: 355 LPPLIIQKEHIDRAISVLREIL 376


>ASTC_ESCF3 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  325 bits (833), Expect = 4e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMLPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDLNSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLIGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOSM RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  325 bits (832), Expect = 5e-91
 Identities = 160/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIHHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNSINHHYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_SHISS RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  324 bits (831), Expect = 7e-91
 Identities = 160/375 (42%), Positives = 228/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+L  E+ A     G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO55 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  324 bits (831), Expect = 7e-91
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+ +++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQDLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A+    G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  L     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTLNHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOLU RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  324 bits (830), Expect = 9e-91
 Identities = 160/375 (42%), Positives = 228/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLHGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTVNHRCGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO27 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  324 bits (830), Expect = 9e-91
 Identities = 159/375 (42%), Positives = 230/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFSGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA ++ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATKECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ARGD_YERPE RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 405

 Score =  324 bits (830), Expect = 9e-91
 Identities = 168/389 (43%), Positives = 230/389 (59%), Gaps = 4/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q ++  Y       VKG+G+ VWD  G +Y+DF  GIAV  LGH HP +  A+ +Q +TL
Sbjct: 14  QVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSALHQQGETL 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++LA+ L+  + AD+ FF NSGAEANE A KLAR YA +   P K +I
Sbjct: 74  WHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERHSPYKTKI 133

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGRTL TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV+LEP
Sbjct: 134 IAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEP 193

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGG+  A   +L+GV+ LC++   LL+FDEVQ G+GR+GK   Y HYGV PDI+T A
Sbjct: 194 IQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHYGVTPDILTTA 253

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPI AML  E++A     G H +T+GGNPLA   + A ++ +    VL    Q 
Sbjct: 254 KALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQR 313

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
              F   L  + ++  +  ++R                  ++ +A     GL+I     +
Sbjct: 314 HGLFVQALQSINSKYDVFSDIRGMGLLIGAELTAKYRGQAREFLAAAAANGLMILNAGPD 373

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           VLR  P L+I  ++I Q +  L++AM  V
Sbjct: 374 VLRLAPSLVIELEDIQQGMARLEKAMASV 402


>ASTC_CITK8 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  323 bits (828), Expect = 2e-90
 Identities = 163/375 (43%), Positives = 227/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +++M  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMMPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK+L++ + A++ FFCNSGAEANE A+KLARKYA    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKMLIDATFAERVFFCNSGAEANEAALKLARKYAHDRFGTHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL A    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAVYNDLNAASELIDDTTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 MQGEGGVLPATKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGA+LA E+ A     G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPIGALLATEKCASVMTVGTHGTTYGGNPLASAVAGKLLEIVNTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     L  E+R                  K I     + G+++     N
Sbjct: 312 HDGFVERLNAINERFGLFSEIRGLGLLIGCVLEAEFAGKAKLISQEAAKAGVMVLIAGAN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++K+E+
Sbjct: 372 VVRFAPALNVSKEEV 386


>ARGD_ECOL6 RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 406

 Score =  323 bits (828), Expect = 2e-90
 Identities = 163/389 (41%), Positives = 230/389 (59%), Gaps = 4/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKGQG+ +WD  G++Y+DF  GIAV  LGH HP +  A+  Q +TL
Sbjct: 15  EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++L + L+E + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 75  WHISNVFTNEPALRLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 135 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G+++LC++   LL+FDEVQCG+GRTG    Y HYGV PDI+T A
Sbjct: 195 IQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+ AML   ++A AF PG H ST+GGNPLA   + A  + +    VLE     
Sbjct: 255 KALGGGFPVSAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIINTPEVLEGIQAK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            ++F   L K+  +  +  ++R              K    D +    E+G+++     +
Sbjct: 315 RQHFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGRARDFLYAGAEEGVMVLNAGPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           V+RF P L++   +ID+ +     A+  V
Sbjct: 375 VMRFAPSLVVEDADIDEGMHRFAHAVAKV 403


>ARGD_ECO57 RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 406

 Score =  323 bits (828), Expect = 2e-90
 Identities = 165/389 (42%), Positives = 229/389 (58%), Gaps = 4/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKGQG+ +WD  G++Y+DF  GIAV  LGH HP +  A+  Q +TL
Sbjct: 15  EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++L + L+E + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 75  WHISNVFTNEPALRLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 135 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPSDIIHVPFNDLHAVKAVMDDHTCAVVVEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G+++LC++   LL+FDEVQCG+GRTG    Y HYGV PDI+T A
Sbjct: 195 IQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPI AML   ++A AF PG H ST+GGNPLA   + A  + +    VLE     
Sbjct: 255 KALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIINTPEVLEGIQAK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            + F   L K+  +  +  ++R              K    D +    E G+++     +
Sbjct: 315 RQRFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGQARDFLYAGAEAGVMVLNAGPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           V+RF P L++   +ID+ +Q    A+  V
Sbjct: 375 VMRFAPSLVVEDADIDEGMQRFAHAVAKV 403


>ASTC_ECOUT RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+     HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOL6 RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+     HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOL5 RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+     HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECOK1 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+     HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO81 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+     HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO7I RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 228/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGCHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLHGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  E+R                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTVNHRCGLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO45 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 159/375 (42%), Positives = 229/375 (61%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+     HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   ++ +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I    ++ G+++    GN
Sbjct: 312 HDWFVERLNSINHHYSLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ARGD_ECOLI RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 406

 Score =  323 bits (827), Expect = 2e-90
 Identities = 165/389 (42%), Positives = 229/389 (58%), Gaps = 4/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKGQG+ +WD  G++Y+DF  GIAV  LGH HP +  A+  Q +TL
Sbjct: 15  EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++L + L+E + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 75  WHISNVFTNEPALRLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 135 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G+++LC++   LL+FDEVQCG+GRTG    Y HYGV PDI+T A
Sbjct: 195 IQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPI AML   ++A AF PG H ST+GGNPLA   + A  + +    VLE     
Sbjct: 255 KALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIINTPEVLEGIQAK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            + F   L K+  +  +  ++R              K    D +    E G+++     +
Sbjct: 315 RQRFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGRARDFLYAGAEAGVMVLNAGPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           V+RF P L++   +ID+ +Q    A+  V
Sbjct: 375 VMRFAPSLVVEDADIDEGMQRFAHAVAKV 403


>ARGD_BACHD RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 384

 Score =  323 bits (827), Expect = 2e-90
 Identities = 167/381 (43%), Positives = 230/381 (60%), Gaps = 6/381 (1%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           ++  TY +  + +  G+G  ++D  G +YLDFVSGIAV  LGH HP+V  AV +Q+ +  
Sbjct: 3   HLFPTYAKWDVTITSGKGTKLYDNQGNEYLDFVSGIAVCNLGHCHPKVVAAVEEQLHSFW 62

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H SN++ I  Q  +A LL E S  D  FFCNSGAEANE AIKLARK   +H      EI+
Sbjct: 63  HVSNLFHIPIQENVAALLTEQSGMDAVFFCNSGAEANEAAIKLARKATGKH------EIV 116

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
           T T SFHGRTL T++ATGQ K + G  P+ + F +VPFND+ ALK  +   T A++LE +
Sbjct: 117 TFTQSFHGRTLGTMSATGQDKIKTGFGPMLETFHHVPFNDIAALKQVVNEQTAAIVLEVI 176

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGEGGV      +   V  +C+E G+LLI DE+Q G+GRTG    +Q Y + PDIIT+AK
Sbjct: 177 QGEGGVNLIDPEFAASVNHVCQEHGILLIIDEIQTGIGRTGTAFAFQQYELTPDIITVAK 236

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
            LG GFP+GAML K+ +  AF  G H STFGGNPLA  A+ A +  + Q   L+   + G
Sbjct: 237 GLGNGFPVGAMLGKQHLIDAFSAGSHGSTFGGNPLAMAAAQAVLTEVFQPNFLQAVQEKG 296

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
           +   + L +  + + +VKE+R                 +    E+GLL+     NV+R L
Sbjct: 297 KQLLSGLNEALSGLEIVKEIRGNGLLVGIELQEEGAPFIKQLREKGLLVLNAGPNVIRLL 356

Query: 373 PPLIITKDEIDQAVQILKRAM 393
           PPL++T +E+ +AV  LK  +
Sbjct: 357 PPLVVTSEELHEAVTQLKEVL 377


>ASTC_ECO5E RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  322 bits (826), Expect = 3e-90
 Identities = 160/375 (42%), Positives = 228/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  E  ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNESVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNIINHRYGLFNEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_ECO57 RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  322 bits (826), Expect = 3e-90
 Identities = 160/375 (42%), Positives = 228/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  E  ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNESVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+GA+LA E+ A     G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNIINHRYGLFNEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_SALPK RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  321 bits (823), Expect = 6e-90
 Identities = 163/375 (43%), Positives = 226/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P+  V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPLIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTGK   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGKLYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  L     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALPA RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 408

 Score =  321 bits (823), Expect = 6e-90
 Identities = 163/375 (43%), Positives = 226/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P+  V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPLIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTGK   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGKLYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  L     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SHIBS RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 406

 Score =  321 bits (822), Expect = 8e-90
 Identities = 159/375 (42%), Positives = 227/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 MAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGG FP+GA+L  E+ A     G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGDFPVGALLTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ASTC_SHIB3 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 406

 Score =  321 bits (822), Expect = 8e-90
 Identities = 159/375 (42%), Positives = 227/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHPE+ EA+ +Q    
Sbjct: 12  EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + AD+ FFCNSGAEANE A+KLARK+A    G  K  I
Sbjct: 72  WHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +ND+ +    I   TCAV++EP
Sbjct: 132 MAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV+PA+ A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PD++T A
Sbjct: 192 IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGG FP+GA+L  E+ A     G H +T+GGNPLA+  +   +E +    +L    Q 
Sbjct: 252 KALGGDFPVGALLTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            ++F   L  +     L  EVR                  K I     + G+++    GN
Sbjct: 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGN 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++++E+
Sbjct: 372 VVRFAPALNVSEEEV 386


>ARGD_LISMF RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 386

 Score =  321 bits (822), Expect = 8e-90
 Identities = 179/383 (46%), Positives = 230/383 (60%), Gaps = 9/383 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++V  TY R P+ LV G G  V D +G+ YLDF SGIAV  LGH    VAEAV +Q+  +
Sbjct: 2   KHVFPTYKRFPIDLVNGTGTVVTDKNGKTYLDFTSGIAVCNLGHCPANVAEAVQQQLTNI 61

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADK-AFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
            H SN+Y    Q  +A+L+ +    D+  FFCNSG EANE A+KLARKY        K +
Sbjct: 62  WHTSNLYECALQDSVAELIADGK--DRLVFFCNSGTEANEAALKLARKYT------GKEK 113

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           IIT   SFHGRT  +++AT Q K  +G   L  GF YVP+ND+EA +  I  HT AVMLE
Sbjct: 114 IITFEKSFHGRTFGSMSATAQAKIHQGFGGLVPGFTYVPYNDIEAFRAEIDEHTAAVMLE 173

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
            +QGEGGVIPA  A+L  V+ LC++ G+LLI DEVQ GLGRTG   G++  G+EPDI TL
Sbjct: 174 VIQGEGGVIPANAAFLLEVQLLCKKMGVLLIIDEVQTGLGRTGTLYGFEQIGLEPDIFTL 233

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AK LG G PIGAM+ K  ++ AF PG H STFGGN LA  A+   + T+ Q G LE    
Sbjct: 234 AKGLGNGLPIGAMVGKANLSSAFGPGSHGSTFGGNKLALAAAKEILRTMKQAGFLEEVNA 293

Query: 311 MGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLR 370
             +YF+  L      +  V  +R              + +V    ++GLLI     NVLR
Sbjct: 294 KADYFRYLLEVHLEALDNVSVIRGGGFLIGIELENTAEPVVTELRDKGLLILTAGANVLR 353

Query: 371 FLPPLIITKDEIDQAVQILKRAM 393
            LPPL ++  EIDQA+ +LK  +
Sbjct: 354 ILPPLTVSYAEIDQAIYLLKSVL 376


>ASTC_SALG2 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  320 bits (819), Expect = 2e-89
 Identities = 162/375 (43%), Positives = 226/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  + A   +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINARFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALEP RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  320 bits (819), Expect = 2e-89
 Identities = 162/375 (43%), Positives = 226/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  + A   +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINARFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ARGD_PHOLL RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 403

 Score =  320 bits (819), Expect = 2e-89
 Identities = 170/386 (44%), Positives = 228/386 (59%), Gaps = 4/386 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q ++  Y       V+GQG+ VWD  G++Y+DF  GIAV  LGH HP + + + +Q + L
Sbjct: 14  QVMLPIYSPAQFIPVRGQGSRVWDQHGKEYIDFAGGIAVVALGHCHPTLVDVLKQQGEKL 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SNI+  EP + LA+ L++ + A++ FF NSGAEANE A KLAR YA     P K +I
Sbjct: 74  WHISNIFTNEPALILAQKLIDATFAERVFFANSGAEANEAAFKLARHYAIARHNPYKTKI 133

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I     FHGRTL TV+  GQ KY  G  P P    +VPFNDL+A+K  I  HTCAV+LEP
Sbjct: 134 IAFHQGFHGRTLFTVSVGGQPKYADGFGPKPADIIHVPFNDLDAVKAVIDDHTCAVVLEP 193

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGV  AA A++ GV++LC++  +LL+FDEVQ G+GRTGK   Y HY V PDIIT A
Sbjct: 194 VQGEGGVTAAAPAFIHGVRELCDKHQVLLVFDEVQSGMGRTGKLFSYMHYDVTPDIITTA 253

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALG GFPI AML    +A    PG H +T+GGNPLA   +    + +    VL    + 
Sbjct: 254 KALGNGFPISAMLTTVNIASVMTPGAHGTTYGGNPLACAVANVAFDIINTPAVLAGVEKR 313

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
                  L  +  +  +  E+R                  KDI+    E GL++    G+
Sbjct: 314 HNLMVNFLNDINQKYSIFGEIRGKGLLIGAELKAPHQGKAKDILQLAAENGLMLLSAGGD 373

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           VLRF P LII+++EI Q ++ L++ +
Sbjct: 374 VLRFTPSLIISEEEIAQGMERLEQVI 399


>ARGD_OCEIH RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 399

 Score =  320 bits (819), Expect = 2e-89
 Identities = 164/381 (43%), Positives = 223/381 (58%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           VM TY R P+   KG+G+++WD +G +YLD+ SGIA   LGH    V  A+  Q+K L H
Sbjct: 11  VMQTYNRFPITATKGKGSFLWDDNGEKYLDYTSGIATCNLGHVPDNVQHAISNQLKDLWH 70

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
           CSN+Y I  Q KLA LL E SC D+ FFCNS                      D+ EIIT
Sbjct: 71  CSNLYHIPSQEKLAALLTEYSCLDQVFFCNSXXXXXXXXXXXXXXXXXXXXXXDRTEIIT 130

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
              SFHGRT +T+ AT Q K  +G  PL +GF Y+PFN+ E+L       T AV+LE +Q
Sbjct: 131 FEQSFHGRTGSTMAATAQEKIHQGFTPLTEGFRYLPFNNKESLSEIDNGKTSAVLLEVIQ 190

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+  A + +L+ +  +C++  +LL+ DE+Q G+GRTG    YQ YG+EPD+IT+AK 
Sbjct: 191 GEGGIHTAEKDWLKQLAAICKQADILLMIDEIQTGIGRTGSLFAYQPYGIEPDVITVAKG 250

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           LG GFPIGAMLAK+ +A +F PG H STFGGNP+AA A +AT++ +L  G LEN  +  E
Sbjct: 251 LGSGFPIGAMLAKQHIAASFSPGTHGSTFGGNPVAAAAGIATLKEILSDGFLENCKEGQE 310

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
               +L  +    PL+K++R                 +    E+ +L+      V+R LP
Sbjct: 311 ELFNQLKSIKEISPLIKDIRGKGYLMGIEVMNQASAWIEKLREKQILVLPAGEKVVRILP 370

Query: 374 PLIITKDEIDQAVQILKRAML 394
           PL  TK+E+   +Q LK   L
Sbjct: 371 PLTTTKEELQICIQALKEVAL 391


>ASTC_SALTY RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 408

 Score =  319 bits (817), Expect = 3e-89
 Identities = 162/375 (43%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHIGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  L     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALPB RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  319 bits (817), Expect = 3e-89
 Identities = 161/375 (42%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRIGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPSYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALNS RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  318 bits (816), Expect = 4e-89
 Identities = 162/375 (43%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRYQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQNYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  L     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALA4 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  318 bits (816), Expect = 4e-89
 Identities = 162/375 (43%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYIPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  L     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTKFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALPC RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  318 bits (815), Expect = 5e-89
 Identities = 161/375 (42%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALHS RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  318 bits (815), Expect = 5e-89
 Identities = 161/375 (42%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_SALDC RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 408

 Score =  318 bits (815), Expect = 5e-89
 Identities = 161/375 (42%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ARGD_SHIFL RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 406

 Score =  318 bits (815), Expect = 5e-89
 Identities = 163/389 (41%), Positives = 229/389 (58%), Gaps = 4/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKGQG+ +WD  G++Y+DF  GIAV  LGH HP +  A+  Q +TL
Sbjct: 15  EVILPIYAPAEFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++L + L+E + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 75  WHISNVFTNEPALRLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 135 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G+++LC++   LL+FDEVQCG+GRTG    Y++YGV PDI+T A
Sbjct: 195 IQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYRYYGVTPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPI AML   ++A AF PG H ST+GGNPLA   + A  + +    VLE     
Sbjct: 255 KALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIINTPEVLEGIQAK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            + F   L K+  +  +  ++R              K    D +    E G+++     +
Sbjct: 315 RQRFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPHYKGRARDFLYAGAEVGVMVLNAGPD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           V+R  P L++   +ID+ +Q    A+  V
Sbjct: 375 VMRLAPSLVVEDADIDEGMQRFAHAVAKV 403


>ASTC_YERPG RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 414

 Score =  318 bits (814), Expect = 7e-89
 Identities = 165/385 (42%), Positives = 231/385 (60%), Gaps = 10/385 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++ TY      +V+G+G+ +WD  G+ Y+DF  GIAVN LGH HP V  A+ +Q   +
Sbjct: 14  EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKV 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP----- 126
            H  N Y  EP ++LAK L++ + A+K FFCNSGAEANE A+KLARKYA  +        
Sbjct: 74  WHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQQ 133

Query: 127 -DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            +K +I+   N+FHGRTL TV+A GQ KY +   PLP G  +  FNDL + ++ I   TC
Sbjct: 134 GEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEHLITDQTC 193

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGGV+PA + +L G++ LC+    LLIFDE+Q G+GRTG+   Y HYGV P
Sbjct: 194 AVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVSP 253

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++T AKALGGGFPIGAML   + A A   G H +TFGGNPLA   +   +  + Q  +L
Sbjct: 254 DVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLL 313

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
                  ++F  EL ++ A   +  E+R                  K+IV    + GL+ 
Sbjct: 314 AGVKARHQWFIDELAEINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIA 373

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAV 386
                +V+RF P LII+  EI + +
Sbjct: 374 LIAGPDVVRFAPSLIISPKEIKEGL 398


>ASTC_YERPE RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 414

 Score =  318 bits (814), Expect = 7e-89
 Identities = 165/385 (42%), Positives = 231/385 (60%), Gaps = 10/385 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++ TY      +V+G+G+ +WD  G+ Y+DF  GIAVN LGH HP V  A+ +Q   +
Sbjct: 14  EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKV 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP----- 126
            H  N Y  EP ++LAK L++ + A+K FFCNSGAEANE A+KLARKYA  +        
Sbjct: 74  WHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQQ 133

Query: 127 -DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            +K +I+   N+FHGRTL TV+A GQ KY +   PLP G  +  FNDL + ++ I   TC
Sbjct: 134 GEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEHLITDQTC 193

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGGV+PA + +L G++ LC+    LLIFDE+Q G+GRTG+   Y HYGV P
Sbjct: 194 AVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVSP 253

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++T AKALGGGFPIGAML   + A A   G H +TFGGNPLA   +   +  + Q  +L
Sbjct: 254 DVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLL 313

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
                  ++F  EL ++ A   +  E+R                  K+IV    + GL+ 
Sbjct: 314 AGVKARHQWFIDELAEINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIA 373

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAV 386
                +V+RF P LII+  EI + +
Sbjct: 374 LIAGPDVVRFAPSLIISPKEIKEGL 398


>ASTC_YERPA RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 414

 Score =  318 bits (814), Expect = 7e-89
 Identities = 165/385 (42%), Positives = 231/385 (60%), Gaps = 10/385 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++ TY      +V+G+G+ +WD  G+ Y+DF  GIAVN LGH HP V  A+ +Q   +
Sbjct: 14  EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKV 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP----- 126
            H  N Y  EP ++LAK L++ + A+K FFCNSGAEANE A+KLARKYA  +        
Sbjct: 74  WHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQQ 133

Query: 127 -DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            +K +I+   N+FHGRTL TV+A GQ KY +   PLP G  +  FNDL + ++ I   TC
Sbjct: 134 GEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEHLITDQTC 193

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGGV+PA + +L G++ LC+    LLIFDE+Q G+GRTG+   Y HYGV P
Sbjct: 194 AVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVSP 253

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++T AKALGGGFPIGAML   + A A   G H +TFGGNPLA   +   +  + Q  +L
Sbjct: 254 DVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLL 313

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
                  ++F  EL ++ A   +  E+R                  K+IV    + GL+ 
Sbjct: 314 AGVKARHQWFIDELAEINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIA 373

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAV 386
                +V+RF P LII+  EI + +
Sbjct: 374 LIAGPDVVRFAPSLIISPKEIKEGL 398


>ASTC_SALTI RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 408

 Score =  318 bits (814), Expect = 7e-89
 Identities = 161/375 (42%), Positives = 224/375 (59%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +WD  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA  A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATNAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ASTC_YERP3 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 414

 Score =  317 bits (813), Expect = 9e-89
 Identities = 165/385 (42%), Positives = 230/385 (59%), Gaps = 10/385 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++ TY      +V+G+G+ +WD  G+ Y+DF  GIAVN LGH HP V  A+ +Q   +
Sbjct: 14  EWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKV 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP----- 126
            H  N Y  EP ++LAK L++ + A+K FFCNSGAEANE A+KLARKYA  +        
Sbjct: 74  WHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQQ 133

Query: 127 -DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            +K +I+   N+FHGRTL TV+A GQ KY +   PLP G  +  FNDL + +  I   TC
Sbjct: 134 GEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEQLITDQTC 193

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGGV+PA + +L G++ LC+    LLIFDE+Q G+GRTG+   Y HYGV P
Sbjct: 194 AVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVSP 253

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++T AKALGGGFPIGAML   + A A   G H +TFGGNPLA   +   +  + Q  +L
Sbjct: 254 DVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLL 313

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
                  ++F  EL ++ A   +  E+R                  K+IV    + GL+ 
Sbjct: 314 AGVKARHQWFIDELAEINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIA 373

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAV 386
                +V+RF P LII+  EI + +
Sbjct: 374 LIAGPDVVRFAPSLIISPKEIKEGL 398


>ASTC_YERPS RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 414

 Score =  317 bits (812), Expect = 1e-88
 Identities = 165/385 (42%), Positives = 231/385 (60%), Gaps = 10/385 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++ TY      +V+G+G+ +WD  G+ Y+DF  GIAVN LGH HP V  A+ +Q   +
Sbjct: 14  EWLVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKV 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP----- 126
            H  N Y  EP ++LAK L++ + A+K FFCNSGAEANE A+KLARKYA  +        
Sbjct: 74  WHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQQ 133

Query: 127 -DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            +K +I+   N+FHGRTL TV+A GQ KY +   PLP G  +  FNDL + ++ I   TC
Sbjct: 134 GEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEHLITDQTC 193

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGGV+PA + +L G++ LC+    LLIFDE+Q G+GRTG+   Y HYGV P
Sbjct: 194 AVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVSP 253

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++T AKALGGGFPIGAML   + A A   G H +TFGGNPLA   +   +  + Q  +L
Sbjct: 254 DVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLL 313

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
                  ++F  EL ++ A   +  E+R                  K+IV    + GL+ 
Sbjct: 314 AGVKARHQWFIDELAEINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIA 373

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAV 386
                +V+RF P LII+  EI + +
Sbjct: 374 LIAGPDVVRFAPSLIISPKEIKEGL 398


>ARGD_SALTY RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 405

 Score =  317 bits (812), Expect = 1e-88
 Identities = 160/386 (41%), Positives = 228/386 (59%), Gaps = 4/386 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKG+G+ VWD  G++Y+DF  GIAV  LGH HP + EA+  Q +TL
Sbjct: 15  EVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP ++L + L++ + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 75  WHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 135 IAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G++ LC+E   LL+FDEVQCG+GRTG    Y HYGV PDI+T A
Sbjct: 195 IQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+ AML  +++A AF  G H ST+GGNPLA   + A  + +    VL+     
Sbjct: 255 KALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            + F   L  +  +  +  ++R              K    D +    E G+++     +
Sbjct: 315 RQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGAD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RF P L++ + +I + +Q   +A+
Sbjct: 375 VMRFAPSLVVEEADIHEGMQRFAQAV 400


>ASTC_SALCH RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 408

 Score =  317 bits (811), Expect = 1e-88
 Identities = 160/375 (42%), Positives = 225/375 (60%), Gaps = 4/375 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++  Y   P   V+G+G+ +W+  G++Y+DF  GIAVN LGHAHP + EA+ +Q    
Sbjct: 12  EWMVPVYVPAPFIPVRGEGSRLWEQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRF 71

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H  N Y  EP ++LAK L++ + A++ FFCNSGAEANE A+KLARKYA   +G  K  I
Sbjct: 72  WHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGI 131

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   N+FHGRTL TV+A GQ  Y +   PLP    +  +NDL +    I  +TCAV++EP
Sbjct: 132 VAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEP 191

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGVIPA +A+L+G+++LC+    LLIFDEVQ G+GRTG+   Y HYGV PDI+T A
Sbjct: 192 VQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 251

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFPIGAML  +  A    PG H +T+GGNPLA   +   ++ +    +     Q 
Sbjct: 252 KALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQR 311

Query: 312 GEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            + F   L  +     +  E+R                  K I     + G+++    G+
Sbjct: 312 HDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGGD 371

Query: 368 VLRFLPPLIITKDEI 382
           V+RF P L ++ +EI
Sbjct: 372 VVRFAPALNVSDEEI 386


>ARGD_VIBVU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  315 bits (806), Expect = 6e-88
 Identities = 162/380 (42%), Positives = 223/380 (58%), Gaps = 4/380 (1%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y  + M  VKGQG+ +WD +G +Y+DF  GIAV+CLGH HP +  A+ +Q   L H SN+
Sbjct: 20  YNPMEMIPVKGQGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQAGKLWHLSNV 79

Query: 78  YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
              EP ++LAK L E S A++ FF NSGAEANE A+KLAR+YA    GP+K EII     
Sbjct: 80  MTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVYGPEKSEIIAFKQG 139

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGG 197
           FHGRT  TVT  GQ  Y  G  P P    ++P+ND+EAL+  I   TCAVM+EP+QGEGG
Sbjct: 140 FHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHISDRTCAVMMEPLQGEGG 199

Query: 198 VIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG 257
           +IP    +++ V++LC++   LL+FDEVQ G GRTG+F  YQ  GV PDI++ AK+LGGG
Sbjct: 200 IIPPTAEFIQAVRELCDKHNALLVFDEVQTGNGRTGEFYAYQGLGVTPDILSTAKSLGGG 259

Query: 258 FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKA 317
           FPIGAML   ++A+  + G H ST+GGNPL             +   L+   +  ++F+ 
Sbjct: 260 FPIGAMLTTAKLAEHLKVGTHGSTYGGNPLXXXXXXXXXXXXSKPETLQGVKEREQWFRE 319

Query: 318 ELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGNVLRFLP 373
            L KL  +  +  E+R              K    D++    ++            RF P
Sbjct: 320 GLAKLNEKYQIFAEIRGKGLLLGAALNEQWKGRARDVLVAAGKEXXXXXXXXXXXXRFTP 379

Query: 374 PLIITKDEIDQAVQILKRAM 393
            L+ITK EI++    L +A+
Sbjct: 380 SLVITKQEIEEGFAKLDKAI 399


>ARGD_SALTI RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 405

 Score =  315 bits (806), Expect = 6e-88
 Identities = 159/386 (41%), Positives = 228/386 (59%), Gaps = 4/386 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           + ++  Y       VKG+G+ VWD  G++Y+DF  GIAV  LGH HP + EA+  Q +TL
Sbjct: 15  EVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETL 74

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN++  EP + L + L++ + A++  F NSG EANE A KLAR YA     P K +I
Sbjct: 75  WHTSNVFTNEPALCLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           I   N+FHGR+L TV+  GQ KY  G  P P    +VPFNDL A+K  +  HTCAV++EP
Sbjct: 135 IAFQNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEP 194

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +QGEGGV  A   +L+G++ LC++   LL+FDEVQCG+GRTG    Y HYGV PDI+T A
Sbjct: 195 IQGEGGVQAATPEFLKGLRDLCDKHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSA 254

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           KALGGGFP+ AML  +++A AF  G H ST+GGNPLA   + A  + +    VL+     
Sbjct: 255 KALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTK 314

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGN 367
            + F   L  +  +  +  ++R              K    D +    E G+++     +
Sbjct: 315 RQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGAD 374

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
           V+RF P L++ + +I++ +Q   +A+
Sbjct: 375 VMRFAPSLVVEEADINEGMQRFAQAV 400


>ARGD_PASMU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 398

 Score =  315 bits (806), Expect = 6e-88
 Identities = 166/395 (42%), Positives = 234/395 (59%), Gaps = 7/395 (1%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           N+EI     Q ++  Y       V+G+G+ VWD  G+ Y+DF SGIAVN LGH   E+ +
Sbjct: 5   NREIF---DQVMIQNYVPAQFIPVRGKGSHVWDQQGKDYIDFTSGIAVNSLGHCADEIVD 61

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
            + +Q + L H SN +  EP + LA  LVE + A++  F NSGAEANE A+KLAR+YA  
Sbjct: 62  VLKQQSEKLWHSSNWFTSEPTLALATKLVEKTFAERVMFVNSGAEANEAALKLARRYAVD 121

Query: 123 HLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGP 182
           H G  K +II    SFHGRTL TV+  GQ KY  G  P P    +VPFNDL A++  +  
Sbjct: 122 HFGYQKSKIIAFKQSFHGRTLFTVSVGGQAKYSDGFGPKPADIVHVPFNDLAAVQAVMDE 181

Query: 183 HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYG 242
           +TCAV++EP+QGE G++PA+Q +L+G+++LC++   LLIFDEVQ G+GRTG    Y  Y 
Sbjct: 182 NTCAVIVEPIQGESGILPASQDFLQGLRELCDQHNALLIFDEVQTGVGRTGYLYAYMKYE 241

Query: 243 VEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
           V PDI+T AKALG GFPIGAML   ++A++F PG H +TFGGNPLA   +   ++ +   
Sbjct: 242 VVPDILTSAKALGNGFPIGAMLTTHEIAKSFAPGVHGTTFGGNPLACAVAEKVIDIISAP 301

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQG 358
             L+   +  E F  +L ++  +  L KE+R                   + V    + G
Sbjct: 302 PFLQKIQRTSEKFMQKLQEINQQCGLFKEIRGEGLLIGAELIEQYHGRASEFVKKAADNG 361

Query: 359 LLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           L+I     NVLRF P L I+++ +    + L + +
Sbjct: 362 LMILVAGPNVLRFAPALNISEEALALGFERLAKTL 396


>ARGD_HAEDU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 393

 Score =  315 bits (806), Expect = 6e-88
 Identities = 173/396 (43%), Positives = 237/396 (59%), Gaps = 9/396 (2%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           M + +I  +   Y+  TY +  +AL  GQG  VWD DG +YLDF SGI VN LG A P+ 
Sbjct: 1   MTSDQIKQLDANYIAQTYAKFDLALSHGQGCEVWDFDGNKYLDFTSGIGVNSLGWADPDW 60

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYA 120
            EAV  Q+  L H SN+++ EP  +LAK LV+ S   + FF NSGAEANEGAIK+ARKY+
Sbjct: 61  LEAVIAQLHKLSHTSNLFYTEPSARLAKHLVQVSGLKRVFFANSGAEANEGAIKVARKYS 120

Query: 121 KQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
               G  +  II+  NSFHGRT++T+ ATGQ  + +   P   GF ++  NDL A K  I
Sbjct: 121 HDKYGDTRSTIISLVNSFHGRTISTLAATGQKLFHQHFFPFTAGFEHLIANDLNAFKTRI 180

Query: 181 GPH-TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             +  CA++LE VQGEGGV    QAYL+ V+ LC+ + +LLI DEVQ G+GRTG    YQ
Sbjct: 181 AQNDICAIILEVVQGEGGVCSLDQAYLQAVQGLCQVQDILLIIDEVQTGIGRTGTMFAYQ 240

Query: 240 HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
            + ++PDI+TLAK L GG PIGA L  ++VA+    GDH STFG NP++  A+ A + T 
Sbjct: 241 QFELKPDIVTLAKGLAGGLPIGAFLLADKVAETLAKGDHGSTFGANPVSCAAANAVL-TK 299

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK--DIVAHCLEQ 357
           L+   L    + G+    +L K    +P VK +                  D+V +CL+Q
Sbjct: 300 LEPLFLTEVMRKGQ----KLRKALQSLPHVKSISGLGLMIGVEFDEHINVADVVTNCLKQ 355

Query: 358 GLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           G+L   T    LR LPPLII  +++++ V +L + +
Sbjct: 356 GVLF-LTAKTKLRMLPPLIINDEQLERGVTVLAQVL 390


>ARGD_METKA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 389

 Score =  314 bits (804), Expect = 1e-87
 Identities = 167/370 (45%), Positives = 232/370 (62%), Gaps = 13/370 (3%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y MNTY R P+ LV G+GA VWD +G +Y+D V+GIAVN LGH HP V EAV +QV+ L
Sbjct: 9   KYHMNTYSRFPVTLVPGEGARVWDDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVERL 68

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPDKY 129
           +HCSN+Y+ EPQ             D  K FFCNSG E+ E AIKLARK+     G  K+
Sbjct: 69  IHCSNLYYNEPQXXXXXXXXXXXPKDLNKVFFCNSGTESVECAIKLARKFT----GCTKF 124

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVML 189
             I     FHGRT+  ++AT + +++   +PL   F +VP+ D+ A++  I   T AV++
Sbjct: 125 --IAFEGGFHGRTMGALSATWKPEFREPFEPLVPEFEHVPYGDVNAVEKAIDDDTAAVIV 182

Query: 190 EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIIT 249
           EPVQGE GV    + +L  +++LC+E GLLLI DEVQ G+GRTG+F  ++H  V PDI+ 
Sbjct: 183 EPVQGEAGVRIPPEGFLRELRELCDEHGLLLIVDEVQSGMGRTGQFFAFEHEDVLPDIVC 242

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
           LAK LGGG P+GA +A+E+VA+AF+PGDH STFGGNPL          T+L++ + E A 
Sbjct: 243 LAKGLGGGVPVGATIAREEVAEAFEPGDHGSTFGGNPLXXXXXXXXXSTVLEENLPEAAE 302

Query: 310 QMGEYFKAELTKLAAEVPLVKEV--RXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
           + G   K  +  L+    +V+EV  R              KD+    L++G L+N T+G+
Sbjct: 303 RKG---KLAMRILSEAEDVVEEVRGRGLMMGVEVGDDERAKDVAREMLDRGALVNVTSGD 359

Query: 368 VLRFLPPLII 377
           V+R +PPL+I
Sbjct: 360 VIRLVPPLVI 369


>ARGD1_BRAJA RecName: Full=Acetylornithine aminotransferase 1;      
             Short=ACOAT 1;         EC=2.6.1.11;
          Length = 405

 Score =  314 bits (804), Expect = 1e-87
 Identities = 167/385 (43%), Positives = 226/385 (58%), Gaps = 1/385 (0%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           +++  + R  +   +G+G W+   +G +YLDF SG+AVN LGHAHP + +A+ +Q   L 
Sbjct: 11  HLLPVFARSDLGFERGEGCWLIATNGDRYLDFTSGVAVNALGHAHPALVKALQEQATKLW 70

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H SN++      KLA  L   S AD  FFCNSGAEA EG IKL R +      P++Y II
Sbjct: 71  HMSNLFQSPDGEKLATRLCNESFADFVFFCNSGAEALEGVIKLVRHHHFSKGHPERYRII 130

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
           T   +FHGRTLAT+ ATG  KY  G  P   GF  VP  D+EA+K  IGP T  +++EP+
Sbjct: 131 TFEGAFHGRTLATLAATGSAKYLEGFGPPMDGFDQVPHGDIEAVKKAIGPQTAGILIEPI 190

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGEGGV  A  A+L+ ++QLC+EKGLLL FDEVQ G+GRTG    ++  GV PD+++LAK
Sbjct: 191 QGEGGVRSATPAFLKALRQLCDEKGLLLAFDEVQTGMGRTGDLFAHRRTGVTPDVMSLAK 250

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           ALGGGFPI                 H STFGGNPLA  A+ A ++ +L+ G  ++  +M 
Sbjct: 251 ALGGGFPIXXXXXXXXXXXXXXXXSHGSTFGGNPLAIAAANAVLDVMLKPGFFDHVQKMS 310

Query: 313 EYFKAELTK-LAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRF 371
              K +L   +     +V EVR               D+VA    + LL      NV+RF
Sbjct: 311 LLLKQKLASVIDRHGDVVSEVRGEGLLIGIKAVVPSGDLVAALRNEKLLTVGAGDNVVRF 370

Query: 372 LPPLIITKDEIDQAVQILKRAMLVV 396
           LPPLI+T+ EI+ +V  L+RA   +
Sbjct: 371 LPPLIVTEAEIEDSVGRLERACAAI 395


>ARGD_VIBVY RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  313 bits (803), Expect = 1e-87
 Identities = 161/380 (42%), Positives = 223/380 (58%), Gaps = 4/380 (1%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y  + M  VKGQG+ +WD +G +Y+DF  GIAV+CLGH HP +  A+ +Q   L H SN+
Sbjct: 20  YNPMEMIPVKGQGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQAGKLWHLSNV 79

Query: 78  YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
              EP ++LAK L E S A++ FF NSGAEANE A+KLAR+YA    GP+K EII     
Sbjct: 80  MTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVYGPEKSEIIAFKQG 139

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGG 197
           FHGRT  TVT  GQ  Y  G  P P    ++P+ND+EAL+  I   TCAVM+EP+QGEGG
Sbjct: 140 FHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHISDRTCAVMMEPLQGEGG 199

Query: 198 VIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG 257
           +IP    +++ V++LC++   LL+FDEVQ G GRTG+F  YQ  GV PDI++ AK+LGGG
Sbjct: 200 IIPPTAEFIQAVRELCDKHNALLVFDEVQTGNGRTGEFYAYQGLGVTPDILSTAKSLGGG 259

Query: 258 FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKA 317
           FPIGAML   ++A+  + G H ST+GGNPL             +   L+   +  ++F+ 
Sbjct: 260 FPIGAMLTTAKLAEHLKVGTHGSTYGGNPLXXXXXXXXXXXXSKPETLQGVKEREQWFRE 319

Query: 318 ELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
            L KL  +  +  E+R                  +D++    ++            RF P
Sbjct: 320 GLAKLNEKYQIFAEIRGKGLLLGAALNEQWQGRARDVLVAAGKEXXXXXXXXXXXXRFTP 379

Query: 374 PLIITKDEIDQAVQILKRAM 393
            L+ITK EI++    L +A+
Sbjct: 380 SLVITKQEIEEGFAKLDKAI 399


>ARGD_STRMU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 379

 Score =  313 bits (801), Expect = 2e-87
 Identities = 169/377 (44%), Positives = 224/377 (59%), Gaps = 8/377 (2%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +   Y R  +  +K +G +++D  G++YLDF +GI V  LG  HP+V  A+ KQ + + H
Sbjct: 4   LFQNYTRADLEFIKAEGNYLFDTQGKKYLDFSTGIGVTNLGF-HPQVQVALQKQAEQIWH 62

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
             N+Y    Q ++A  L+       AFFCNSGAEANE AIK+ARK         K EIIT
Sbjct: 63  TPNLYQNSLQEEVAAKLMAGKDY-LAFFCNSGAEANEAAIKIARK------ATGKQEIIT 115

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             NSFHGRT  +++ATGQ K + G       F Y  FNDL ++K  +  +T AVMLE VQ
Sbjct: 116 FQNSFHGRTFGSMSATGQDKIKVGFGDAVPHFHYAVFNDLNSVKALVTENTAAVMLELVQ 175

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GV+PA Q ++  +   C++ GLLLI DEVQ G+GRTGK   +QHYG+EPDI TLAK 
Sbjct: 176 GESGVLPAEQDFVTALADYCQKNGLLLIIDEVQTGMGRTGKLYAFQHYGIEPDIFTLAKG 235

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           L  G P+GAMLAK+Q   AF PG H STFGGN LA  AS A ++ + + G LE AW+   
Sbjct: 236 LANGVPVGAMLAKKQFGSAFGPGSHGSTFGGNKLAMAASSAVLDIMTKAGFLEQAWENAH 295

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
           Y + +LT        V +VR                +V    ++GL++     NV+R LP
Sbjct: 296 YLQEQLTSALQVADTVTQVRGLGYMIGIETTADLGQLVKATRDRGLIVLTAGTNVIRLLP 355

Query: 374 PLIITKDEIDQAVQILK 390
           PL +TKDEIDQ + IL+
Sbjct: 356 PLTLTKDEIDQGIMILQ 372


>ARGD_RHILO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 399

 Score =  312 bits (800), Expect = 3e-87
 Identities = 163/383 (42%), Positives = 229/383 (59%), Gaps = 1/383 (0%)

Query: 9   MGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV 68
           M    +  T+ R P+A   G+G W+    G +YLDF  GIAVN LGH+HP +  A+ +Q 
Sbjct: 1   MSGSALYETFARAPLAFDHGEGTWLVTDKGERYLDFAGGIAVNSLGHSHPHLVAALTEQA 60

Query: 69  KTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDK 128
             L H SN+Y I  Q +L + LV+ + ADK FF NSGAEA E AIK AR+Y      P++
Sbjct: 61  AKLWHVSNLYEIPGQSRLGQRLVDATFADKVFFTNSGAEALECAIKTARRYHFVKGHPER 120

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVM 188
           + +IT   +FHGRTLAT+ A GQ KY  G  P  +GF  V F+D++A +  I P T A++
Sbjct: 121 FRVITFEGAFHGRTLATIAAGGQYKYLEGFGPKVEGFDQVGFDDIDAAEKAITPETAAIL 180

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EPVQGEGG+ P     L+ ++QLC++ GLLLI+DEVQCG+GRTGK   ++  GV PDI+
Sbjct: 181 IEPVQGEGGIRPVPTQSLKRLRQLCDQHGLLLIYDEVQCGIGRTGKLFAHEWSGVAPDIM 240

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENA 308
            +AK +GGGFP+GA LA ++ A     G H +TFGGNPLA     A ++ +L+ G LE+ 
Sbjct: 241 AIAKGIGGGFPMGACLATDEAAVGMTAGVHGTTFGGNPLAMAVGNAVLDVVLEDGFLEDV 300

Query: 309 WQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
            +     K  L  +A E P +V+++R                +     +Q LL      N
Sbjct: 301 QRKALLMKQGLAAIADEFPDVVEDIRGTGLMLGLKCAMPNTKVNMALRDQHLLAVPAGDN 360

Query: 368 VLRFLPPLIITKDEIDQAVQILK 390
           V+R LPPL +T  EI +A+  ++
Sbjct: 361 VIRLLPPLTVTDAEIHEALNRIR 383


>ARGD_ARCFU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 375

 Score =  312 bits (800), Expect = 3e-87
 Identities = 156/379 (41%), Positives = 243/379 (64%), Gaps = 13/379 (3%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           +++++ TY R  + + +G+G +V+D +G++YLD V+GIA   +GH +  + E + +Q++ 
Sbjct: 8   KKHILQTYTRQKVVIERGEGCYVYDVNGKRYLDLVAGIATVSIGHCNSHLVERLKEQLEK 67

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           L+H SN+Y+  PQV+LA+ L E +  D+ FFCNSGAEA E A+K AR+         + +
Sbjct: 68  LIHISNLYYTTPQVELAEKLSEIAGMDRFFFCNSGAEAVEAALKFARR------ATGRKK 121

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
            ++ T  FHGRT+  ++ T + K+++  +PL     +  FN+ E+L+  +   T AV++E
Sbjct: 122 FVSFTGDFHGRTMGALSVTHKEKFRKPFEPLVSPVEFAEFNNPESLEKVVDEETAAVIVE 181

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
            VQGE GV PA + +++ +++L E+ G LLI DEVQ G GRTG++    HYG+EPD+IT+
Sbjct: 182 LVQGEAGVYPADREFVKAIEELREKYGFLLIVDEVQTGFGRTGRWFAKDHYGIEPDMITM 241

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AKA+G G PIG    KE+VA+  Q GDH STFGGNPLA TA+LAT+E + ++G++EN+ +
Sbjct: 242 AKAMGSGVPIGCCALKEEVAEKIQVGDHGSTFGGNPLACTAALATIEVIEREGLVENSAR 301

Query: 311 MGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLR 370
           MGEYF   L +    V                      + V  CLE GLL+N T+   +R
Sbjct: 302 MGEYFVKRLKESFENV-------IGVGLMIGFDVGDAAEFVRKCLENGLLVNNTSERRIR 354

Query: 371 FLPPLIITKDEIDQAVQIL 389
            +PPL+IT+ E+D+AV+I+
Sbjct: 355 LVPPLVITEREVDKAVEIM 373


>ARGD_ALNGL RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;AltName: Full=Acetylornithine transaminase;
          Length = 451

 Score =  311 bits (798), Expect = 5e-87
 Identities = 164/396 (41%), Positives = 241/396 (60%), Gaps = 5/396 (1%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++E++    + ++ TY R+P+ L +G+G  ++D +GR+YLD  +GIAVN LGHA  +   
Sbjct: 49  SKEVMEAAGRVLVGTYARVPVVLSRGKGCKLYDPEGREYLDLSAGIAVNVLGHADSDWLR 108

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           AV +Q  TL H SN+++  PQV+LAK LV +S AD+ FF NSG EANE AIK ARK+ + 
Sbjct: 109 AVTEQAATLTHVSNVFYSIPQVELAKRLVASSFADRVFFSNSGTEANEAAIKFARKFQRF 168

Query: 123 HLGPDKY---EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
               +K    E ++ +NSFHGRT+ ++  T +  Y+   +P+  G  ++ + ++EA    
Sbjct: 169 TRPDEKQPATEFVSFSNSFHGRTMGSLALTSKENYRSPFEPVMPGVTFLEYGNIEAATQL 228

Query: 180 IGPHT-CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           I      AV +EP+QGEGGV  A + +L  +++ C++ G LL+FDEVQCGLGRTG    +
Sbjct: 229 IQRRKIAAVFVEPIQGEGGVYSATKEFLYALRKACDDSGTLLVFDEVQCGLGRTGYLWAH 288

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           + Y V PDI+TLAK L GG PIGA+L  E+VA A   GDH +TF G PL   A+L  ++ 
Sbjct: 289 EIYDVFPDIMTLAKPLAGGLPIGAVLVTERVASAITYGDHGTTFAGGPLVCKAALTVLDK 348

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQG 358
           +L+ G L +  + G YFK  L         V+EVR                +V  CL  G
Sbjct: 349 ILRPGFLASVSKKGHYFKEMLINKLGGNSHVREVRGVGLIVGIELDVSASPLVNACLNSG 408

Query: 359 LLI-NCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           LL+     GNV+R +PPLIIT+ E+++A +IL + +
Sbjct: 409 LLVLTAGKGNVVRIVPPLIITEQELEKAAEILLQCL 444


>ARGD_PROMM RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 418

 Score =  311 bits (796), Expect = 8e-87
 Identities = 168/391 (42%), Positives = 228/391 (58%), Gaps = 12/391 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           VM TY R P+ L++G+G WVWD  G QYLD V+GIA   LGH+   +  ++ +Q+K L H
Sbjct: 25  VMGTYKRFPVTLLRGKGCWVWDDHGHQYLDAVAGIATCALGHSDRALRRSLGQQLKQLQH 84

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN+Y I  Q  LA  LVENSCAD  FFCNSGAEANE AIKLARK+  +  G D+  I+T
Sbjct: 85  VSNLYRIPEQEALAHWLVENSCADSVFFCNSGAEANEAAIKLARKHGHRRRGIDRPIILT 144

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAV 187
           A +SFHGRTLA ++ATGQ  + +G +P+ +GF + PFN+L+A +  +      GP   AV
Sbjct: 145 ANSSFHGRTLAAISATGQPNFHKGFEPMVEGFEFFPFNNLQAFEQQLNRLEAQGPSVAAV 204

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EP+QGEGGV P    +   +++LC +  +LLIFDEVQ G+GR G + GYQ  G+EPD 
Sbjct: 205 LIEPLQGEGGVNPGEAGFFRRLRELCSQHQILLIFDEVQVGMGRCGNWWGYQQLGIEPDA 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            T                K Q A  F+PGDHASTFGGNP A  A+L   + + ++G++  
Sbjct: 265 FTXXXXXXXXXXXXXXXVK-QHADLFEPGDHASTFGGNPFACKAALTVAKEIERRGLIAK 323

Query: 308 AWQMGEYFKAELTKLAAEVP-LVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
             Q G   +  LT L    P  +K VR                   ++    LE+ LL+ 
Sbjct: 324 VQQRGAQLREGLTDLVQRFPRQLKGVRGWGLLQGLVLQDESTFTAPNVAQAALEEKLLVI 383

Query: 363 CTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                V+R +PPLII   EI Q +Q L+  +
Sbjct: 384 AAGPKVVRMVPPLIIKPSEIRQLLQRLEATL 414


>ARGD_BRUSU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  310 bits (793), Expect = 2e-86
 Identities = 160/379 (42%), Positives = 224/379 (59%), Gaps = 1/379 (0%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           +TY R  +   +G+G W+   DG +Y+DF +GIAVN LGH+HP + E +  Q + L H S
Sbjct: 12  DTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWHLS 71

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           N+Y I  Q KL + LVE++ ADK FF NSGAEA E AIK AR+Y      P+++ IIT  
Sbjct: 72  NVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIITFE 131

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGE 195
            +FHGRTLAT+ A GQ KY  G  P  +GF  VPF D  AL+  I P T  ++LEP+QGE
Sbjct: 132 GAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQGE 191

Query: 196 GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALG 255
           GG+    + +L  V+Q+C+E GLLL+ DEVQ G+GRTGK   ++  G+ PDI+ +AK +G
Sbjct: 192 GGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEWAGIRPDIMAIAKGIG 251

Query: 256 GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYF 315
           GGFPIGA LA  + A+    G H +T+GGNPL      A ++ +L  G +EN        
Sbjct: 252 GGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATALVM 311

Query: 316 KAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPP 374
           K  L  L    P +V E+R                ++    ++ +L      NV+R LPP
Sbjct: 312 KQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLIQALRDEHILSVGAGDNVVRLLPP 371

Query: 375 LIITKDEIDQAVQILKRAM 393
           LI T +E  +A++ ++ A+
Sbjct: 372 LITTPEEAREALKHIETAV 390


>ARGD_BRUME RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  310 bits (793), Expect = 2e-86
 Identities = 160/379 (42%), Positives = 224/379 (59%), Gaps = 1/379 (0%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           +TY R  +   +G+G W+   DG +Y+DF +GIAVN LGH+HP + E +  Q + L H S
Sbjct: 12  DTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWHLS 71

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           N+Y I  Q KL + LVE++ ADK FF NSGAEA E AIK AR+Y      P+++ IIT  
Sbjct: 72  NVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIITFE 131

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGE 195
            +FHGRTLAT+ A GQ KY  G  P  +GF  VPF D  AL+  I P T  ++LEP+QGE
Sbjct: 132 GAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQGE 191

Query: 196 GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALG 255
           GG+    + +L  V+Q+C+E GLLL+ DEVQ G+GRTGK   ++  G+ PDI+ +AK +G
Sbjct: 192 GGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEWAGIRPDIMAIAKGIG 251

Query: 256 GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYF 315
           GGFPIGA LA  + A+    G H +T+GGNPL      A ++ +L  G +EN        
Sbjct: 252 GGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATALVM 311

Query: 316 KAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPP 374
           K  L  L    P +V E+R                ++    ++ +L      NV+R LPP
Sbjct: 312 KQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLIQALRDEHILSVGAGDNVVRLLPP 371

Query: 375 LIITKDEIDQAVQILKRAM 393
           LI T +E  +A++ ++ A+
Sbjct: 372 LITTPEEAREALKHIETAV 390


>ARGD_VIBPA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  309 bits (792), Expect = 2e-86
 Identities = 161/380 (42%), Positives = 222/380 (58%), Gaps = 4/380 (1%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y  + M  V+G+G+ +WD D  +Y+DF  GIAV+CLGH HP + +A+ +Q   L H SN+
Sbjct: 20  YNPMEMIPVRGKGSRIWDQDDNEYIDFAGGIAVSCLGHCHPVMVDALTEQGNKLWHLSNV 79

Query: 78  YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
              EP ++LAK L E S A++ FF NSGAEANE A+KLAR+YA    GP+K EII     
Sbjct: 80  MTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHGPEKSEIIAFKQG 139

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGG 197
           FHGRT  TVT  GQ  Y  G  P P    ++P+ND+EAL+  +   TCAVM+EP+QGEGG
Sbjct: 140 FHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSDRTCAVMMEPLQGEGG 199

Query: 198 VIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG 257
           ++P    + + V++LC++   LLIFDEVQ G GRTG F  YQ  G+ PDI++ AK+LGGG
Sbjct: 200 IVPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGITPDILSTAKSLGGG 259

Query: 258 FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKA 317
           FPIGAML   ++A+  + G H ST+GGNPL             +  VL    +    F+A
Sbjct: 260 FPIGAMLTTAKLAEHLKVGTHGSTYGGNPLXXXXXXXXXXXXTKPEVLAGVLEREALFRA 319

Query: 318 ELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
            L K+ A+  L  EVR                  +D++    +Q            RF P
Sbjct: 320 GLEKINAKYNLFSEVRGKGLLLGAALNEEWQGRARDVLVAAGKQXXXXXXXXXXXXRFTP 379

Query: 374 PLIITKDEIDQAVQILKRAM 393
            L+IT+ EI++ +  L +A+
Sbjct: 380 SLVITQQEIEEGLAKLDKAI 399


>ASTC_PHOLL RecName: Full=Succinylornithine transaminase;       
           Short=SOAT;         EC=2.6.1.81;AltName:
           Full=Succinylornithine aminotransferase;
          Length = 402

 Score =  309 bits (791), Expect = 3e-86
 Identities = 167/388 (43%), Positives = 224/388 (57%), Gaps = 4/388 (1%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           + Y++  +       V+ +G+ VWD DG++Y+DF  GIAVN LGHAHPE+ + +  Q+  
Sbjct: 11  EHYMVPCFSPAKFIPVRAKGSKVWDQDGKEYIDFAGGIAVNSLGHAHPELKDELIYQIDK 70

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           + H  N Y  EP +KLAK LVEN+ ADKAFFCNSGAEANE A+KLARKYA    G +K E
Sbjct: 71  IWHIGNGYTNEPVLKLAKRLVENTFADKAFFCNSGAEANEAALKLARKYAADKYGKNKNE 130

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           II+  +SFHGRTL TVT  GQ KY +   PLPQ   ++P+N+L A++  I  +TCA    
Sbjct: 131 IISFKDSFHGRTLFTVTVGGQPKYSQDYAPLPQEITHLPYNNLSAIREHISENTCAXXXX 190

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
                     A  A+L+ ++ LC+    LLIFDE+Q G+GRTG    YQ YGVEPDI+T 
Sbjct: 191 XXXXXXXXXXADPAFLQELRTLCDRFQALLIFDEIQTGVGRTGYLYAYQEYGVEPDILTS 250

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AK LGGGFPIGAML K+ +A  FQPG H +TFGGNPLA   +   +  + Q  +L    Q
Sbjct: 251 AKGLGGGFPIGAMLTKQHIAAVFQPGTHGTTFGGNPLATAVANKVLSIVNQAELLTGVLQ 310

Query: 311 MGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNG 366
             +YF  +L+KL     +   +R                  K +                
Sbjct: 311 RHDYFMDKLSKLNQRYQIFSCLRGKGLLLGAELDKAWQGKAKQLTNXXXXXXXXXXXXXP 370

Query: 367 NVLRFLPPLIITKDEIDQAVQILKRAML 394
           +VLRF P L I   +ID+ +  L+ A++
Sbjct: 371 DVLRFAPALNIEFADIDEGLVRLESAIM 398


>ARGD_METMA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 395

 Score =  307 bits (787), Expect = 9e-86
 Identities = 161/388 (41%), Positives = 244/388 (62%), Gaps = 11/388 (2%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           ++    +YVM TYGR P+ L KG+GA V D  G++Y+D V+GIAVN +GH HP V +A+ 
Sbjct: 18  VIDKDSKYVMQTYGRQPLVLSKGKGAVVQDIYGKEYIDCVAGIAVNNVGHCHPTVVKAIQ 77

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
            Q + L+H SN+Y+ E Q + A+ L   +  +  FFCNSGAEA E A+KLAR      + 
Sbjct: 78  AQAEKLIHVSNLYYTEIQAEFAETLASITGMECVFFCNSGAEAVEAAMKLAR------VA 131

Query: 126 PDKYEIITATNSFHGRTLATVTATGQTKYQRG-LDPLPQGFAYVPFNDLEALKNTIGPHT 184
             K   + A +SFHGRT+  ++ T ++ Y+   + P+    ++VP++D +A++  I   T
Sbjct: 132 TGKSAFVAAEHSFHGRTIGALSVTHKSMYRDPFMPPVSSKTSFVPYSDADAIRKAISEDT 191

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV+LEP+QGEGGV      YL+ V+++C+E G LLIFDEVQ G GRTG +   + +GVE
Sbjct: 192 AAVVLEPIQGEGGVNVPDPGYLKEVREICDETGTLLIFDEVQTGFGRTGTWFCKEQFGVE 251

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGV 304
           PDI+++AKA+GGGFP+GA+ A+  +  +F  G HASTFGG P        +++ + ++ +
Sbjct: 252 PDIMSMAKAIGGGFPMGAIAARSGL--SFGRGQHASTFGGGPXXXXXXXXSIQAIKEEKL 309

Query: 305 LENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCT 364
           LE + +MG YF  +L+ +A +   + EVR                 V    E G+L+NCT
Sbjct: 310 LERSKEMGAYFTKKLSGMARDD--IVEVRGKGLMIGVEIKYPCGKFVDFAREHGVLVNCT 367

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRA 392
           + +VLR +PPL+ITK++ID  V +L++A
Sbjct: 368 SDSVLRLVPPLVITKEQIDSVVDVLEQA 395


>ARGD_LISMO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 386

 Score =  307 bits (786), Expect = 1e-85
 Identities = 171/382 (44%), Positives = 222/382 (58%), Gaps = 7/382 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++V  TY R P+ LV G G  V D +G+ YLDF SGIAV  LGH    VAEAV +Q+  +
Sbjct: 2   KHVFPTYKRFPIDLVNGTGTVVTDKNGKTYLDFTSGIAVCNLGHCPTNVAEAVQQQLGNI 61

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN+Y    Q  +A+L+ +       FFCNSG E+NE A+KLARKY        K +I
Sbjct: 62  WHTSNLYECALQDSVAELIADGK-ERLVFFCNSGTESNEAALKLARKYT------GKEKI 114

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           IT   SFHGRT  +++ATGQ K  +G   L  GF YVP+ND+EA +  I  +T AVMLE 
Sbjct: 115 ITFEKSFHGRTFGSMSATGQAKIHQGFGELVPGFTYVPYNDIEAFRAEIDENTAAVMLEV 174

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           +Q EGGVIPA  A+L  V+ LC++ G LLI DEVQ GLGRTG   G++  G++PDI TLA
Sbjct: 175 IQAEGGVIPANAAFLLEVQLLCKKMGALLIIDEVQTGLGRTGTLYGFEQIGLDPDIFTLA 234

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K LG G PIGAM+ K  +  AF PG H STFGGN            T+ Q G LE     
Sbjct: 235 KGLGNGLPIGAMVGKSDLISAFGPGSHGSTFGGNXXXXXXXXXXXXTMKQTGFLEEVNAK 294

Query: 312 GEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRF 371
            +YF+  L      +  V ++R              + ++    ++GLLI     NVLR 
Sbjct: 295 ADYFRNLLEANLEVLDNVSDIRGGGFLIGIELENAAEPVITELRDKGLLILTAGTNVLRI 354

Query: 372 LPPLIITKDEIDQAVQILKRAM 393
           LPPL ++  EIDQA+ +LK  +
Sbjct: 355 LPPLTVSYAEIDQAIYLLKSVL 376


>ARGD_METAC RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 395

 Score =  306 bits (785), Expect = 2e-85
 Identities = 160/388 (41%), Positives = 242/388 (62%), Gaps = 11/388 (2%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           ++    +YVM TYGR P+ L KG+GA V D  G++Y+D V+GIAVN +GH HP V +A+ 
Sbjct: 18  VIEKDSKYVMQTYGRQPLVLSKGKGAVVQDIYGKEYIDCVAGIAVNNVGHCHPTVVKAIQ 77

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
            Q + L+H SN+Y+ E Q + A+ L   +  ++ FFCNSGAE+ E A+KLAR      + 
Sbjct: 78  AQAENLIHVSNLYYTEIQAEFAETLASITGMERVFFCNSGAESVEAAMKLAR------VA 131

Query: 126 PDKYEIITATNSFHGRTLATVTATGQTKYQRG-LDPLPQGFAYVPFNDLEALKNTIGPHT 184
             K   + A +SFHGRT+  ++ T ++ Y+   + P+     +VP++D EA++  I  +T
Sbjct: 132 TGKSAFVAAEHSFHGRTIGALSVTHKSMYRDPFMPPVSSETTFVPYSDAEAIRQAISENT 191

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV+LEP+QGEGG+      YL+ V+++C+E G LLIFDEVQ G GRTG +   + +GVE
Sbjct: 192 AAVILEPIQGEGGINIPDPGYLKEVREICDETGALLIFDEVQTGFGRTGTWFCKEQFGVE 251

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGV 304
           PDI++++KA+GGGFP+GA+ A   +   F  G HASTFGG P        +++ + ++ +
Sbjct: 252 PDIMSMSKAIGGGFPMGAIAAHNGI--NFGRGQHASTFGGGPXXXXXXXXSVKVIREEKL 309

Query: 305 LENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCT 364
           LE + +MG YF  +L  +  +   V EVR                 V    EQG+L+NCT
Sbjct: 310 LERSKEMGAYFMKKLAGMVRDD--VVEVRGKGLMIGVEIKYPCGKFVDFAREQGVLVNCT 367

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRA 392
           + +VLR +PPL+ITK++ID  V +L++A
Sbjct: 368 SDSVLRLVPPLVITKEQIDTVVDVLEQA 395


>ASTC_YERE8 RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;
          Length = 414

 Score =  304 bits (778), Expect = 1e-84
 Identities = 159/385 (41%), Positives = 222/385 (57%), Gaps = 10/385 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++++ TY      +V+G+GA +WD  G+ Y+DF  GIAVN LGH HP V  A+ +Q   +
Sbjct: 14  EWIVPTYAPADFIVVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADKV 73

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP----- 126
            H  N Y  EP ++LAK L++ + A+K FFCNSGAEANE A+KLARKYA  +        
Sbjct: 74  WHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQQ 133

Query: 127 -DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            +K +I+   N+FHGRTL TV+A GQ KY +   PLP G ++  FNDL + +  I   TC
Sbjct: 134 GEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAEALITDQTC 193

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGGV+PA   +L G++ LC+    +LIFDEVQ G+GRTG+   Y HYGV P
Sbjct: 194 AVIVEPIQGEGGVLPADSEFLHGLRALCDRHNAVLIFDEVQTGVGRTGELYAYMHYGVTP 253

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++T AKALGGGFPI AML   + A A   G H +T+GGNPLA   +   +  +    VL
Sbjct: 254 DVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPAVL 313

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
               +  ++F   L  + A   +  E+R                  KD            
Sbjct: 314 SGVKERHQWFLEGLADINARYKVFAEIRGRGLLIGCVLNSDYAGKSKDXXXXXXXXXXXX 373

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAV 386
                +V+RF P LII++ +I + +
Sbjct: 374 XXXXPDVVRFAPSLIISQHDIKEGL 398


>ASTC_CAUCR RecName: Full=Succinylornithine transaminase;       
           EC=2.6.1.81;AltName: Full=Succinylornithine
           aminotransferase;AltName: Full=Carbon starvation protein
           C;
          Length = 392

 Score =  303 bits (777), Expect = 1e-84
 Identities = 156/366 (42%), Positives = 210/366 (57%), Gaps = 1/366 (0%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +MNTY R  + +V+G+G W++D DGR YLD  +G+AVN LGH  P + +A+  Q   L H
Sbjct: 4   LMNTYARANIDIVRGEGCWLYDQDGRDYLDLAAGVAVNTLGHGDPRLVQALKTQADILWH 63

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN+Y +  Q  LA  L + + AD+ FF NSGAEA E AIK AR++      P++Y ++T
Sbjct: 64  ASNLYRLPAQEALATKLTDATFADRVFFANSGAEAVEAAIKTARRWQGAKGRPERYRVLT 123

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             N+FHGRTLAT++AT Q K + G  PL   F   PFND+E     I P T A+++EP+Q
Sbjct: 124 FGNAFHGRTLATISATDQMKVREGFTPLYDAFDTTPFNDIEGAARAITPQTAAILVEPIQ 183

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+ PA   +L G++ LC++  LLLI DEVQ G+GRTG    ++ YGV PDII +AK 
Sbjct: 184 GEGGLTPATPGFLAGLRALCDQHDLLLILDEVQTGIGRTGHLFAHELYGVRPDIIAVAKG 243

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           LGGGFPIGA LA E  A    PG H ST+GGNP                G LE   +   
Sbjct: 244 LGGGFPIGACLATEDAASGMTPGSHGSTYGGNPXXXXXXXXXXXXXXXPGFLETVRERAA 303

Query: 314 YFKAELTK-LAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
              A L + L     L    +              +D+VAH  + G++      +V+R L
Sbjct: 304 LVDALLERLLRRHSDLFVRAQGHGLMRGLQVRASARDVVAHLRDFGVMTVAAGADVVRLL 363

Query: 373 PPLIIT 378
           PPL I+
Sbjct: 364 PPLTIS 369


>ARGD_AGRT5 RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 399

 Score =  303 bits (776), Expect = 2e-84
 Identities = 158/369 (42%), Positives = 216/369 (58%), Gaps = 1/369 (0%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           + +T+ R P+   +G+G W++   G +YLDF +G+AVN LGHAHP + EA+  Q + + H
Sbjct: 8   LFDTFARAPLRFERGEGVWLFTESGERYLDFAAGVAVNSLGHAHPHLVEAIKTQAEKVWH 67

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN+Y +  Q KLAK L E + ADK FF NSGAEA E AIK AR+Y      P+K+ IIT
Sbjct: 68  VSNLYEVPGQEKLAKRLTEATFADKVFFTNSGAEALECAIKTARRYHYSKGHPEKFRIIT 127

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
              +FHGRTLAT+ A GQ KY  G  P  +GF  VPF D++ALK             P+Q
Sbjct: 128 FEGAFHGRTLATIAAGGQQKYLEGFGPKVEGFDQVPFGDVDALKXXXXXXXXXXXXXPIQ 187

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+   A+ +L+ ++ LC+E  LLLIFDEVQ G+GRTGKF  Y+  GV PDI+ +AK 
Sbjct: 188 GEGGIRAPAKEFLQLLRSLCDEHDLLLIFDEVQTGVGRTGKFFAYEQTGVAPDIMAVAKG 247

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           +GGGFP+GA LA    A     G H +T+GGNPLA     A ++ +L  G LE    +  
Sbjct: 248 IGGGFPLGACLATADAASGMTAGVHGTTYGGNPLAMAVGNAVLDVVLADGFLEKVRDVAL 307

Query: 314 YFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
            F+  L  L    P +++E+R               +++     + LL      NV+R L
Sbjct: 308 VFRQGLASLKDRYPDVIEEIRGEGLLLGIKARVPSGELLQAMRAEHLLGVPAGDNVIRLL 367

Query: 373 PPLIITKDE 381
           PPL+ T +E
Sbjct: 368 PPLVTTAEE 376


>ARGD_SHEON RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 405

 Score =  300 bits (767), Expect = 2e-83
 Identities = 154/372 (41%), Positives = 222/372 (59%), Gaps = 4/372 (1%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVK 85
           V+G+G+ VWD +G +++DF  GIAVNCLGH HP +  A+  Q + L H SN+   EP ++
Sbjct: 28  VRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALE 87

Query: 86  LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLAT 145
           LA  LV ++ A++ +F NSGAEANE A+KLAR+YA +  G +K EII    +FHGRT  T
Sbjct: 88  LATKLVNSTFAERVYFANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFT 147

Query: 146 VTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAY 205
           V+  GQ  Y  G  P PQ   ++PFND+ AL+  +   TCA+MLEP+QGEGG+I A  A+
Sbjct: 148 VSVGGQAAYSDGFGPKPQSITHLPFNDVAALEAAVSDKTCAIMLEPLQGEGGIIDADPAF 207

Query: 206 LEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           L+ V++L  +   L+IFDEVQ G+GRTG+   Y    + PDI+T AKALGGGFPI AML 
Sbjct: 208 LKAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTDIVPDILTTAKALGGGFPIAAMLT 267

Query: 266 KEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
             ++A+  + G H ST+GGNPLA     A ++ +    VL       +  +  L K+  +
Sbjct: 268 TTEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLNGVKHREQLLRDGLNKINEK 327

Query: 326 VPLVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDE 381
             +  EVR                  +D +   + +GL+      NV+RF P L+I + +
Sbjct: 328 YHVFSEVRGKGLLLGAVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPSLVIPEAD 387

Query: 382 IDQAVQILKRAM 393
           I + +   +RA+
Sbjct: 388 IAEGLARFERAV 399


>ARGD_SYNPX RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 420

 Score =  299 bits (766), Expect = 2e-83
 Identities = 161/387 (41%), Positives = 220/387 (56%), Gaps = 12/387 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           VMNTY R P+ LV+G+G WVWD  GR++LD V+GIA + LGH+                H
Sbjct: 27  VMNTYNRFPLTLVRGRGCWVWDDQGRRHLDAVAGIATDTLGHSDXXXXXXXXXXXXXXQH 86

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN+Y I  Q  LA  LV++SCAD  FFCNSGAEANE AIKLARK+     G D+  I+T
Sbjct: 87  VSNLYRIPEQDALATWLVQHSCADSVFFCNSGAEANEAAIKLARKHGHLKRGIDRPRILT 146

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAV 187
           A+ SFHGRTLA V+ATGQ +Y +G +P+ +GF Y P+ND+ A ++ +      GP   AV
Sbjct: 147 ASASFHGRTLAAVSATGQPRYHQGFEPMVEGFDYFPYNDIHAFESLLERHEANGPAVAAV 206

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+QGEGGV P    + + ++ LC E+ +LLI DEVQ G+GR+G+  GY+  G+EPD 
Sbjct: 207 LLEPLQGEGGVHPGDAGFFQRLRHLCSERNILLILDEVQVGMGRSGRLWGYEQLGIEPDA 266

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            T                  + A  F+PGDHASTFGGNP A TA L   + + ++G+L N
Sbjct: 267 FTXXXXXXXXXXXXXXXVNAK-ADVFEPGDHASTFGGNPFACTAGLTVAQEIQRRGLLRN 325

Query: 308 AWQMGEYFKAELTKLAAEVP-LVKEVR----XXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
             +             A  P L++ VR                    +    +EQ LL+ 
Sbjct: 326 VEERXXXXXXXXXXXVARYPQLLQGVRGWGLLQGLVLHQDCGVTAPQLAKAAIEQRLLLV 385

Query: 363 CTNGNVLRFLPPLIITKDEIDQAVQIL 389
                VLR +PPL+I+ +E+ Q ++ L
Sbjct: 386 AAGATVLRMVPPLVISANEVRQLLRRL 412


>ARGD_RHIME RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 399

 Score =  298 bits (764), Expect = 4e-83
 Identities = 156/366 (42%), Positives = 221/366 (60%), Gaps = 5/366 (1%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           +TY R P+   +G+G W+   DG +YLDF +G+AVN LGHAHP + EA+  Q   + H S
Sbjct: 9   DTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQADKVWHLS 68

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKY--AKQHLGPDKYEIIT 133
           N+Y I  Q  LA+ L + + AD+ FF NSGAEA E AIK AR+Y  AK H+  +K+ +IT
Sbjct: 69  NLYEIAGQESLARRLTQVTFADRVFFTNSGAEALECAIKTARRYHFAKGHV--EKFHVIT 126

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
              +FHGRTLAT+ A GQ KY  G  P   GF  VPF D+ A+KN I   T A+++EP+Q
Sbjct: 127 FEGAFHGRTLATIAAGGQQKYIEGFGPKAPGFYQVPFGDIGAVKNAINEETAAILVEPIQ 186

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+  A++ +++G+++LC+E GLLLI DEVQ G+GRTGK   ++  G++PDI+ +AK 
Sbjct: 187 GEGGIRTASKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEWAGIKPDIMAVAKG 246

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           +GGGFP+G                H ST+GGNPLA     A ++ +L +G L+   ++  
Sbjct: 247 IGGGFPLGXXXXXXXXXXXXXXXXHGSTYGGNPLAMAVGNAVLDVVLAEGFLDQVREVAL 306

Query: 314 YFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
            F+  L  L    P +++E+R               D++     + LL+     NVLR L
Sbjct: 307 VFRQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPSADLLKAIRAEKLLVVPAGENVLRLL 366

Query: 373 PPLIIT 378
           PPLI T
Sbjct: 367 PPLITT 372


>ARGD2_BRAJA RecName: Full=Acetylornithine aminotransferase 2;      
             Short=ACOAT 2;         EC=2.6.1.11;
          Length = 398

 Score =  298 bits (763), Expect = 5e-83
 Identities = 169/376 (44%), Positives = 236/376 (62%), Gaps = 2/376 (0%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +M+   R     V+G G+++WD   ++YLDFV G AVNCLGH+   +A+A+  Q K LL 
Sbjct: 11  LMDITARPKAVFVRGAGSYLWDDSRKRYLDFVQGWAVNCLGHSPSAIADALAAQAKRLLT 70

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            S  ++ EP +KLA+ LV NS  D+ FF NSGAEANEGAIKLARKY   H G   +EII+
Sbjct: 71  PSPAFYNEPSLKLAQALVANSAFDQVFFANSGAEANEGAIKLARKYGSLHKG-GAFEIIS 129

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
               FHGRTLAT++A+G+  ++   +P   GF     ND+ +++  I  +T AVMLEP+Q
Sbjct: 130 FEGGFHGRTLATMSASGKKAFEPLFEPKVAGFKKAKLNDIASVEKLINDNTVAVMLEPIQ 189

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GV PA   +L+ ++ L +  GLLLI DE+Q G+GRTGK   Y+H G+ PDI+TL K 
Sbjct: 190 GESGVWPATDQFLQELRALTKAHGLLLILDEIQTGMGRTGKLFHYEHTGIAPDIMTLGKG 249

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           +GGG P+ A+LA E+ A  F+ GD   TF GNP+   A LA ++ + +   L++  + G 
Sbjct: 250 IGGGVPLAALLATERAA-CFEHGDQGGTFNGNPIMCAAGLAVLDEVGKPDFLKSVTETGL 308

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
             ++EL K++A                         IVA   E G+L+N    + LRF+P
Sbjct: 309 LLESELQKVSAXXXXXXXXXXXXXXXXXXXXPIAPGIVAQAFEAGVLLNAPQVDTLRFMP 368

Query: 374 PLIITKDEIDQAVQIL 389
            L +T+ EI + +  L
Sbjct: 369 ALNVTRAEIAEMIDCL 384


>ARGD_RALSO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 399

 Score =  296 bits (759), Expect = 2e-82
 Identities = 172/385 (44%), Positives = 237/385 (61%), Gaps = 7/385 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q +M    R  +   +G+G+W+ D +G++YLDFV G AVNCLGH++  + EA+  Q K L
Sbjct: 9   QSLMYITNRPEIVFTEGKGSWLTDHNGKRYLDFVQGWAVNCLGHSNDGMIEALNAQAKKL 68

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQH---LGPDK 128
           ++ S  ++ EP  KLA LL  +SC DK FF NSGAEANEGAIKLARK+ K+H    G ++
Sbjct: 69  INPSPAFYNEPMAKLAGLLSAHSCFDKVFFANSGAEANEGAIKLARKWGKKHKSGAGKNR 128

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVM 188
           +EIIT  +SFHGRTLAT++A+G+  +     P   GF     ND+ +++  I   T  VM
Sbjct: 129 FEIITFDHSFHGRTLATMSASGKAGWDTIFAPQVPGFPKAILNDIASVEALITDETVGVM 188

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           LEPVQGEGGV+PA Q +++ ++ L  +  LLLI DEVQ G GR G    YQ   +EPDI+
Sbjct: 189 LEPVQGEGGVLPATQEFMQQLRALTRKHKLLLIVDEVQAGCGRCGTLFAYQLSNIEPDIM 248

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENA 308
           TL K +GGG P+ A+L  ++VA +F+ GD   T+ GNPL      + +E LL  G L   
Sbjct: 249 TLGKGIGGGVPLSALLCTDEVA-SFEAGDQGGTYNGNPLMTAVGCSVIEQLLAPGFLAGV 307

Query: 309 WQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQ---GLLINCTN 365
            + G Y +A+L +L+                          +V    E    GLL+N   
Sbjct: 308 QERGAYLRAQLLELSEAFXXXXXXXXXXXXXXXXXKDIGGQLVEAAREMNPTGLLLNAPR 367

Query: 366 GNVLRFLPPLIITKDEIDQAVQILK 390
            N+LRF+P L +T DEID  + +L+
Sbjct: 368 PNILRFMPALNVTTDEIDTMIGMLR 392


>ARGD_PROMP RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 415

 Score =  295 bits (755), Expect = 5e-82
 Identities = 153/381 (40%), Positives = 231/381 (60%), Gaps = 13/381 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +MNTY R  ++  KG G W+WD  G++YLD V+GIA   LGH++  + + +  Q+K + H
Sbjct: 24  LMNTYTRFDISFKKGNGCWLWDEKGKKYLDAVAGIATCSLGHSNRILRKKLSAQLKKVQH 83

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ-HLGPDKYEII 132
            SN+Y IE Q +L+K L + SCA+  FFCNSGAEANE AIKL +KY    H G + + I+
Sbjct: 84  ISNLYKIEEQEELSKYLTKQSCAESVFFCNSGAEANESAIKLIKKYGNTVHKGKESF-IL 142

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCA 186
            A +SFHGRTLAT++ATGQ KYQ+G +P+ +GF +  +ND+ ++K               
Sbjct: 143 AAESSFHGRTLATLSATGQPKYQKGFEPMVKGFKFFKYNDIASVKKLFEELKANNQKASG 202

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           +++EP+QGEGGVIP  + + + ++++C +   LLI DEVQ G+GRTGK  GY++  +EPD
Sbjct: 203 ILVEPIQGEGGVIPGDKKFFKELREICNKYNSLLILDEVQSGVGRTGKMWGYENLEIEPD 262

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLE 306
             T                +++ A  F PGDHASTFGGNP A  A++  +E + ++ +L+
Sbjct: 263 GFTXXXXXXXXXXXXXXXVQKK-ANIFTPGDHASTFGGNPFACRAAITVLEEIKRRKILK 321

Query: 307 NAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKD---IVAHCLEQGLLIN 362
           N  + G       TK++A+ P ++  +R               D   I     ++GLL+ 
Sbjct: 322 NVLERGNQLNEGFTKISAKFPKIISGIRGLGLIQGLVINDSYTDAKTITLKAFDKGLLLV 381

Query: 363 CTNGNVLRFLPPLIITKDEID 383
              GNV+RF+PPLII+++EI+
Sbjct: 382 PAGGNVVRFVPPLIISRNEIN 402


>ARGD_WOLSU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 393

 Score =  293 bits (750), Expect = 2e-81
 Identities = 161/394 (40%), Positives = 242/394 (61%), Gaps = 15/394 (3%)

Query: 8   AMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQ 67
           A+ ++YV+++YGR  +   +G+ A +WD++G+ Y+DF SGIAV  +GH +  +A A+C Q
Sbjct: 4   ALDKEYVLHSYGRNYVQFTQGKNATLWDSEGKDYIDFASGIAVCSVGHGNERLAGAICDQ 63

Query: 68  VKTLLHCSNIYWIEPQVKLAKLLVENSCAD-KAFFCNSGAEANEGAIKLARKYAKQHLGP 126
            K L+H SN+Y+IEPQ +LA+ LV+ S  D + FF NSGAEANEGAIK+ARK+ + H G 
Sbjct: 64  AKKLIHTSNLYYIEPQARLAEKLVKLSGYDMRVFFANSGAEANEGAIKIARKFGESHEGE 123

Query: 127 DK-YEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
            K Y+IIT  +SFHGRT+  + ATGQ K      P P GF Y    +L+ +   +   TC
Sbjct: 124 VKRYKIITLESSFHGRTITALKATGQEKMHHYFGPYPDGFVYA--KNLDHVFKLVDEKTC 181

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV+LE VQGEGG+ P  +  ++ +++  +E+G+LL+ DEVQ G+ R+G+    Q YG+ P
Sbjct: 182 AVLLELVQGEGGIEPQDREGIKKLERFLKERGVLLMVDEVQTGIYRSGELFASQAYGIVP 241

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS---LATMETLLQK 302
           D+IT+AK L GG PIGA++    +   F PGDH STFGGN L+  A    L+ +E+L Q+
Sbjct: 242 DVITVAKGLAGGVPIGAVMT--TLKDIFAPGDHGSTFGGNFLSTRAGLEVLSILESLYQE 299

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVR---XXXXXXXXXXXXXXKDIVAHCLEQGL 359
           G L+ +    + F AEL  L  E P + E                   K ++    ++ +
Sbjct: 300 GTLQKSI---DRFSAELRALCVEFPSLFECEVGLGLMRGIRAKSAEIQKSVIDEAFKKRV 356

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           L+  +  N +RFLPPL +++ E+ +    L+ A+
Sbjct: 357 LVLRSGRNTVRFLPPLTLSEREMQEGFSRLREAL 390


>ARGD_COREF RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 402

 Score =  293 bits (749), Expect = 2e-81
 Identities = 162/390 (41%), Positives = 222/390 (56%), Gaps = 22/390 (5%)

Query: 4   QEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           ++ L    Q ++NTYG  P+ LV G+G+ V DADG  Y+D ++GIAVN LGHAHP + EA
Sbjct: 8   EDTLTSWPQVLLNTYGTPPVELVTGKGSTVTDADGNVYIDLLAGIAVNALGHAHPAIIEA 67

Query: 64  VCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKA--------FFCNSGAEANEGAIKL 115
           V  Q+  L H SN++   P V++A  LV+    D A        FFCNSGAEANE A KL
Sbjct: 68  VTTQLSQLGHVSNLFATRPVVEVAAELVQRFALDDATIASQTQVFFCNSGAEANEAAFKL 127

Query: 116 ARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEA 175
           AR   +       + I+ ATN FHGRT+ ++  TGQ   +    PLP G  + P+ DL+ 
Sbjct: 128 ARLTGR-------HRILAATNGFHGRTMGSLALTGQPDKRIPFAPLPSGVEFYPYGDLDY 180

Query: 176 LKNTIGPH---TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
           L   +      T A++LEP+QGE GVIPA + +L GV++LC++ GLL I DEVQ G+GRT
Sbjct: 181 LTTLVESDPTDTAAIILEPIQGETGVIPAPEGFLTGVRELCDKHGLLFIVDEVQTGIGRT 240

Query: 233 GKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           G F  +QH GV PD++T+AK LGGG PIGA LA  + A+ F PG H +TFGGNP++    
Sbjct: 241 GDFFAHQHEGVTPDVVTMAKGLGGGLPIGACLATGEAAKLFGPGKHGTTFGGNPVSXXXX 300

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
              +  + ++   + A + GE F  +L                            K  V 
Sbjct: 301 XXVLSVIDEEFCADVA-RKGELFAEQLXXXXXXXXXXXXX---LMLGVVLDQPVAKQAVT 356

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEI 382
              + GL++N    N++R  PPL+IT DEI
Sbjct: 357 AGFKHGLILNAPADNIIRLTPPLVITDDEI 386


>ARGD_CHLTE RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 400

 Score =  292 bits (748), Expect = 3e-81
 Identities = 144/390 (36%), Positives = 229/390 (58%), Gaps = 1/390 (0%)

Query: 1   MNNQEI-LAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPE 59
           MN   I L   +Q   + Y RLP+ +  G+G++++ A G +YLD ++G+ VN +G+    
Sbjct: 1   MNTPAINLETEKQLFFHNYARLPLDIASGKGSFLYTASGERYLDMIAGVGVNAIGYGDKR 60

Query: 60  VAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKY 119
           + +A+ +Q    +H SN++  +PQ  LA  L+E S   K FFCNSG EA E AIKLAR++
Sbjct: 61  LEQAITEQASKYIHVSNLFMQKPQFDLAAKLLEISRMSKVFFCNSGTEAIEAAIKLARRF 120

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
           A ++   DK ++++ TN FHGRT   ++ T + KY  G +PL      + FND+E L+  
Sbjct: 121 AARNGDTDKTQVLSLTNCFHGRTYGALSLTAKPKYVDGFEPLVPETGMIDFNDVEDLERK 180

Query: 180 IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
           +   T AV +E VQGEGG+   ++A++  +K+L +E   L++ DE+Q G GRTG F  Y 
Sbjct: 181 VSNRTAAVFVEFVQGEGGIHKVSEAFIAKLKELAKEHDFLIVADEIQAGCGRTGAFFSYM 240

Query: 240 HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
            + ++PD++ +AK         A++  E+VA+ F PG H +TFGGNP+A  A LA +E +
Sbjct: 241 PFDIQPDLVCVAKXXXXXXXXXAIIGSEKVAEVFTPGSHGTTFGGNPVACAAGLAMIEAI 300

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGL 359
           L  G+++NA ++G   +    K+A +   + E+R              K  V   L++G+
Sbjct: 301 LADGLMQNALEVGSMMRTAFEKMAEKHAQILEIRQYGLMIGVTVHREAKYYVEEALKRGV 360

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAVQIL 389
           L+N T+ NV+R LPPL I+K+E    +  L
Sbjct: 361 LVNATSNNVIRLLPPLSISKEEAQLCLDTL 390


>ARGD_LISIN RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 384

 Score =  292 bits (747), Expect = 4e-81
 Identities = 167/383 (43%), Positives = 216/383 (56%), Gaps = 9/383 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           ++V  TY R P+ +VKG G  V DA G+ YLDF SGIAV  LGH    V EA+  Q+  +
Sbjct: 2   KHVFPTYNRFPVDIVKGNGTVVKDATGKTYLDFTSGIAVCNLGHCPENVTEAIQSQLANI 61

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADK-AFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
            H SN+Y    Q  +A+L+ + +  DK  FFCNSG EANE A+KLARKY        K +
Sbjct: 62  WHTSNLYECALQDSVAELITDGT--DKLVFFCNSGTEANEAALKLARKYT------GKEK 113

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           IIT   SFHGRT  +++ATGQ K  +G   L  GF YVP+ND+E+ K  +  +T AVMLE
Sbjct: 114 IITFEKSFHGRTFGSMSATGQAKIHQGFGRLVPGFTYVPYNDIESFKTELDENTAAVMLE 173

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
            +QGEGGVIP   A+L  V+ LC++ G LLI DEVQ            Q   ++PDI TL
Sbjct: 174 VIQGEGGVIPGNAAWLMEVQMLCKKAGALLIIDEVQXXXXXXXXXXXXQQTFLDPDIFTL 233

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AK LG G PIGAM+ KE ++ AF PG H STFGGN            T+ Q G LE    
Sbjct: 234 AKGLGNGLPIGAMVGKEHLSSAFGPGSHGSTFGGNXXXXXXXXXXXXTMKQTGFLEEVNA 293

Query: 311 MGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLR 370
              YF+  L +   ++  V  +R                +V    ++GLLI     N+LR
Sbjct: 294 KAAYFRNLLEEHFEQLENVVAIRGEGFLIGIELGSSAAPVVTELRDKGLLILTAGPNILR 353

Query: 371 FLPPLIITKDEIDQAVQILKRAM 393
            LPPL ++  EIDQA+ ILK  +
Sbjct: 354 ILPPLTVSYAEIDQAISILKSVL 376


>ARGD_XANCP RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 408

 Score =  291 bits (744), Expect = 9e-81
 Identities = 158/324 (48%), Positives = 201/324 (62%), Gaps = 3/324 (0%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y +  Y    + L +GQG+ VWD  GR+YLD  SGIAV+ LGH  P++  A+ +Q   L 
Sbjct: 14  YYLPVYRPRQVVLERGQGSRVWDDQGREYLDLSSGIAVSGLGHNDPDLMAALTEQAGKLW 73

Query: 73  HCSNIYWIEPQVKLAKLLVENS-CADKAFFCNSGAEANEGAIKLARKYAKQHLGP-DKYE 130
           H SN+++  P +KLA+ LV  S  A K F CNSG EANE AIKL RK+A     P DK  
Sbjct: 74  HTSNVFFSAPPLKLAEELVTASRFAQKVFLCNSGTEANEAAIKLVRKWASSQGRPADKRV 133

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGP-HTCAVML 189
           I+T   SFHGRTLA+VTAT Q KYQ G +PLP GF YV FND+ AL++ +      AVML
Sbjct: 134 IVTFRGSFHGRTLASVTATAQPKYQEGYEPLPGGFRYVDFNDVPALESAMASGDVAAVML 193

Query: 190 EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIIT 249
           EP+QGEGGV+PAA  +L  V+ LC++   LL+ DE+QCG+GRTG    +    V PDI+T
Sbjct: 194 EPIQGEGGVMPAAPGFLARVRALCDQHDALLVLDEIQCGMGRTGSLFAHWQEQVTPDIVT 253

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
           LAKALGGGFPIGAMLA  +VA+  Q G H +TFGGNP                 + EN  
Sbjct: 254 LAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPXXXXXXXXXXXXXXSPQIAENVA 313

Query: 310 QMGEYFKAELTKLAAEVPLVKEVR 333
           +     +A L  L AE  +  ++R
Sbjct: 314 RQSAALRAGLEALNAEFGVFAQIR 337


>ARGD2_PSESM RecName: Full=Acetylornithine aminotransferase 2;      
             Short=ACOAT 2;         EC=2.6.1.11;
          Length = 400

 Score =  291 bits (744), Expect = 9e-81
 Identities = 159/389 (40%), Positives = 227/389 (58%), Gaps = 15/389 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +M+TY  L ++  +G G  +WD  GR+YLD V+G+AV  +GH+HP + +A+  Q   LLH
Sbjct: 6   LMSTYQPLALSFTRGLGTRLWDQSGREYLDAVAGVAVTNVGHSHPMLVDAIRDQAGLLLH 65

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLAR-----KYAKQHLGPDK 128
            SN+Y I+ Q +LA+ L   +  D+ FF NSGAEANE A+KLAR     KY +Q L    
Sbjct: 66  TSNLYSIDWQQRLAQKLTRLAGMDRVFFNNSGAEANETALKLARLHGWHKYIEQPL---- 121

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKN---TIGPHTC 185
             ++   N+FHGRTL T+ A+     +     LP  +  VPF DL A      T G    
Sbjct: 122 --VVVMENAFHGRTLGTLAASDGPAVRLSYSDLPGDYIKVPFGDLLAFDKVCVTHGHRIA 179

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EP+QGEGG   A   YL+ +++ C  +  LL+ DE+Q G+GRTGK+  +QH G+ P
Sbjct: 180 AVLVEPIQGEGGAQVAPAGYLKALRERCTRRDWLLMLDEIQTGMGRTGKWFAFQHEGIVP 239

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVL 305
           D++TLAK LG G PIGA LA+ + A+ F PG H STFGGNPLA       ++ + Q+ ++
Sbjct: 240 DVMTLAKGLGNGVPIGACLARGKAAELFTPGSHGSTFGGNPLACRVGCTVIDIIEQQALV 299

Query: 306 ENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQ-GLLINCT 364
           ENA   G++    L ++    P V +VR               ++     EQ GLLIN T
Sbjct: 300 ENAGVRGQHLLGRLQEVLGGHPQVMQVRGRGLMIGIELREAIPELTRIAAEQHGLLINVT 359

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            G V+R LPPL++   E++Q VQ L  ++
Sbjct: 360 RGKVIRLLPPLVLEAAEVEQIVQGLAASL 388


>ARGD_BUCAI RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 408

 Score =  288 bits (738), Expect = 4e-80
 Identities = 151/384 (39%), Positives = 218/384 (56%), Gaps = 4/384 (1%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           ++  Y  +P   +KG+G+ +WD  G++Y+DF  GIAV  LGH HP + + +  Q K L H
Sbjct: 17  ILPIYNPIPFIPIKGKGSRIWDQKGKEYIDFSGGIAVTSLGHCHPILNKTLKNQSKMLWH 76

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SNI+  EP                 FF NSGAEANE A KLAR Y+ +     K +II+
Sbjct: 77  LSNIFTNEPXXXXXXXXXXXXXXXXIFFANSGAEANEAAFKLARYYSSKIYNFKKNKIIS 136

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             NSFHGRT  TV+  GQ+KY     P P G  +  FND+ ++KN I   TCAV++E +Q
Sbjct: 137 FYNSFHGRTFFTVSVGGQSKYSNNFGPKPAGIVHASFNDINSVKNLIDHDTCAVVVELIQ 196

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGGVIPA   +++ +K+LC++  +LLIFDE+Q G+GRTGK   Y++Y + PDI+T+AK+
Sbjct: 197 GEGGVIPANLTFVQALKELCKQYNVLLIFDEIQTGIGRTGKLFYYEYYAITPDILTIAKS 256

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           LGGGFPI AML   +VA    PG H +T+GGNPLA   + + ++ +  K VL    +  +
Sbjct: 257 LGGGFPISAMLTTNEVASVIAPGIHGTTYGGNPLACAVAESVIDIINTKKVLSGVEKKSK 316

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVAHCLEQGLLINCTNGNVL 369
              +EL  +     L  E+R                    I+   L +G++      NV+
Sbjct: 317 KIISELNIINKRFKLFTEIRGRGLLIGIVLKPNVSRNIHKILNFSLSEGVIFLTAGNNVI 376

Query: 370 RFLPPLIITKDEIDQAVQILKRAM 393
           R  P LII + +I + ++   RA+
Sbjct: 377 RLAPSLIIKELDIIEGMKRFYRAL 400


>ARGD_XYLFA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 411

 Score =  287 bits (734), Expect = 1e-79
 Identities = 165/399 (41%), Positives = 229/399 (57%), Gaps = 9/399 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++ +L++ + Y +  Y    + LV+GQG+ VWD  GR YLD  +GIAV CLGH  P++  
Sbjct: 5   SESVLSLSRYY-LPVYRPCQVVLVRGQGSRVWDEQGRDYLDLAAGIAVCCLGHCDPDLVA 63

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENS-CADKAFFCNSGAEANEGAIKLARKYAK 121
           A+ +Q   L H SN+++ EP ++LA+ LV+ S  A++ F C+SG EANE AIKL RK+A 
Sbjct: 64  ALVEQAGRLWHTSNVFYSEPSLRLAQELVDVSRFAERVFLCSSGTEANEAAIKLVRKWAA 123

Query: 122 -QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
            Q   P+   I+T   SFHGRTLA VTAT Q KYQ G +PLP GF YV FN +EAL+   
Sbjct: 124 AQGRLPEHRTIVTFHGSFHGRTLAAVTATAQPKYQEGYEPLPGGFRYVDFNHIEALEXXX 183

Query: 181 GPHTCAVM-LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                    LEP+QGEGGV+P    YL  V+ LC+  G LL+ DE+QCG+GRTG    Y 
Sbjct: 184 XXXXXXXXXLEPIQGEGGVMPVVSGYLAQVRALCDRYGALLVLDEIQCGMGRTGTLFAYW 243

Query: 240 HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
              V PDI+TLAK LGGGFPIGAMLA  +VA+  Q G H +TFGGNP+            
Sbjct: 244 QEEVVPDIVTLAKGLGGGFPIGAMLAGPKVAEVMQFGAHGTTFGGNPMXXXXXXXXXXXX 303

Query: 300 LQKGVLENAWQMGEYFKAELTKLA-AEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHC 354
               +  N  +     +A L +++ A   +  +VR                    I+   
Sbjct: 304 XSVEIAANVQRQSVALRAGLEEISEAFGGVFTQVRGRGLMLGAVLAPLYAGQASAILEVA 363

Query: 355 LEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +E G+L+     +VLRF+P L ++ +E+   +  L+ A+
Sbjct: 364 VEHGVLLLQAGPDVLRFVPALNVSDEELADGLVRLRAAL 402


>ARGD_BACAN RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 386

 Score =  286 bits (732), Expect = 2e-79
 Identities = 149/381 (39%), Positives = 217/381 (56%), Gaps = 6/381 (1%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           ++  TYGR  +  VKG G  V D +G+QYLDF SGI V  LGH HP V +AV +Q+  + 
Sbjct: 4   HLFQTYGRRTVEFVKGNGTKVIDNNGKQYLDFTSGIGVCNLGHCHPTVMKAVQEQLNDIW 63

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H SN++    Q ++A LL EN   D  FFCNSGAEANE A+KLARK+  + L      ++
Sbjct: 64  HISNLFTNSLQEEVASLLTENIALDYVFFCNSGAEANEAALKLARKHTGKSL------VV 117

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
           T   SFHGRT  T++ATGQ K + G  PL   F + PFND++ALK               
Sbjct: 118 TCEQSFHGRTFGTMSATGQNKVKEGFGPLLPSFLHTPFNDIKALKXXXXXXXXXXXXXXX 177

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
                 IPA  ++L+ ++ LC++ G L I DEVQ G+GRTG    Y+  G++P I+T AK
Sbjct: 178 XXXXXXIPADLSFLKEIETLCKKFGSLFIIDEVQTGIGRTGTLFAYEQMGIDPHIVTTAK 237

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           ALG G P+GAM+ ++++  +F  G H STFGGN +A  A+   ++   +   L+   + G
Sbjct: 238 ALGNGIPVGAMIGRKELGTSFTAGSHGSTFGGNYVAMAAAKEVLQVSKRLSFLKEVQEKG 297

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
           EY   +L +    V  ++ +R                 +    ++GLL+     NV+R L
Sbjct: 298 EYVLQKLQEELQHVECIQNIRGKGLMVGIECTHEVASFIEQLEKEGLLVLQAGPNVIRLL 357

Query: 373 PPLIITKDEIDQAVQILKRAM 393
           PPLI+T +E++QAV ++K+ +
Sbjct: 358 PPLIVTNEELEQAVYMIKKVV 378


>ARGD_XYLFT RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 411

 Score =  286 bits (731), Expect = 3e-79
 Identities = 165/399 (41%), Positives = 228/399 (57%), Gaps = 9/399 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++ +L++ + Y +  Y    + LV+GQG+ VWD  GR YLD  +GIAV CLGH  P++  
Sbjct: 5   SESVLSLSRYY-LPVYRPCQVVLVRGQGSRVWDEQGRDYLDLAAGIAVCCLGHCDPDLVA 63

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENS-CADKAFFCNSGAEANEGAIKLARKYAK 121
           A+ +Q   L H SN+++ EP ++LA+ LV+ S  A++ F C+SG EANE AIKL RK+A 
Sbjct: 64  ALVEQAGRLWHTSNVFYSEPSLRLAQELVDVSRFAERVFLCSSGTEANEAAIKLVRKWAA 123

Query: 122 -QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
            Q   P+   I+T   SFHGRTL  VTAT Q KYQ G +PLP GF YV FN +EAL+   
Sbjct: 124 AQGRLPEHRTIVTFRGSFHGRTLGAVTATAQPKYQEGYEPLPGGFRYVDFNHIEALEXXX 183

Query: 181 GPHTCAVM-LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                    LEP+QGEGGV+P A  YL  V+ LC+  G LL+ DE+QCG+GRTG    Y 
Sbjct: 184 XXXXXXXXXLEPIQGEGGVMPIAPGYLAQVRALCDRYGALLVLDEIQCGMGRTGTLFAYW 243

Query: 240 HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
              V PDI+TLAK LGGGFPIGAMLA  +VA+  Q G H +TFGGNP+            
Sbjct: 244 QEEVVPDIVTLAKGLGGGFPIGAMLAGPKVAEVMQFGAHGTTFGGNPMXXXXXXXXXXXX 303

Query: 300 LQKGVLENAWQMGEYFKAELTKLA-AEVPLVKEVR----XXXXXXXXXXXXXXKDIVAHC 354
               +  N  +     +A L +++ A   +  +VR                    I+   
Sbjct: 304 XSVEIAANVQRQSVALRAGLEEISEAFGGVFTQVRGRGLMLGAVLAPLYAGQASAILEVA 363

Query: 355 LEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            E G+L+     +VLRF+P L ++ +E+   +  L+ A+
Sbjct: 364 AEHGVLLLQAGPDVLRFVPALNVSDEELADGLVRLRAAL 402


>ARGD_DEBHA RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 466

 Score =  286 bits (731), Expect = 3e-79
 Identities = 171/403 (42%), Positives = 247/403 (61%), Gaps = 14/403 (3%)

Query: 4   QEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           Q I  + + + + TY R  + +  G+G++++D + RQYLDF +GIAV CLGH+H ++ E 
Sbjct: 51  QYINTITKPFTVTTYARPNVVMTHGKGSYLYDLENRQYLDFSAGIAVTCLGHSHSKITEI 110

Query: 64  VCKQVKTLLHCSNIYWIEPQVKLAKLLVENSC-------ADKAFFCNSGAEANEGAIKLA 116
           +  Q  TL+HCSN+Y      +LA  LV N+        A + F CNSG EANE A+K A
Sbjct: 111 ISDQAATLMHCSNLYHNLYAGELANKLVTNTINSGGMKEAQRVFLCNSGTEANEAALKFA 170

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEAL 176
           RKY K     DKYE+IT  NSFHGRT+  ++ T   KYQ+   PL  G      ND+ ++
Sbjct: 171 RKYGKS-FSDDKYEMITFKNSFHGRTMGALSVTPNEKYQKPFAPLVPGVKIAEPNDISSV 229

Query: 177 KNTIGPH-TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKF 235
           +  I    TCAV++EP+QGEGGV      +L  +K+LC +  ++LI+DE+QCGLGR+GK 
Sbjct: 230 EKLISKEKTCAVIIEPIQGEGGVNAIDAEFLVSLKKLCVDNEVVLIYDEIQCGLGRSGKL 289

Query: 236 LGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASL 293
             + +   E  PDI+T+AKALG GFPIGA++  +++ +  + GDH +T+GGNPL +    
Sbjct: 290 WAHCNLPEEAHPDILTMAKALGNGFPIGAVMVSDKIEKVLKVGDHGTTYGGNPLGSKIGS 349

Query: 294 ATMETLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXK--DI 350
             ++ +  K  L    +  E F   L+K+A + P  + EV                  D+
Sbjct: 350 YVVDQVSDKEFLLEVEEKSEKFTKGLSKIANKHPDHIGEVXXXXXXXXXXXXXXXDVGDV 409

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           VA C E GLL+     NVLR +P L I  + I++ + +L + +
Sbjct: 410 VAKCRENGLLVISAGMNVLRIVPALNIPNEAIEEGLDVLDKCI 452


>ARGD_CORGL RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 391

 Score =  286 bits (731), Expect = 3e-79
 Identities = 167/389 (42%), Positives = 232/389 (59%), Gaps = 22/389 (5%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q ++NTYG  P+ LV G+GA V D  G  Y+D ++GIAVN LGHAHP + EAV  Q+  L
Sbjct: 9   QVIINTYGTPPVELVSGKGATVTDDQGNVYIDLLAGIAVNALGHAHPAIIEAVTNQIGQL 68

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKA--------FFCNSGAEANEGAIKLARKYAKQH 123
            H SN++   P V++A+ L++    D A        FFCNSGAEANE A K+AR   +  
Sbjct: 69  GHVSNLFASRPVVEVAEELIKRFSLDDATLAAQTRVFFCNSGAEANEAAFKIARLTGRSR 128

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
                  I+ A + FHGRT+ ++  TGQ   +    P+P G  + P+ D + L+  +  +
Sbjct: 129 -------ILAAVHGFHGRTMGSLALTGQPDKREAFLPMPSGVEFYPYGDTDYLRKMVETN 181

Query: 184 ---TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A+ LEP+QGE GV+PA + +L+ V++LC+E G+L+I DEVQ G+GRTG F  +QH
Sbjct: 182 PTDVAAIFLEPIQGETGVVPAPEGFLKAVRELCDEYGILMITDEVQTGVGRTGDFFAHQH 241

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            GV PD++T+AK LGGG PIGA LA  + A+   PG H +TFGGNP+A  A+ A +  + 
Sbjct: 242 DGVVPDVVTMAKGLGGGLPIGACLATGRAAELMTPGKHGTTFGGNPVACAAAKAVLSVVD 301

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLL 360
                E A + GE FK EL  LA                        K  V    + G++
Sbjct: 302 DAFCAEVA-RKGELFK-EL--LAKXXXXXXXXXXXXXXXXXXERDVAKQAVLDGFKHGVI 357

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQIL 389
           +N    N++R  PPL+IT +EI  AV+ +
Sbjct: 358 LNAPADNIIRLTPPLVITDEEIADAVKAI 386


>ARGD_NEUCR RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 461

 Score =  285 bits (729), Expect = 5e-79
 Identities = 158/378 (41%), Positives = 218/378 (57%), Gaps = 13/378 (3%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y++ TY R P   VKG+G+++WD + R+YLDF SGIAVN LGH   E ++ + +Q + L+
Sbjct: 63  YMVTTYSRPPPVFVKGKGSYLWDLEDRKYLDFTSGIAVNSLGHCDEEFSKIIAEQAQELV 122

Query: 73  HCSNIYWIEPQVKLAKLLVENSCAD-------KAFFCNSGAEANEGAIKLARKYAKQHLG 125
           H SN+Y+      L+KLLVE++ A          F CNSG+EANE  IK ARK  K  L 
Sbjct: 123 HASNLYYNPWTGALSKLLVESTKASGGMHDASSVFVCNSGSEANEAGIKFARKVGKV-LD 181

Query: 126 PD--KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
           P   K EI+   N+FHGRT+ +++AT   KYQ    P+  GF    +ND+ A+ + +   
Sbjct: 182 PSGSKVEIVCFQNAFHGRTMGSLSATPNPKYQAPFAPMVPGFKVGTYNDIAAIPSLVTEK 241

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           TC+V++EP+QGEGGV+PA + +L  + + C E G LL +DE+QCGL RTG F  +     
Sbjct: 242 TCSVIVEPIQGEGGVMPATEEFLVALGKRCREVGALLHYDEIQCGLARTGTFWAHSSLPK 301

Query: 244 E--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQ 301
           E  PDI+T AKA+G GFPI A +  E VA   + GDH +TFGGNPLA   +   +  L  
Sbjct: 302 EAHPDILTTAKAIGNGFPIAATIVNEHVASKIKVGDHGTTFGGNPLACRLAHYIVGRLAD 361

Query: 302 KGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLL 360
           K + E      E F     KL  + P LVKEVR                ++    E+GLL
Sbjct: 362 KQLQEGVKAKSEVFLRGFEKLRNKFPSLVKEVRGKGLILGLQLSEDPTPVIKAARERGLL 421

Query: 361 INCTNGNVLRFLPPLIIT 378
           +     N LRF+P L++T
Sbjct: 422 VITAGTNTLRFVPSLLVT 439


>ARGD_BACCR RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 386

 Score =  283 bits (725), Expect = 1e-78
 Identities = 148/381 (38%), Positives = 213/381 (55%), Gaps = 6/381 (1%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           ++  TYGR  +  VKG G  V D  G++YLDF SGI V  LGH HP V + V +Q+  + 
Sbjct: 4   HLFQTYGRRTIEFVKGTGTKVIDNKGKEYLDFTSGIGVCNLGHCHPTVLKGVQEQLDDIW 63

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H SN++    Q ++A LL EN   D  FFCNSGAEANE A+KLARK+  + L      ++
Sbjct: 64  HISNLFTNSLQEEVASLLTENRALDYVFFCNSGAEANEAALKLARKHTGKSL------VV 117

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
           T   SFHGRT  T++ATGQ K + G  PL   F ++PFND++AL                
Sbjct: 118 TCQQSFHGRTFGTMSATGQDKVKEGFGPLLPSFLHIPFNDIKALXXXXXXXXXXXXXXXX 177

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
                 IP   ++L+ ++ LC + G L I DEVQ G+GRTG    Y+  G+EPDI+T+AK
Sbjct: 178 XXXXXXIPVDLSFLKEIETLCNKFGSLFIIDEVQTGIGRTGTLFAYEQVGIEPDIVTVAK 237

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           ALG G P+GAM+  +++  +F  G H STFGGN +A  A+   ++   +   L+   + G
Sbjct: 238 ALGNGIPVGAMIGGKELGTSFTAGSHGSTFGGNYIAMAAAKEVLQVSKKPSFLKEVQEKG 297

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
           EY   +L +    V  ++ +R                 +     +GLL+     NV+R L
Sbjct: 298 EYVLEKLQEELQHVECIQNIRGKGLMIGIECKHEVASFIEQLENEGLLVLQAGPNVIRLL 357

Query: 373 PPLIITKDEIDQAVQILKRAM 393
           PPLI+T +E++QAV I+K+ +
Sbjct: 358 PPLIVTNEELEQAVYIIKKVV 378


>ARGD_YARLI RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 411

 Score =  283 bits (724), Expect = 2e-78
 Identities = 154/396 (38%), Positives = 229/396 (57%), Gaps = 12/396 (3%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           +L   ++Y + TY +  + L KG+GA++WD++  +Y+DF +GIAV  LGH++PE+ + + 
Sbjct: 13  LLQTAEKYSVPTYAKPSVILTKGKGAYLWDSNDNKYIDFSAGIAVTALGHSNPEITKILA 72

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSC-------ADKAFFCNSGAEANEGAIKLARK 118
           +Q   L+HCSN++  E   +L + LVE +        A K F  NSG EANE A+K ARK
Sbjct: 73  EQSSQLMHCSNLFNNEWAPRLQESLVEETLKSGGMKGARKVFLANSGTEANEAALKFARK 132

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKN 178
                  PDK E +    +FHGRT+  ++ T   KYQ    PL  G     +ND +A  +
Sbjct: 133 VGTLS-SPDKTEFVNFEKAFHGRTMGALSVTPNPKYQAPFAPLVPGVKTGVYNDPKA-AD 190

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
            I   TC V++EPVQGEGGV  A   +L+ ++  C+E G +LIFDE+QCGLGRTG+   +
Sbjct: 191 LITEKTCGVIVEPVQGEGGVYKANDEFLQALRNKCDEVGAMLIFDEIQCGLGRTGRL--W 248

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
            H  V PDI+T+AKALG GFPIGA +  E VA     GDH +T+GGNPLA+      +  
Sbjct: 249 AHDKVHPDILTMAKALGNGFPIGATMVTEAVADKIAIGDHGTTYGGNPLASRVGHYVLSQ 308

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQ 357
           +  K VL+N  ++ +  +  + ++  E P L+ EVR                +VA   E 
Sbjct: 309 VASKEVLDNVKKVSQQIRDAVAEVQEEFPELITEVRGDGLLLGIQFSKDPSKVVAAAREN 368

Query: 358 GLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           GLL+     N +R +P L I ++ + + ++ILK+A+
Sbjct: 369 GLLVITAGTNTVRLVPALNIDQEAVTEGLEILKKAI 404


>ARGD_BUCAP RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase;         Short=ACOAT;       
           Short=Succinyldiaminopimelate transferase;
          Length = 404

 Score =  281 bits (719), Expect = 7e-78
 Identities = 145/366 (39%), Positives = 217/366 (59%), Gaps = 4/366 (1%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVK 85
           VKG+G+ +WD  G++Y+DF  GIAV  LGH HP + + + +Q K L H SNI+  EP ++
Sbjct: 29  VKGKGSRLWDQKGKEYIDFSGGIAVTSLGHCHPVLNKVLRQQSKKLWHISNIFTNEPALR 88

Query: 86  LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLAT 145
           LA  L+ +S A + FF NSGAEANE A KLAR Y+ +     K +II+  NSFHGRT  T
Sbjct: 89  LADKLISSSFASRVFFANSGAEANEAAFKLARYYSSKIYNLKKNKIISFYNSFHGRTFFT 148

Query: 146 VTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAY 205
           V+  GQ KY     P P    +  FN++ ++K+ I  +TCAV++E +QGEGG++PA  A+
Sbjct: 149 VSVGGQAKYSDFFGPKPPAIMHAKFNEINSVKSIIDDNTCAVVMELIQGEGGIVPADVAF 208

Query: 206 LEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           +  ++ LC +   LLIFDE+Q G+GRT K   Y+HY V+PDI+T+AK+LG GFPI A L 
Sbjct: 209 VREIRDLCYKYNALLIFDEIQTGIGRTSKLYAYEHYEVQPDILTIAKSLGSGFPISATLT 268

Query: 266 KEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
              +A   +PG H +T+GGNPLA + + + +  +  K  L    +  +   +EL  +   
Sbjct: 269 TNGIASVIKPGIHGTTYGGNPLACSIAESVVNIVNTKKFLLGVEKKSKKIISELNIINKR 328

Query: 326 VPLVKEVRXXXXXXXXXXXXXXKDIVAHCLE----QGLLINCTNGNVLRFLPPLIITKDE 381
             L  E+R               + + + L     +G+++     NV+R  P LII+K +
Sbjct: 329 FGLFTEIRGKGLLIGIVLRPELSEEIHNILNALFLEGVIVLTAGKNVIRLAPSLIISKRD 388

Query: 382 IDQAVQ 387
           I + ++
Sbjct: 389 IVEGMK 394


>OAT2_STAAW RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (712), Expect = 4e-77
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGEWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVDFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           +ALK  I  +T AV++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 DALKAAINENTAAVLVEPIQGEAGINIPPEGYLKAIRELCDEHNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA ++V   F PG H STFGGNPLA  AS
Sbjct: 237 KLFATDWDNVKPDVYILGKALGGGVFPISVVLADKEVLDVFTPGSHGSTFGGNPLACAAS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
           +A ++ ++ + +   + ++G+YFK +L ++  + P +KEVR              +    
Sbjct: 297 IAALDVIVDEDLPGRSLELGDYFKEQLKQI--DHPSIKEVRGRGLFIGVELNESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              E+GLL   T+  V+RF PPLIITK+E+D A++ ++
Sbjct: 355 ALKEEGLLCKETHDTVIRFAPPLIITKEELDLALEKIR 392


>OAT2_STAAS RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (712), Expect = 4e-77
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGEWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVDFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           +ALK  I  +T AV++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 DALKAAINENTAAVLVEPIQGEAGINIPPEGYLKAIRELCDEHNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA ++V   F PG H STFGGNPLA  AS
Sbjct: 237 KLFATDWDNVKPDVYILGKALGGGVFPISVVLADKEVLDVFTPGSHGSTFGGNPLACAAS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
           +A ++ ++ + +   + ++G+YFK +L ++  + P +KEVR              +    
Sbjct: 297 IAALDVIVDEDLPGRSLELGDYFKEQLKQI--DHPSIKEVRGRGLFIGVELNESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              E+GLL   T+  V+RF PPLIITK+E+D A++ ++
Sbjct: 355 ALKEEGLLCKETHDTVIRFAPPLIITKEELDLALEKIR 392


>OAT2_STAAR RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (712), Expect = 4e-77
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGEWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVDFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           +ALK  I  +T AV++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 DALKAAINKNTAAVLVEPIQGEAGINIPPEGYLKAIRELCDEHNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA ++V   F PG H STFGGNPLA  AS
Sbjct: 237 KLFARDWDNVKPDVYILGKALGGGVFPISVVLADKEVLDVFTPGSHGSTFGGNPLACAAS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
           +A ++ ++ + +   + ++G+YFK +L ++  + P +KEVR              +    
Sbjct: 297 IAALDVIVDEDLPGRSLELGDYFKEQLKQI--DHPSIKEVRGRGLFIGVELNESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              E+GLL   T+  V+RF PPLIITK+E+D A++ ++
Sbjct: 355 ALKEEGLLCKETHDTVIRFAPPLIITKEELDLALEKIR 392


>OAT2_STAAN RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (712), Expect = 4e-77
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGEWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVDFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           +ALK  I  +T AV++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 DALKAAINENTAAVLVEPIQGEAGINIPPEGYLKAIRELCDEHNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA ++V   F PG H STFGGNPLA  AS
Sbjct: 237 KLFATDWDNVKPDVYILGKALGGGVFPISVVLADKEVLDVFTPGSHGSTFGGNPLACAAS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
           +A ++ ++ + +   + ++G+YFK +L ++  + P +KEVR              +    
Sbjct: 297 IAALDVIVDEDLPGRSLELGDYFKEQLKQI--DHPSIKEVRGRGLFIGVELNESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              E+GLL   T+  V+RF PPLIITK+E+D A++ ++
Sbjct: 355 ALKEEGLLCKETHDTVIRFAPPLIITKEELDLALEKIR 392


>OAT2_STAAM RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (712), Expect = 4e-77
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGEWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVDFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           +ALK  I  +T AV++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 DALKAAINENTAAVLVEPIQGEAGINIPPEGYLKAIRELCDEHNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA ++V   F PG H STFGGNPLA  AS
Sbjct: 237 KLFATDWDNVKPDVYILGKALGGGVFPISVVLADKEVLDVFTPGSHGSTFGGNPLACAAS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
           +A ++ ++ + +   + ++G+YFK +L ++  + P +KEVR              +    
Sbjct: 297 IAALDVIVDEDLPGRSLELGDYFKEQLKQI--DHPSIKEVRGRGLFIGVELNESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              E+GLL   T+  V+RF PPLIITK+E+D A++ ++
Sbjct: 355 ALKEEGLLCKETHDTVIRFAPPLIITKEELDLALEKIR 392


>OAT2_STAAC RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (712), Expect = 4e-77
 Identities = 154/398 (38%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEKIIELTNHYGAHNYLPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGEWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVDFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           +ALK  I  +T AV++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 DALKAAINENTAAVLVEPIQGEAGINIPPEGYLKAIRELCDEHNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA ++V   F PG H STFGGNPLA  AS
Sbjct: 237 KLFATDWDNVKPDVYILGKALGGGVFPISVVLADKEVLDVFTPGSHGSTFGGNPLACAAS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
           +A ++ ++ + +   + ++G+YFK +L ++  + P +KEVR              +    
Sbjct: 297 IAALDVIVDEDLPGRSLELGDYFKEQLKQI--DHPSIKEVRGRGLFIGVELNESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              E+GLL   T+  V+RF PPLIITK+E+D A++ ++
Sbjct: 355 ALKEEGLLCKETHDTVIRFAPPLIITKEELDLALEKIR 392


>ARGD1_BORPA RecName: Full=Acetylornithine aminotransferase 1;      
             Short=ACOAT 1;         EC=2.6.1.11;
          Length = 393

 Score =  278 bits (712), Expect = 4e-77
 Identities = 152/376 (40%), Positives = 207/376 (55%), Gaps = 3/376 (0%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N Y RLP++   G+G W+WD   R+YLD ++GI V+CLGH HP +  A+ +Q   L+H S
Sbjct: 7   NIYARLPVSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAARLIHTS 66

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           NIY +           E S   +  F NSG+EANE AIKLAR Y  +  G     IIT  
Sbjct: 67  NIYEVPXXXXXXXXXXELSGMSEVLFSNSGSEANEAAIKLARYYGYKQ-GNTHAHIITMD 125

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALK--NTIGPHTCAVMLEPVQ 193
           +S+HGRTLAT+ ATG  K ++G  P+P GF  VP+NDL A++      P   AV+LE +Q
Sbjct: 126 SSWHGRTLATLAATGSDKARQGFGPMPSGFIQVPYNDLPAIRAAGEAEPRVTAVLLEVLQ 185

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+ P+  A+L GV+QLC E+G LL+ DEVQ G+GRTGK+  +Q   + PD++TLAK 
Sbjct: 186 GEGGIRPSDMAFLRGVRQLCTERGWLLMIDEVQSGIGRTGKWFAHQWADIRPDVMTLAKG 245

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           L GG                    H +TF             ++ + Q+G+L NA ++G 
Sbjct: 246 LAGGVXXXXXXXXXXXXXXXXXXSHGTTFXXXXXXXXXXXXVIDAIEQEGLLANAHEVGX 305

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
                     A VP + EVR                +    +E GLLIN T   V+R LP
Sbjct: 306 XXXXXXXSELAGVPGIIEVRGHGLMLGIELDRPCGILATRAMEAGLLINVTRERVVRLLP 365

Query: 374 PLIITKDEIDQAVQIL 389
           PLI++ +E DQ V+IL
Sbjct: 366 PLILSGEEADQIVRIL 381


>ARGD1_BORBR RecName: Full=Acetylornithine aminotransferase 1;      
             Short=ACOAT 1;         EC=2.6.1.11;
          Length = 393

 Score =  278 bits (712), Expect = 4e-77
 Identities = 152/376 (40%), Positives = 207/376 (55%), Gaps = 3/376 (0%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N Y RLP++   G+G W+WD   R+YLD ++GI V+CLGH HP +  A+ +Q   L+H S
Sbjct: 7   NIYARLPVSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAARLIHTS 66

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           NIY +           E S   +  F NSG+EANE AIKLAR Y  +  G     IIT  
Sbjct: 67  NIYEVPXXXXXXXXXXELSGMSEVLFSNSGSEANEAAIKLARYYGYKQ-GNTHAHIITMD 125

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALK--NTIGPHTCAVMLEPVQ 193
           +S+HGRTLAT+ ATG  K ++G  P+P GF  VP+NDL A++      P   AV+LE +Q
Sbjct: 126 SSWHGRTLATLAATGSDKARQGFGPMPSGFIQVPYNDLPAIRAAGEAEPRVTAVLLEVLQ 185

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+ P+  A+L GV+QLC E+G LL+ DEVQ G+GRTGK+  +Q   + PD++TLAK 
Sbjct: 186 GEGGIRPSDMAFLRGVRQLCTERGWLLMIDEVQSGIGRTGKWFAHQWADIRPDVMTLAKG 245

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           L GG                    H +TF             ++ + Q+G+L NA ++G 
Sbjct: 246 LAGGVXXXXXXXXXXXXXXXXXXSHGTTFXXXXXXXXXXXXVIDAIEQEGLLANAHEVGX 305

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
                     A VP + EVR                +    +E GLLIN T   V+R LP
Sbjct: 306 XXXXXXXSELAGVPGIIEVRGRGLMLGIELDRPCGILATRAMEAGLLINVTRERVVRLLP 365

Query: 374 PLIITKDEIDQAVQIL 389
           PLI++ +E DQ V+IL
Sbjct: 366 PLILSGEEADQIVRIL 381


>OAT_STACT RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  278 bits (711), Expect = 6e-77
 Identities = 149/392 (38%), Positives = 232/392 (59%), Gaps = 5/392 (1%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+   + Y    Y  LP+ + + +G W+ D +G +Y+D ++  +    GH HP+V E
Sbjct: 4   SEDIIKKTEHYGAPNYKPLPIVISEAEGIWITDPEGNKYMDMLAAYSAVNQGHRHPKVIE 63

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+ +Q   +   S  +  +      + + E +  +K    N+GAEA E A+K AR++A +
Sbjct: 64  ALKEQADKVTLVSRAFNSDNLGDWYEKVSELTGKEKVLPMNTGAEAVETAVKAARRWAYE 123

Query: 123 H--LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
           H  + PDK EII    +FHGRT+A V+ + + +YQRG  PL +GF  V F D++ LK+ I
Sbjct: 124 HKDIEPDKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLEGFLKVDFGDVDQLKDAI 183

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
             +T A+++EP+QGE G+    + YL+ +++L +E  +L I DE+Q GLGR+GK      
Sbjct: 184 NENTAAILVEPIQGEAGINVPPEGYLKEIRKLADENNILFIADEIQSGLGRSGKTFATDW 243

Query: 241 YGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
            GV+ D+  L KALGGG  PI A+ A  +V   F PG H STFGGNPLAA  S+A ++ L
Sbjct: 244 DGVKLDVYILGKALGGGVLPISAVAADSEVLDVFTPGSHGSTFGGNPLAAAVSIAALDVL 303

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGL 359
             + + E + ++GEYF+ EL K+  + P++KEVR              +       E+GL
Sbjct: 304 EDEKLAERSRELGEYFQDELKKI--DNPVIKEVRGRGLFIGVELNEDARPYAEALKEEGL 361

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAVQILKR 391
           L   T+  V+RF PPLIITK+EID A++ +K+
Sbjct: 362 LCKETHDTVIRFAPPLIITKEEIDDALERIKK 393


>OAT2_STAS1 RecName: Full=Ornithine aminotransferase 2;       
           Short=OAT 2;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 2;
          Length = 396

 Score =  278 bits (710), Expect = 8e-77
 Identities = 149/387 (38%), Positives = 228/387 (58%), Gaps = 5/387 (1%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++EI+ +   Y    Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SEEIIEVTNHYGAQNYVPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAK- 121
           A+ +Q   +   S  +  E   +  + + + S   KA   N+GAEA E A+K AR++A  
Sbjct: 64  ALKEQADKVTLVSRAFHSENLGEWYEKICKLSGKAKALPMNTGAEAVETALKAARRWAYD 123

Query: 122 -QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
            +++ PDK EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+EA+K  I
Sbjct: 124 VKNIQPDKAEIIAFNGNFHGRTMAPVSLSSEPEYQRGYGPLLDGFRKVDFGDIEAVKAAI 183

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
             +T A+++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+GK      
Sbjct: 184 NENTAAILIEPIQGEAGINVPPEGYLKQIRELCDEHNVLFIADEIQAGLGRSGKLFATDW 243

Query: 241 YGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
             V+PD+  L KALGGG  PI  +LA E+V   F PG H STFGGNPLA   S A ++ +
Sbjct: 244 DNVKPDVYILGKALGGGVLPISVVLADEEVLGVFTPGSHGSTFGGNPLACAVSNAALDVI 303

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGL 359
           + + +   + ++G+YFK+EL K+  + P +KEVR              +       EQGL
Sbjct: 304 IDEDLPGRSLELGDYFKSELEKI--DHPAIKEVRGRGLFIGIELNEAARPFCESLKEQGL 361

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAV 386
           L   T+  V+RF PPLII+K+E+D A+
Sbjct: 362 LCKETHDTVIRFAPPLIISKEELDFAL 388


>ARGD_DICDI RecName: Full=Probable acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 453

 Score =  277 bits (709), Expect = 1e-76
 Identities = 152/400 (38%), Positives = 230/400 (57%), Gaps = 8/400 (2%)

Query: 5   EILAMGQQYVMNTYGRLP-MALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           + + +    +MNTYGR+  +    G+ +W++D  G +YLDF +GIAVN LGH++   +E 
Sbjct: 49  DYIKLHDNVIMNTYGRVSDIVFTHGKDSWLYDMKGDKYLDFGAGIAVNALGHSNDGWSEV 108

Query: 64  VCKQVKTLLHCSNIYWIEPQVKLAKLLVENS-CADKAFFCNSGAEANEGAIKLARKYAKQ 122
           V  Q K L H SN+Y+ +P ++LA+ ++ ++   DK FF NSG EANE            
Sbjct: 109 VANQSKKLTHLSNLYYNQPAIELAQSMIASTPIFDKVFFANSGTEANEXXXXXXXXXXXX 168

Query: 123 HLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGP 182
               DK+EII  ++ F GR++ +++ T ++KY+    PL  G  +  +ND+E++K  +  
Sbjct: 169 XXXVDKHEIIAFSHGFSGRSMGSLSCTHKSKYREIYGPLVPGVHFAEYNDIESVKKLMSK 228

Query: 183 H-TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY 241
             TCAV++EPVQGEGG+  A   +++ + +LC+E   LLI DEVQCG+GRTG+   +  +
Sbjct: 229 SKTCAVIIEPVQGEGGLEAATVEFMQQLYKLCKENDCLLIVDEVQCGIGRTGQLWAHTRF 288

Query: 242 GVE---PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
             E   PDI+TLAK L GG PIGA+L  ++VA   +PGDH +TFGG PL         E 
Sbjct: 289 DTEKCKPDIMTLAKPLAGGLPIGAVLVSDKVASEIKPGDHGTTFGGGPLVCEVGKYVFER 348

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVR-XXXXXXXXXXXXXXKDIVAHCLE 356
           + Q   L+   + G+Y    L KL  + P  + E+R                D+V++   
Sbjct: 349 ISQPSFLKEVQEKGKYLTDGLKKLKDQFPNSILEIRTVGGLFVGIQLDHNVSDLVSYAKS 408

Query: 357 QGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           Q +LI     +V+RF PPL ITK EIDQ + +LK  ++ V
Sbjct: 409 QKILIINAGDDVIRFCPPLTITKQEIDQLLLVLKNYLIKV 448


>ARGD_CAMJE RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 393

 Score =  277 bits (708), Expect = 1e-76
 Identities = 148/386 (38%), Positives = 221/386 (57%), Gaps = 4/386 (1%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Q +++ TY R  + L KGQG +++D   ++YLDF SGI V  LG+ H +    +  QV  
Sbjct: 6   QSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDK 65

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           LLH SN+Y+ E               ++ FF NSG E+ EGA+K ARKYA    G    +
Sbjct: 66  LLHTSNLYYNENIXXXXXXXXXXXXXERVFFTNSGTESIEGAMKTARKYAFNK-GVKGGQ 124

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
            I   +SFHGRTL  ++ T   KYQ+   PL  G  +  +ND+ +++  +   TCA++LE
Sbjct: 125 FIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKFAKYNDISSVEKLVNEKTCAIILE 184

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
            VQGEGG+ PA + + + +++LC+EK +LLI DE+QCG+GR+GKF  Y+H  + PDI+T 
Sbjct: 185 SVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTS 244

Query: 251 AKALGGGFPIGAMLAKEQVA-QAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
           AKALG G  +GA +  ++VA  + + GDH ST+GGNPL      A  E   ++ +LEN  
Sbjct: 245 AKALGCGLSVGAFVINQKVASNSLEAGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVN 304

Query: 310 QMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK--DIVAHCLEQGLLINCTNGN 367
           ++  Y +  L +L  E    K+ +              K   ++  C E  LL+     N
Sbjct: 305 KLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKSVKVAKVIQKCQENALLLISCGEN 364

Query: 368 VLRFLPPLIITKDEIDQAVQILKRAM 393
            LRFLPPLI+ K+ ID+  + L++A+
Sbjct: 365 DLRFLPPLILQKEHIDEMSEKLRKAL 390


>OAT1_STAAW RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  273 bits (699), Expect = 1e-75
 Identities = 148/384 (38%), Positives = 218/384 (56%), Gaps = 5/384 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           I+ +   Y  N Y  L + + KG+G  VWD DG+QY+D +SG +V   GH HP + +A+ 
Sbjct: 4   IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMT 63

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
           +Q   L   S + + +   K  + +   +  DK    NSG EA E AIK+ARK+  +  G
Sbjct: 64  EQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSEVKG 123

Query: 126 --PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
               + EII   N+FHGRTL +++ +    Y+ G  PL QG   V F D+E L   I P+
Sbjct: 124 ITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDIEQLTQAISPN 183

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A++LEP+QGEGGV    + Y++ V+QLC++  +LLI DE+Q GLGRTGK+   +   V
Sbjct: 184 TAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEWEQV 243

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PDI  L KALGGG +P+ A+LA   V +   PG H STFGGNPLA   S A ++ L  +
Sbjct: 244 VPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDE 303

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
            ++E + ++G +    L +L  + P +KE+R                 V   +++G+L  
Sbjct: 304 QLVERSERLGSFLLKALLQL--KHPSIKEIRGRGLFIGIELNTDAAPFVDQLIQRGILCK 361

Query: 363 CTNGNVLRFLPPLIITKDEIDQAV 386
            T+  ++R  PPL+I K+EI Q V
Sbjct: 362 DTHRTIIRLSPPLVIDKEEIHQIV 385


>OAT1_STAAS RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  273 bits (699), Expect = 1e-75
 Identities = 148/384 (38%), Positives = 218/384 (56%), Gaps = 5/384 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           I+ +   Y  N Y  L + + KG+G  VWD DG+QY+D +SG +V   GH HP + +A+ 
Sbjct: 4   IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMT 63

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
           +Q   L   S + + +   K  + +   +  DK    NSG EA E AIK+ARK+  +  G
Sbjct: 64  EQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSEVKG 123

Query: 126 --PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
               + EII   N+FHGRTL +++ +    Y+ G  PL QG   V F D+E L   I P+
Sbjct: 124 ITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDIEQLTQAISPN 183

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A++LEP+QGEGGV    + Y++ V+QLC++  +LLI DE+Q GLGRTGK+   +   V
Sbjct: 184 TAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEWEQV 243

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PDI  L KALGGG +P+ A+LA   V +   PG H STFGGNPLA   S A ++ L  +
Sbjct: 244 VPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDE 303

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
            ++E + ++G +    L +L  + P +KE+R                 V   +++G+L  
Sbjct: 304 QLVERSERLGSFLLKALLQL--KHPSIKEIRGRGLFIGIELNTDAAPFVDQLIQRGILCK 361

Query: 363 CTNGNVLRFLPPLIITKDEIDQAV 386
            T+  ++R  PPL+I K+EI Q V
Sbjct: 362 DTHRTIIRLSPPLVIDKEEIHQIV 385


>OAT1_STAAN RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  273 bits (699), Expect = 1e-75
 Identities = 147/384 (38%), Positives = 218/384 (56%), Gaps = 5/384 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           I+ +   Y  N Y  L + + KG+G  VWD DG+QY+D +SG +V   GH HP + +A+ 
Sbjct: 4   IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMT 63

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
           +Q   L   S + + +   K  + +   +  DK    NSG EA E AIK+ARK+  +  G
Sbjct: 64  EQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLSLNSGTEAVEAAIKIARKWGSEVKG 123

Query: 126 --PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
               + EII   N+FHGRTL +++ +    Y+ G  PL QG   V F D+E L   I P+
Sbjct: 124 ITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDIEQLTQAISPN 183

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A++LEP+QGEGGV    + Y++ V+QLC++  +L+I DE+Q GLGRTGK+   +   V
Sbjct: 184 TAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILMIADEIQVGLGRTGKWFAMEWEQV 243

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PDI  L KALGGG +P+ A+LA   V +   PG H STFGGNPLA   S A ++ L  +
Sbjct: 244 VPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDE 303

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
            ++E + ++G +    L +L  + P +KE+R                 V   +++G+L  
Sbjct: 304 QLVERSERLGSFLLKALLQL--KHPSIKEIRGRGLFIGIELNTDAAPFVDQLIQRGILCK 361

Query: 363 CTNGNVLRFLPPLIITKDEIDQAV 386
            T+  ++R  PPL+I K+EI Q V
Sbjct: 362 DTHRTIIRLSPPLVIDKEEIHQIV 385


>OAT1_STAAM RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  273 bits (699), Expect = 1e-75
 Identities = 147/384 (38%), Positives = 218/384 (56%), Gaps = 5/384 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           I+ +   Y  N Y  L + + KG+G  VWD DG+QY+D +SG +V   GH HP + +A+ 
Sbjct: 4   IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMT 63

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
           +Q   L   S + + +   K  + +   +  DK    NSG EA E AIK+ARK+  +  G
Sbjct: 64  EQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLSLNSGTEAVEAAIKIARKWGSEVKG 123

Query: 126 --PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
               + EII   N+FHGRTL +++ +    Y+ G  PL QG   V F D+E L   I P+
Sbjct: 124 ITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDIEQLTQAISPN 183

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A++LEP+QGEGGV    + Y++ V+QLC++  +L+I DE+Q GLGRTGK+   +   V
Sbjct: 184 TAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILMIADEIQVGLGRTGKWFAMEWEQV 243

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PDI  L KALGGG +P+ A+LA   V +   PG H STFGGNPLA   S A ++ L  +
Sbjct: 244 VPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDE 303

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
            ++E + ++G +    L +L  + P +KE+R                 V   +++G+L  
Sbjct: 304 QLVERSERLGSFLLKALLQL--KHPSIKEIRGRGLFIGIELNTDAAPFVDQLIQRGILCK 361

Query: 363 CTNGNVLRFLPPLIITKDEIDQAV 386
            T+  ++R  PPL+I K+EI Q V
Sbjct: 362 DTHRTIIRLSPPLVIDKEEIHQIV 385


>OAT1_STAAC RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  273 bits (699), Expect = 1e-75
 Identities = 148/384 (38%), Positives = 218/384 (56%), Gaps = 5/384 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           I+ +   Y  N Y  L + + KG+G  VWD DG+QY+D +SG +V   GH HP + +A+ 
Sbjct: 4   IIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMT 63

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
           +Q   L   S + + +   K  + +   +  DK    NSG EA E AIK+ARK+  +  G
Sbjct: 64  EQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSEVKG 123

Query: 126 --PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
               + EII   N+FHGRTL +++ +    Y+ G  PL QG   V F D+E L   I P+
Sbjct: 124 ITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDIEQLTQAISPN 183

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A++LEP+QGEGGV    + Y++ V+QLC++  +LLI DE+Q GLGRTGK+   +   V
Sbjct: 184 TAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEWEQV 243

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PDI  L KALGGG +P+ A+LA   V +   PG H STFGGNPLA   S A ++ L  +
Sbjct: 244 VPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDE 303

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
            ++E + ++G +    L +L  + P +KE+R                 V   +++G+L  
Sbjct: 304 QLVERSERLGSFLLKALLQL--KHPSIKEIRGRGLFIGIELNTDAAPFVDQLIQRGILCK 361

Query: 363 CTNGNVLRFLPPLIITKDEIDQAV 386
            T+  ++R  PPL+I K+EI Q V
Sbjct: 362 DTHRTIIRLSPPLVIDKEEIHQIV 385


>ARGD_LEPIN RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 406

 Score =  273 bits (697), Expect = 2e-75
 Identities = 151/393 (38%), Positives = 219/393 (55%), Gaps = 4/393 (1%)

Query: 4   QEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           Q    +   Y++NTY R  +A   G    ++D D +QY+DF  G+AV  LGHA P++ E 
Sbjct: 12  QHTKELADHYLLNTYARYDVAFRYGVNELLFDFDNKQYIDFHCGVAVTNLGHADPDIIEV 71

Query: 64  VCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQH 123
           V  Q   L H SN+++ E   KLA+LL+ NS   K F  NSG EA EGA KLARKYA   
Sbjct: 72  VRSQADKLFHTSNLFYSEEASKLAELLILNSFPGKVFLTNSGTEAIEGAFKLARKYAYSK 131

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
              D   I++   SFHGR+++ ++ TGQ K ++G   L +G  ++  N+ EAL      +
Sbjct: 132 SIVDPI-ILSLEKSFHGRSVSGMSLTGQDKIRKGYGELLKGIEFIEPNNDEALVAAFERY 190

Query: 184 T---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A++ EP+ GE G+IP ++ +L   ++L EE   LLIFDE+Q G+GRTG    ++ 
Sbjct: 191 QGRIVALIEEPILGESGIIPLSRNFLTLSRELTEENEALLIFDEIQTGMGRTGTLFAFET 250

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            G  PD +TLAK LG GFPIGA++  E+    F  G H STFGGN LAA  +  T+  + 
Sbjct: 251 MGFSPDAMTLAKGLGSGFPIGALIVGEKYQDLFTQGSHGSTFGGNHLAAAVAYETIRIIQ 310

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLL 360
            + +L N     +     L ++  + P++ EVR              K I   CL  GL+
Sbjct: 311 TREILNNVNICSDIAFTRLREMQEKYPVISEVRGKGLHIGLELKVPSKPIAEACLSAGLV 370

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +N T  NV+R +PPL I+ D ++Q + IL+  +
Sbjct: 371 VNATADNVVRIMPPLTISTDFLNQGLDILESVL 403


>ARGD_LEPIC RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 406

 Score =  273 bits (697), Expect = 2e-75
 Identities = 151/393 (38%), Positives = 219/393 (55%), Gaps = 4/393 (1%)

Query: 4   QEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           Q    +   Y++NTY R  +A   G    ++D D +QY+DF  G+AV  LGHA P++ E 
Sbjct: 12  QHTKELADHYLLNTYARYDVAFRYGVNELLFDFDNKQYIDFHCGVAVTNLGHADPDIIEV 71

Query: 64  VCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQH 123
           V  Q   L H SN+++ E   KLA+LL+ NS   K F  NSG EA EGA KLARKYA   
Sbjct: 72  VRSQADKLFHTSNLFYSEEASKLAELLILNSFPGKVFLTNSGTEAIEGAFKLARKYAYSK 131

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
              D   I++   SFHGR+++ ++ TGQ K ++G   L +G  ++  N+ EAL      +
Sbjct: 132 SIVDPI-ILSLEKSFHGRSVSGMSLTGQDKIRKGYGELLKGIEFIEPNNDEALVAAFERY 190

Query: 184 T---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A++ EP+ GE G+IP ++ +L   ++L EE   LLIFDE+Q G+GRTG    ++ 
Sbjct: 191 QGRIVALIEEPILGESGIIPLSRNFLTLSRELTEENEALLIFDEIQTGMGRTGTLFAFET 250

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            G  PD +TLAK LG GFPIGA++  E+    F  G H STFGGN LAA  +  T+  + 
Sbjct: 251 MGFSPDAMTLAKGLGSGFPIGALIVGEKYQDLFTQGSHGSTFGGNHLAAAVAYETIRIIQ 310

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLL 360
            + +L N     +     L ++  + P++ EVR              K I   CL  GL+
Sbjct: 311 TREILNNVNICSDIAFTRLREMQEKYPVISEVRGKGLHIGLELKVPSKPIAEACLSAGLV 370

Query: 361 INCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +N T  NV+R +PPL I+ D ++Q + IL+  +
Sbjct: 371 VNATADNVVRIMPPLTISTDFLNQGLDILESVL 403


>ARGD1_BORPE RecName: Full=Acetylornithine aminotransferase 1;      
             Short=ACOAT 1;         EC=2.6.1.11;
          Length = 393

 Score =  273 bits (697), Expect = 2e-75
 Identities = 150/376 (39%), Positives = 205/376 (54%), Gaps = 3/376 (0%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N Y RLP++   G+G W+WD   R+YLD ++GI V+CLGH HP +  A+ +Q   L+H S
Sbjct: 7   NIYARLPVSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAARLIHTS 66

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           NIY +           E S   +  F NSG+EANE AIKLAR Y  +  G     IIT  
Sbjct: 67  NIYEVPXXXXXXXXXXELSGMSEVLFNNSGSEANEAAIKLARYYGYKQ-GNTHAHIITMD 125

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALK--NTIGPHTCAVMLEPVQ 193
           +S+HGRTLAT+ ATG  K ++G  P+P GF  VP+NDL A++      P   AV+LE +Q
Sbjct: 126 SSWHGRTLATLAATGSDKARQGFGPMPSGFIQVPYNDLPAIRAAGEAEPRVTAVLLEVLQ 185

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GEGG+ P+  A+L+GV+QLC E+G LL+ DEVQ G+GRTGK+  +Q   + PD++TLAK 
Sbjct: 186 GEGGIRPSDMAFLQGVRQLCTERGWLLMIDEVQSGIGRTGKWFAHQWADIRPDVMTLAKG 245

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
           L GG                    H +TF             ++ + Q+G+L NA ++  
Sbjct: 246 LAGGVXXXXXXXXXXXXXXXXXXSHGTTFXXXXXXXXXXXXVIDAIEQEGLLGNAHEVXX 305

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLP 373
                        P V EVR                +    +E GLLIN T   V+R LP
Sbjct: 306 XXXXXXXXXXXXXPGVIEVRGRGLMLGIELDRPCGILATRAMEAGLLINVTRERVVRLLP 365

Query: 374 PLIITKDEIDQAVQIL 389
           PLI++ +E DQ V+IL
Sbjct: 366 PLILSGEEADQIVRIL 381


>OAT1_STAAR RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  272 bits (696), Expect = 3e-75
 Identities = 147/384 (38%), Positives = 218/384 (56%), Gaps = 5/384 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           I+ +   Y  N Y  L + + +G+G  VWD DG+QY+D +SG +V   GH HP + +A+ 
Sbjct: 4   IIELTDYYSSNNYAPLKLVITEGKGGKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMT 63

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
           +Q   L   S + + +   K  + +   +  DK    NSG EA E AIK+ARK+     G
Sbjct: 64  EQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSDVKG 123

Query: 126 --PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
               + EII   N+FHGRTL +++ +    Y+ G  PL QG   V F D+E L   I P+
Sbjct: 124 ITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKSGFHPLLQGTKTVDFGDIEQLTQAISPN 183

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A++LEP+QGEGGV    + Y++ V+QLC++  +LLI DE+Q GLGRTGK+   +   V
Sbjct: 184 TAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEWEQV 243

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PDI  L KALGGG +P+ A+LA   V +   PG H STFGGNPLA   S A ++ L  +
Sbjct: 244 VPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDE 303

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
            ++E + ++G +    L +L  + P +KE+R                 V   +++G+L  
Sbjct: 304 QLVERSERLGSFLLKALLQL--KHPSIKEIRGRGLFIGIELNTDAAPFVEQLIKRGILCK 361

Query: 363 CTNGNVLRFLPPLIITKDEIDQAV 386
            T+  ++R  PPL+I K+EI+Q V
Sbjct: 362 DTHRTIIRLSPPLVIDKEEINQIV 385


>ARGD_XANAC RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 408

 Score =  270 bits (690), Expect = 2e-74
 Identities = 151/324 (46%), Positives = 189/324 (58%), Gaps = 3/324 (0%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y +  Y    + L +GQG+ VWD  GR+YLD  SGIAV+ LGH  P++  A+ +Q   L 
Sbjct: 14  YYLPVYRPRQVVLERGQGSRVWDDAGREYLDLSSGIAVSGLGHNDPDLVAALTEQAGKLW 73

Query: 73  HCSNIYWIEPQVKLAKLLVENS-CADKAFFCNSGAEANEGAIKLARKYAKQHLGP-DKYE 130
           H SN+++  P +KLA+ LV  S  A K F CNSG EANE AIKL RK+A     P DK  
Sbjct: 74  HTSNVFFSAPPLKLAEELVSASRFAHKVFLCNSGTEANEAAIKLVRKWASSQGRPADKRV 133

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           I+T   SFHGRTLA+VTAT Q KYQ G +PLP GF YV FN                   
Sbjct: 134 IVTFRGSFHGRTLASVTATAQPKYQEGYEPLPGGFRYVDFNXXXXXXXXXXXXXXXXXXX 193

Query: 191 -PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIIT 249
            P+QGEGGV+PAA  +L  V+ LC++   LL+ DE+QCG+GRTG    +    V PDI+T
Sbjct: 194 XPIQGEGGVMPAAPGFLSRVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQEQVTPDIVT 253

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
           LAKALGGGFPIGAMLA  +VAQ  Q G H +TFGGNP                 + +N  
Sbjct: 254 LAKALGGGFPIGAMLAGPKVAQTMQFGAHGTTFGGNPXXXXXXXXXXXXXXSPQIADNVV 313

Query: 310 QMGEYFKAELTKLAAEVPLVKEVR 333
           +     +A L  L AE  L  ++R
Sbjct: 314 RQSAALRAGLEALNAEFGLFAQIR 337


>ARGD_CAUCR RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 405

 Score =  270 bits (690), Expect = 2e-74
 Identities = 155/379 (40%), Positives = 208/379 (54%), Gaps = 3/379 (0%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Q ++M  Y R P+A  +G+GA +   +G +YLD V+GIA N LGHAHP + E +  Q + 
Sbjct: 11  QHHIMGVYNRAPLAFERGRGARLISTEGEEYLDCVAGIATNGLGHAHPALVEVLKAQAEK 70

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
           L H SNIY I  Q +LA  L  NS AD  FF NSG EA E A+K ARKY   +  P++ +
Sbjct: 71  LWHVSNIYRIPEQEELADALCANSFADVVFFTNSGTEAVECALKTARKYHSANGQPERID 130

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLE-ALKNTIGPHTCAVML 189
           I     SFHGRT A V A+G   Y  G  P   G++ + F D +               +
Sbjct: 131 IYGFDGSFHGRTYAAVNASGNPSYVDGFGPRLPGYSQLTFGDHDXXXXXXXXXXXXXXXV 190

Query: 190 EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ-HYGVEPDII 248
           EPVQGEGG        L G++QLC+E G+LLI+DEVQCG+GRTGK   Y+   G EP I+
Sbjct: 191 EPVQGEGGARSIPTQCLVGLRQLCDEHGVLLIYDEVQCGMGRTGKLFAYEWAEGGEPHIM 250

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENA 308
            +AKALGGGFPIGA LA  + A+      H STFGGNPLA     A +E +     L+N 
Sbjct: 251 AVAKALGGGFPIGACLATTEAAKGMTVAAHGSTFGGNPLAMAVGKAALEIIKSPETLDNV 310

Query: 309 WQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
             +  +F  +L  L    P ++ +VR              +D +    ++ LLI     N
Sbjct: 311 KTVSGFFTQQLNGLKDRFPDVIVDVRGKGMLIGVKLIPNNRDFMVLARDEKLLIAGGGDN 370

Query: 368 VLRFLPPLIITKDEIDQAV 386
            +R LPPL +T +E  +A+
Sbjct: 371 CVRLLPPLNLTIEEASEAI 389


>OAT_GEOSW RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 398

 Score =  270 bits (689), Expect = 2e-74
 Identities = 149/397 (37%), Positives = 224/397 (56%), Gaps = 19/397 (4%)

Query: 5   EILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV 64
           EI+ + +QY  N Y  LP+ L KG+G WV D +G +Y+D +S  +    GH HP++ +A+
Sbjct: 6   EIIRLTEQYGANNYHPLPVVLTKGEGVWVEDPEGNRYMDMLSAYSAVNQGHRHPKIIQAL 65

Query: 65  CKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLAR 117
            +Q   +   S  +       W E   K+AKL  +    D     N+GAEA E A K AR
Sbjct: 66  KEQADRITLTSRAFHNDQLGPWYE---KVAKLTGK----DMVLPMNTGAEAVETAFKAAR 118

Query: 118 KYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEA 175
           ++A    G   DK EII   N+FHGRT+A V+ +   +Y+RG  P+  G   +P+ D+EA
Sbjct: 119 RWAYDVKGVEKDKAEIIVCENNFHGRTMAAVSMSSSEEYKRGFGPMLPGIKIIPYGDVEA 178

Query: 176 LKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKF 235
           LK  I P+T A + EP+QGE G+    + +L+    +C+E  +L I DE+Q GLGR+GK 
Sbjct: 179 LKKAITPNTAAFIFEPIQGEAGINIPPEGFLKEAYNVCKENNVLYIADEIQSGLGRSGKM 238

Query: 236 LGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLA 294
                  V PD+  L KALGGG FPI  + A   +   F PG H STFGGNPLA   S+A
Sbjct: 239 FACDWENVVPDMYILGKALGGGVFPISCVAANRDILGVFNPGSHGSTFGGNPLACAVSIA 298

Query: 295 TMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC 354
            ++ ++++ + E + ++G YF  +L ++  + P +KEVR              +      
Sbjct: 299 ALDVIIEEKLPERSLELGNYFIEKLREI--QHPDIKEVRGRGLFIGVELHTSARPYCEKL 356

Query: 355 LEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKR 391
            ++GLL   T+  V+RF PPL+ITK+E+D A++ +K+
Sbjct: 357 KQEGLLCKETHDTVIRFAPPLVITKEELDWAIERVKK 393


>OAT_BACSU RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 401

 Score =  268 bits (684), Expect = 8e-74
 Identities = 139/394 (35%), Positives = 224/394 (56%), Gaps = 5/394 (1%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++EI+     Y  N Y  LP+ + +  GAWV D +G +Y+D +S  +    GH HP++ +
Sbjct: 7   SKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQ 66

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+  Q   +   S  +  +      +   + +  +     N+GAEA E A+K AR++A +
Sbjct: 67  ALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYE 126

Query: 123 HLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
             G   ++ EII    +FHGRT+  V+ + + +Y+RG  P+  G   +P+ D+EAL+  I
Sbjct: 127 VKGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAI 186

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
            P+T A + EP+QGE G++   + +L+    +C+E+ +L I DE+Q GLGRTGK      
Sbjct: 187 TPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDW 246

Query: 241 YGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
            G+ PD+  L KALGGG FPI  + A  ++   F PG H STFGGNPLA   S+A++E L
Sbjct: 247 DGIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVL 306

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGL 359
             + + + + ++GEYFK+EL  +  + P++KEVR              +       E+GL
Sbjct: 307 EDEKLADRSLELGEYFKSELESI--DSPVIKEVRGRGLFIGVELTEAARPYCERLKEEGL 364

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           L   T+  V+RF PPLII+K+++D A++ +K  +
Sbjct: 365 LCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVL 398


>OAT_STAES RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  266 bits (680), Expect = 2e-73
 Identities = 153/398 (38%), Positives = 220/398 (55%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G  Y+D +S  +    GH HP + +
Sbjct: 4   SEKIINLTNHYGAHNYVPLPIVISEAEGVWVKDPEGNTYMDMLSAYSAVNQGHRHPRIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGQWHEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL +GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLEGFRKVEFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
             LK  I  +T A+++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 NQLKAAINKNTAAILVEPIQGEAGINVPPEGYLKTIRELCDEHQILFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA  +V   F PG H STFGGNPL     
Sbjct: 237 KLFATDWDHVKPDVYILGKALGGGVFPISVVLADNEVLDVFTPGSHGSTFGGNPLXXXXX 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
                    + +   + ++GEYFK+EL K+  E P +KEVR              +    
Sbjct: 297 XXXXXXXXXEDLPGRSLELGEYFKSELKKI--EHPSIKEVRGRGLFIGIELHESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              EQGLL   T+  V+RF PPL+ITK+E+D A++ +K
Sbjct: 355 ALKEQGLLCKETHDTVIRFAPPLVITKEELDMALEKIK 392


>OAT_STAEQ RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  266 bits (680), Expect = 2e-73
 Identities = 153/398 (38%), Positives = 219/398 (55%), Gaps = 19/398 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++I+ +   Y  + Y  LP+ + + +G WV D +G  Y+D +S  +    GH HP + +
Sbjct: 4   SEKIINLTNHYGAHNYVPLPIVISEAEGVWVKDPEGNTYMDMLSAYSAVNQGHRHPRIIQ 63

Query: 63  AVCKQ------VKTLLHCSNI-YWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+  Q      V    H  N+  W E   KLA         DKA   N+GAEA E A+K 
Sbjct: 64  ALKDQADKVTLVSRAFHSDNLGQWYEKICKLAG-------KDKALPMNTGAEAVETALKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G  P+K EII    +FHGRT+A V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVEFGDV 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
             LK  I  +T A+++EP+QGE G+    + YL+ +++LC+E  +L I DE+Q GLGR+G
Sbjct: 177 NQLKAAINKNTAAILVEPIQGEAGINVPPEGYLKTIRELCDEHQILFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V+PD+  L KALGGG FPI  +LA  +V   F PG H STFGGNPL     
Sbjct: 237 KLFATDWDHVKPDVYILGKALGGGVFPISVVLADNEVLDVFTPGSHGSTFGGNPLXXXXX 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
                    + +   + ++GEYFK+EL K+  E P +KEVR              +    
Sbjct: 297 XXXXXXXXXEDLPGRSLELGEYFKSELKKI--EHPSIKEVRGRGLFIGIELHESARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              EQGLL   T+  V+RF PPL+ITK+E+D A++ +K
Sbjct: 355 ALKEQGLLCKETHDTVIRFAPPLVITKEELDMALEKIK 392


>OAT_MACCJ RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 397

 Score =  263 bits (673), Expect = 1e-72
 Identities = 148/399 (37%), Positives = 225/399 (56%), Gaps = 19/399 (4%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +Q+I+ +   Y    Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +
Sbjct: 4   SQDIIEITNHYGAPNYHPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQ 63

Query: 63  AVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKL 115
           A+ +Q   +   S  +       W E   KLA         +     N+GAEA E AIK 
Sbjct: 64  ALKEQADRVTLTSRAFHSDQLGPWYEKICKLAG-------KEMVLPMNTGAEAVETAIKA 116

Query: 116 ARKYAKQHLG--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL 173
           AR++A    G   D+ EII    +FHGRTLA V+ + + +YQRG  PL  GF  V F D+
Sbjct: 117 ARRWAYDVKGVAKDQAEIIAMKGNFHGRTLAAVSLSSEAEYQRGYGPLLGGFKLVEFGDI 176

Query: 174 EALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
           E +K+ I P+T AV+LEP+QGE G+      +L+ V+ +C E  +L I DE+Q GLGR+G
Sbjct: 177 EQIKSAITPNTAAVLLEPIQGEAGINIPEDGFLKQVRDVCTENNVLFIADEIQAGLGRSG 236

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATAS 292
           K        V PD+  L KALGGG FPI  +LA +++ + F  G H STFGGNPLA   S
Sbjct: 237 KMFATDWDNVVPDMYILGKALGGGVFPISCVLADKEILEVFNAGSHGSTFGGNPLACAVS 296

Query: 293 LATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVA 352
            A ++ L+ + + E + ++GEYF+++L ++  + P++KEVR              +    
Sbjct: 297 NAALDVLVDEKLAERSLELGEYFQSKLKEI--DNPVIKEVRGKGLFIGVELNEAARPYCE 354

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKR 391
              E GLL   T+  V+RF PPLII+++++D A+  +K+
Sbjct: 355 QLKELGLLCKETHDTVIRFAPPLIISQEDLDWAIDKVKQ 393


>ARGD_STRAW RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 403

 Score =  263 bits (671), Expect = 3e-72
 Identities = 150/390 (38%), Positives = 207/390 (53%), Gaps = 12/390 (3%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           N E+    Q  +MN YG   + LV+G G  +WDADG++YLDFV GIAVN LGHAHP + E
Sbjct: 7   NAELTERWQGALMNNYGTPRLPLVRGAGTRLWDADGKEYLDFVGGIAVNALGHAHPAIVE 66

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCAD-KAFFCNSGAEANEGAIKLARKYAK 121
           AV  Q+ +L H SN++  EP V LA+ L++    D + +FCNSGAEANE A K+ R   +
Sbjct: 67  AVSTQIASLGHVSNLFVAEPPVALAERLLQLFGRDGRVYFCNSGAEANEAAFKIGRLTGR 126

Query: 122 QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG 181
            H+       +     FHGRT+  +  TGQ   Q    PLP    +VP+ D +       
Sbjct: 127 SHM-------VATQGGFHGRTMGALALTGQPGKQEPFLPLPGDVTHVPYGDAQXXXXXXX 179

Query: 182 PHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ-H 240
                  +EP+QGE GV+     YL+  + +    G LL+ DEVQ G+GRTG +  YQ H
Sbjct: 180 XXXXXXXIEPIQGENGVVVPPAGYLKAARAITAATGSLLVLDEVQTGIGRTGHWFEYQAH 239

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            GV PD++TLAK         A +A  + A+  QPG H +TFGGNP+A  A LA +ET+ 
Sbjct: 240 EGVLPDVVTLAKXXXXXXXXXATVAFGRAAELLQPGHHGTTFGGNPIACAAGLAVLETIQ 299

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR-XXXXXXXXXXXXXXKDIVAHCLEQGL 359
            +G+LEN     E  +  +  L    PL+  VR                         G 
Sbjct: 300 AEGLLENVKSASEKLRDGIESLGH--PLIAHVRGSGLLLGIVLTEPLXXXXXXXXXXXGF 357

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAVQIL 389
           L+N    +V+R +PPL +  DE+D  ++ L
Sbjct: 358 LVNAPAPDVVRLMPPLNLGDDEVDAFLRAL 387


>ARGD_ASHGO RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 423

 Score =  263 bits (671), Expect = 3e-72
 Identities = 146/399 (36%), Positives = 228/399 (57%), Gaps = 15/399 (3%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWD-ADGRQYLDFVSGIAVNCLGHAHPEVAEAV 64
           + A  Q+Y ++ Y +  + L +G+G+ ++D  + R+Y+DFV+GIAV  LGH+ P +AE +
Sbjct: 17  LTASMQKYFVDVYAKPDLVLTRGRGSRLFDDVNKREYIDFVAGIAVTSLGHSDPAIAEVI 76

Query: 65  CKQVKTLLHCSNIYWIEPQVKLAKLLVENSC-------ADKAFFCNSGAEANEGAIKLAR 117
             Q  TL+H SN++     +K A+ LVE++        A+K +FCNSG EANE A+K +R
Sbjct: 77  AAQSATLVHTSNLFHNSEALKFAEKLVESTKRFGGQQDAEKVYFCNSGTEANEAALKFSR 136

Query: 118 KYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFND-LEAL 176
           + A +   P K   I   NSFHGRT+ +++ T + KY+     +     ++  +D +E L
Sbjct: 137 RRALR-TDPQKQGFIAFENSFHGRTMGSLSVTSKAKYRLPFGDMVPHVTFLNIHDPVEKL 195

Query: 177 KNTI---GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
            + I    P T A++LEP+QGEGGV    +  L  + +LC++  ++LI+DE+QCGLGRTG
Sbjct: 196 VSFIVENAPKTAAMILEPIQGEGGVHRVPEDKLVALGRLCKKHDIVLIYDEIQCGLGRTG 255

Query: 234 KFLGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATA 291
           K   + +   +  PDI T AKALG GFP+GA +   +V +    GDH +T+GGNPLA   
Sbjct: 256 KLWAHSNLPADAHPDIFTTAKALGNGFPMGATVVNSKVNEVLSVGDHGTTYGGNPLACAV 315

Query: 292 SLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIV 351
               ++ + Q+  L++       F A L  L  + P ++E+R               DI+
Sbjct: 316 GNHVLDRIAQQPFLDDVKAKANVFTAGLLALQKKYPFIREIRGDGLLIGVEFTVDVSDII 375

Query: 352 AHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
           +   E+GLLI     N LR +P L I +D I Q ++IL+
Sbjct: 376 SKSRERGLLITAAGPNTLRIIPALTIEEDTIRQGLEILE 414


>OAT_DROAN RecName: Full=Ornithine aminotransferase, mitochondrial; 
                  EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 432

 Score =  262 bits (670), Expect = 3e-72
 Identities = 137/396 (34%), Positives = 228/396 (57%), Gaps = 4/396 (1%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++ + A   +Y  + Y  LP+AL KG+G +VWD +G++Y D++S  +    GH HP++ +
Sbjct: 35  SETVFARENKYGAHNYHPLPVALSKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVK 94

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YA 120
           A+ +Q   L   S  ++ +   +  + + +    DK    N+G E  E A KLARK  Y 
Sbjct: 95  ALTEQASKLALTSRAFYSDVLGEYEEYVTKLFGFDKVLPMNTGVEGGETACKLARKWGYL 154

Query: 121 KQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
           ++ +  ++ +II A N+F GRTL+ V+A+       G  P   GF  + ++++ AL+  +
Sbjct: 155 QKKIPENQAKIIFARNNFWGRTLSAVSASNDPSSYEGFGPFMPGFELIEYDNVTALEEAL 214

Query: 181 -GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             P+ CA M+EP+QGE GV+  +  YL+ V++LC +  +L I DEVQ GL RTGK L   
Sbjct: 215 KDPNVCAFMVEPIQGERGVVVPSDGYLKKVRELCSKNNVLWIADEVQTGLARTGKLLAVN 274

Query: 240 HYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +  V+PDI+ L KAL GG +P+ A+L  + V    +PG+H ST+GGNPL    ++A +E 
Sbjct: 275 YEDVQPDILILGKALSGGLYPVSAVLCNDPVMLCIKPGEHGSTYGGNPLGCRVAMAALEV 334

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQG 358
           L ++ + ENA++MGE  ++EL+ L  +V  V   +                +     E G
Sbjct: 335 LQEEKLAENAFKMGELLRSELSTLPKDVVSVVRGKGLLNAIVINEKYDAWKVCLKLKENG 394

Query: 359 LLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
           LL   T+G+++RF PPL+I    + ++++I+K+ +L
Sbjct: 395 LLAKPTHGDIIRFAPPLVIMNPRLRESIEIIKKTIL 430


>OAT_PLAFD RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 414

 Score =  262 bits (669), Expect = 4e-72
 Identities = 145/399 (36%), Positives = 223/399 (55%), Gaps = 7/399 (1%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           ++Q+ +     Y  + Y  +P+ L +G+G +V+D + R+Y DF+S  +    GH HP++ 
Sbjct: 9   SSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDIL 68

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--Y 119
            A+  Q K L  CS  ++ +      + L      DK    N+GAEA+E A KL RK  Y
Sbjct: 69  NAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGY 128

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
             + +  +  +II   N+F GRTL  V+A+   K +    P    F  VP++DLEAL+  
Sbjct: 129 EVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKE 188

Query: 180 I-GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           +  P+ CA ++EPVQGE GVI  + +Y  GV  LC++  +L + DEVQ GLGRTGK L  
Sbjct: 189 LQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCT 248

Query: 239 QHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME 297
            HYGV+PD+I L KAL GG +PI A+LA + V    +PG+H ST+GGNPLAA   +  ++
Sbjct: 249 HHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALK 308

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL-- 355
            L+ + + ENA ++G  F   L +   +  +V+EVR               ++   CL  
Sbjct: 309 VLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVNVWDICLKF 368

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            E GL+    +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 369 KENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTV 407


>OAT_PLAF7 RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 414

 Score =  262 bits (669), Expect = 4e-72
 Identities = 145/399 (36%), Positives = 223/399 (55%), Gaps = 7/399 (1%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           ++Q+ +     Y  + Y  +P+ L +G+G +V+D + R+Y DF+S  +    GH HP++ 
Sbjct: 9   SSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDIL 68

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--Y 119
            A+  Q K L  CS  ++ +      + L      DK    N+GAEA+E A KL RK  Y
Sbjct: 69  NAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGY 128

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
             + +  +  +II   N+F GRTL  V+A+   K +    P    F  VP++DLEAL+  
Sbjct: 129 EVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKE 188

Query: 180 I-GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           +  P+ CA ++EPVQGE GVI  + +Y  GV  LC++  +L + DEVQ GLGRTGK L  
Sbjct: 189 LQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCT 248

Query: 239 QHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME 297
            HYGV+PD+I L KAL GG +PI A+LA + V    +PG+H ST+GGNPLAA   +  ++
Sbjct: 249 HHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALK 308

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL-- 355
            L+ + + ENA ++G  F   L +   +  +V+EVR               ++   CL  
Sbjct: 309 VLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVNVWDICLKF 368

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            E GL+    +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 369 KENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTV 407


>OAT_DROME RecName: Full=Ornithine aminotransferase, mitochondrial; 
                  EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 431

 Score =  261 bits (667), Expect = 7e-72
 Identities = 136/393 (34%), Positives = 227/393 (57%), Gaps = 4/393 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           + A   +Y  + Y  LP+AL KG+G +VWD +G++Y D++S  +    GH HP++  A+ 
Sbjct: 37  VYARENKYGAHNYHPLPVALTKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVAALT 96

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YAKQH 123
            Q   L   S  ++ +   +  + + +    DK    N+G E  E A KLARK  Y ++ 
Sbjct: 97  AQASKLALTSRAFYSDVLGEYEEYVTKLFGFDKVLPMNTGVEGGETACKLARKWGYLEKK 156

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI-GP 182
           +  ++ +II A N+F GRTL+ V+A+       G  P   GF  + ++++ AL+ ++  P
Sbjct: 157 IPANQAKIIFARNNFWGRTLSAVSASNDPSSYEGFGPFMPGFELIEYDNVSALEESLKDP 216

Query: 183 HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYG 242
           + CA M+EP+QGE GV+  +  YL+ V++LC +  +L I DEVQ GL RTGK L   +  
Sbjct: 217 NVCAFMVEPIQGEAGVVVPSDGYLKKVRELCTKYNVLWIADEVQTGLARTGKLLAVDYEQ 276

Query: 243 VEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQ 301
           V+PDI+ L KAL GG +P+ A+L  +QV    +PG+H ST+GGNPL    ++A +E L +
Sbjct: 277 VQPDILILGKALSGGMYPVSAVLCNDQVMLCIKPGEHGSTYGGNPLGCRVAMAALEVLQE 336

Query: 302 KGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLI 361
           + + ENA++MG+  + EL+ L  +V  V   +               ++     E GLL 
Sbjct: 337 EKLAENAFKMGDLLRNELSTLPKDVVSVVRGKGLLNAIVINQKFDAWEVCLRLKENGLLA 396

Query: 362 NCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
             T+G+++RF PPL+I + ++ +++ I+++ +L
Sbjct: 397 KPTHGDIIRFAPPLVINETQMRESIDIIRKTIL 429


>ARGD_MYCLE RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 404

 Score =  260 bits (665), Expect = 1e-71
 Identities = 156/380 (41%), Positives = 202/380 (53%), Gaps = 13/380 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +MN YG  P+ L  G GA V D D   YLD + GIAVN LGH HP V EAV  Q+ TL H
Sbjct: 19  MMNNYGTPPIVLASGNGAVVTDVDSNTYLDLLGGIAVNVLGHRHPAVIEAVTHQITTLGH 78

Query: 74  CSNIYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
            SN+Y  EP + LA+ LV    AD   + FFCNSG EANE A KL+R   +  L      
Sbjct: 79  TSNLYATEPSITLAEELVALLGADTQTRVFFCNSGTEANELAFKLSRLTGRTKL------ 132

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
            + A  +FHGRT+ ++  TGQ   Q   +PLP    +VP+                  LE
Sbjct: 133 -VAAQAAFHGRTMGSLALTGQPAKQAAFEPLPGHVTHVPYGQXXXXXXXXXXXXXXXFLE 191

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+ GE GVI   + YL   + +    G LL+ DEVQ G+GRTG F  +QH  + PD++TL
Sbjct: 192 PIMGESGVIVPPEGYLAAARDITTRHGALLVIDEVQTGIGRTGAFFAHQHDSITPDVVTL 251

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310
           AK LGGG PIGA LA    A+    G H STFGGNP+              +G++  A  
Sbjct: 252 AKGLGGGLPIGAFLATGPAAELLTLGLHGSTFGGNPVCTXXXXXXXXXXXTQGLVRRAEV 311

Query: 311 MGEYFKAELTKLAAEVPLVKEV-RXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVL 369
           +G+  +  +  L+   PL+ +V                KDI     + G L+N T   V+
Sbjct: 312 LGDSMRIGIESLSH--PLIDQVXXXXXXXXIVLTAPRAKDIEKAARDAGFLVNATAPEVI 369

Query: 370 RFLPPLIITKDEIDQAVQIL 389
           R  PPLIIT+ +ID  +  L
Sbjct: 370 RLAPPLIITESQIDSFITAL 389


>ARGD2_BORPE RecName: Full=Acetylornithine aminotransferase 2;      
             Short=ACOAT 2;         EC=2.6.1.11;
          Length = 396

 Score =  259 bits (663), Expect = 2e-71
 Identities = 160/386 (41%), Positives = 226/386 (58%), Gaps = 5/386 (1%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +M    R  +  V+GQG+W+ D  G++YLDFV G AVN LGH  PE+  A+ +Q   L++
Sbjct: 11  LMEITARPDLVFVRGQGSWLEDHAGKRYLDFVQGWAVNTLGHCAPEMKRAMAEQADKLMN 70

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            S  ++  P ++LA+ L   SC D+ FF NSGAEANEGAIKLARK+ + +     Y+IIT
Sbjct: 71  PSPAFYNLPSIELAQRLTSASCFDRVFFANSGAEANEGAIKLARKWGRVNRN-GAYKIIT 129

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             + FHGRTLAT++A+G+  +     P  +GF     NDL++++  I   T AVMLEPVQ
Sbjct: 130 MNHGFHGRTLATMSASGKPGWDTMFAPQVEGFPKAEINDLDSVRALIDAQTVAVMLEPVQ 189

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GVIPA + +++G+++L +E G+L I DEVQ G+GRTG    YQ + V PDI+T    
Sbjct: 190 GEAGVIPATREFMQGLRKLADEHGILFIVDEVQTGMGRTGSLFAYQQFDVIPDIMTXXXX 249

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
                       +E+V   F  GD   T+ GNPL A   +A  +T+   G +E A     
Sbjct: 250 XXXXXXXXXXXXREEVC-VFAHGDQGGTYNGNPLCAAVGVAVFDTITAPGFMEAAQARTR 308

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQGLLINCTNGNVLR 370
                L  L+A+  L  E                  IV        +GLL+N   GN+LR
Sbjct: 309 QLSEGLLALSAKWSLRGERGMGXXXXXXXXXXXXPAIVEAARMLAPEGLLLNAPRGNLLR 368

Query: 371 FLPPLIITKDEIDQAVQILKRAMLVV 396
           F+P L +T+ ++ + ++ L   +  V
Sbjct: 369 FMPALNVTEADMARMLEQLDGVIAAV 394


>ARGD_STRCO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 402

 Score =  259 bits (662), Expect = 3e-71
 Identities = 148/386 (38%), Positives = 209/386 (54%), Gaps = 12/386 (3%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           M+N+E+    Q  +MN YG   + LV+G+GA +WDADG++YLDFV GIAVN LGHAHP V
Sbjct: 1   MSNEELTERWQGTLMNNYGTPRLPLVRGEGARLWDADGKEYLDFVGGIAVNALGHAHPAV 60

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCAD-KAFFCNSGAEANEGAIKLARKY 119
            +AV +Q+ +L H SN++  EP V LA+ L+++   D K +FCNSGAEANEGA K+ R  
Sbjct: 61  VDAVSRQIASLGHVSNLFIAEPPVALAERLLQHFGRDGKVYFCNSGAEANEGAFKIGRLT 120

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
            + H+       +     FHGRT+  +  TGQ   Q    PLP    +VP+ D +     
Sbjct: 121 GRPHM-------VATRGGFHGRTMGALALTGQPGKQEPFLPLPGDVTHVPYGDPQXXXXX 173

Query: 180 IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                   ++EP+QGE GV+     YL+           LL+ DEVQ G+GRTG +  YQ
Sbjct: 174 XXXXXXXXIIEPIQGENGVVVPPPGYLKXXXXXXXXXXXLLVLDEVQTGVGRTGHWFEYQ 233

Query: 240 -HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
            H GV PD++TLAK         A +A  + A   QPG H +TFGGNP+A  A LA ++T
Sbjct: 234 AHEGVLPDVVTLAKXXXXXXXXXATVAFGRAADLLQPGHHGTTFGGNPVACAAGLAVLDT 293

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR-XXXXXXXXXXXXXXKDIVAHCLEQ 357
           +  +G+L+N  +  E  +  +  L    PLV  VR                         
Sbjct: 294 IADEGLLDNVKRQSETLRGGVEALGH--PLVAHVRGAGLLLGIVLTEPLXXXXXXXXXXX 351

Query: 358 GLLINCTNGNVLRFLPPLIITKDEID 383
           G+L+N    +V+R +P L +  D ++
Sbjct: 352 GILVNAPAPDVVRLMPALNLGDDVVE 377


>ARGD_LACLA RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 377

 Score =  258 bits (660), Expect = 5e-71
 Identities = 149/383 (38%), Positives = 215/383 (56%), Gaps = 12/383 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +   YGRLP +L+KG+  +++D  G +YLDF SGI V  LG++  +   AV  Q+ +L H
Sbjct: 4   LFENYGRLPFSLIKGEDQYLFDDRGNKYLDFTSGIGVMNLGYSFEKGKVAVKAQLDSLSH 63

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN+Y    Q  +A+ L +N  + KAFFCNSG EANE A+KL       HL     +I+ 
Sbjct: 64  LSNLYQNPLQEDVAEKLSQNH-SYKAFFCNSGTEANEAALKLT------HLIKKDQKILA 116

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC-AVMLEPV 192
            T+ FHGRT   ++AT Q K Q G  PL   F   PFND+ AL+  +      A++ E +
Sbjct: 117 FTDGFHGRTFGAMSATMQEKIQAGFSPLLPNFVASPFNDVVALEQILEKEKIGAIIFEII 176

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGEGGV+P +  ++E +K  C++KG+LLI DE+Q G+GRTGK   ++H+  EPDI TLAK
Sbjct: 177 QGEGGVLPISPDFVEALKS-CQQKGILLIIDEIQTGIGRTGKLFAFEHFDFEPDIFTLAK 235

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           AL  G P GAMLAK + A  F  G H STFGGNPLA  ++   ++  +    LE     G
Sbjct: 236 ALANGIPTGAMLAKNKYASYFSAGKHGSTFGGNPLAMASANEVLKE-IDSDFLEKVTDKG 294

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK--DIVAHCLEQGLLINCTNGNVLR 370
            +F   LT+  +    VK +R              K  ++                +V+R
Sbjct: 295 IFFLKLLTEKLSVKATVKSIRGLGLMIGIQLTDEKKVPEVXXXXXXXXXXXXXXGHDVIR 354

Query: 371 FLPPLIITKDEIDQAVQILKRAM 393
            LPPL++TK E+ +  ++L++ +
Sbjct: 355 LLPPLVMTKVELQKGAELLEKIL 377


>ARGD2_BORBR RecName: Full=Acetylornithine aminotransferase 2;      
             Short=ACOAT 2;         EC=2.6.1.11;
          Length = 396

 Score =  258 bits (660), Expect = 5e-71
 Identities = 160/386 (41%), Positives = 226/386 (58%), Gaps = 5/386 (1%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +M    R  +  V+GQG+W+ D  G++YLDFV G AVN LGH  PE+  A+ +Q   L++
Sbjct: 11  LMEITARPDLVFVRGQGSWLEDHAGKRYLDFVQGWAVNTLGHCAPEMKRALAEQADKLMN 70

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            S  ++  P ++LA+ L   SC D+ FF NSGAEANEGAIKLARK+ + +     Y+IIT
Sbjct: 71  PSPAFYNLPSIELAQRLTSASCFDRVFFANSGAEANEGAIKLARKWGRVNRN-GAYKIIT 129

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             + FHGRTLAT++A+G+  +     P  +GF     NDL++++  I   T AVMLEPVQ
Sbjct: 130 MNHGFHGRTLATMSASGKPGWDTMFAPQVEGFPKAEINDLDSVRALIDAQTVAVMLEPVQ 189

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GVIPA + +++G+++L +E G+L I DEVQ G+GRTG    YQ + V PDI+T    
Sbjct: 190 GEAGVIPATREFMQGLRKLADEHGILFIVDEVQTGMGRTGSLFAYQQFDVIPDIMTXXXX 249

Query: 254 LGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGE 313
                       +E+V   F  GD   T+ GNPL A   +A  +T+   G +E A     
Sbjct: 250 XXXXXXXXXXXXREEVC-VFAHGDQGGTYNGNPLCAAVGVAVFDTITAPGFMEAAQARTR 308

Query: 314 YFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQGLLINCTNGNVLR 370
                L  L+A+                        IV        +GLL+N   GN+LR
Sbjct: 309 QLSEGLLALSAKXXXXXXXXXXXXXXXXXXXXXXPAIVEAARMLAPEGLLLNAPRGNLLR 368

Query: 371 FLPPLIITKDEIDQAVQILKRAMLVV 396
           F+P L +T+ ++ + ++ L   +  V
Sbjct: 369 FMPALNVTEADMARMLEQLDGVIAAV 394


>ARGD_STAEQ RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 375

 Score =  257 bits (657), Expect = 1e-70
 Identities = 148/377 (39%), Positives = 205/377 (54%), Gaps = 8/377 (2%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y+ N Y R  +  V      + D D   YLDF SGI V  LG  + E+ +AV  Q+  + 
Sbjct: 3   YLFNNYKRDNIEFVDANQNELIDKDNNVYLDFSSGIGVTNLGF-NMEIYQAVYNQLNLIW 61

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H  N+Y    Q ++A+ L+       AFFCNSG EANE AIKLARK         K EII
Sbjct: 62  HSPNLYLSSIQEEVAQKLIGQRDY-LAFFCNSGTEANEAAIKLARK------ATGKSEII 114

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
               SFHGRT   ++ATGQ K      P+  GF +  FND  + K+    +T AV++E +
Sbjct: 115 AFKKSFHGRTYGAMSATGQKKITDQFGPVVPGFKFAIFNDFNSFKSLTSNNTAAVIIEII 174

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGE GV+PA   +++ + + C++K +L+I DEVQ G+GRTGK   ++HY + PDIITLAK
Sbjct: 175 QGESGVLPADSLFMKQLNEYCKQKDILIIVDEVQTGIGRTGKLYAHEHYQLSPDIITLAK 234

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
            LG G PIGAML K+ +  AF  G H +TFGGN L+  A+  T+  +    +L +    G
Sbjct: 235 GLGNGLPIGAMLGKKNLGHAFGYGSHGTTFGGNRLSLAAANQTLSIINDADLLNDVQSKG 294

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
           ++    L K       V EVR                +V      GL+I     NV+R L
Sbjct: 295 QFLIENLRKSLVNKRNVIEVRGVGLMVGIEVTNDPSQVVREAKRMGLIILTAGKNVIRLL 354

Query: 373 PPLIITKDEIDQAVQIL 389
           PPL ITK ++++ ++IL
Sbjct: 355 PPLTITKKQLEKGIEIL 371


>ARGD_STAES RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 375

 Score =  257 bits (656), Expect = 1e-70
 Identities = 148/377 (39%), Positives = 205/377 (54%), Gaps = 8/377 (2%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y+ N Y R  +  V      + D D   YLDF SGI V  LG  + E+ +AV  Q+  + 
Sbjct: 3   YLFNNYKRDNIEFVDANQNELIDKDNNVYLDFSSGIGVTNLGF-NMEIYQAVYNQLNLIW 61

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           H  N+Y    Q ++A+ L+       AFFCNSG EANE AIKLARK         K EII
Sbjct: 62  HSPNLYLSSIQEEVAQKLIGQRDY-LAFFCNSGTEANEAAIKLARK------ATGKSEII 114

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
               SFHGRT   ++ATGQ K      P+  GF +  FND  + K+    +T AV++E +
Sbjct: 115 AFKKSFHGRTYGAMSATGQKKITDQFGPVVPGFKFAIFNDFNSFKSLTSNNTAAVIIEII 174

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGE GV+PA   +++ + + C++K +L+I DEVQ G+GRTGK   ++HY + PDIITLAK
Sbjct: 175 QGESGVLPADPLFMKQLNEYCKQKDILIIVDEVQTGIGRTGKLYAHEHYQLSPDIITLAK 234

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
            LG G PIGAML K+ +  AF  G H +TFGGN L+  A+  T+  +    +L +    G
Sbjct: 235 GLGNGLPIGAMLGKKNLGHAFGYGSHGTTFGGNRLSLAAANQTLSIINDADLLNDVQSKG 294

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFL 372
           ++    L K       V EVR                +V      GL+I     NV+R L
Sbjct: 295 QFLIENLRKSLVNKRNVIEVRGVGLMVGIEVTNDPSQVVREAKRMGLIILTAGKNVIRLL 354

Query: 373 PPLIITKDEIDQAVQIL 389
           PPL ITK ++++ ++IL
Sbjct: 355 PPLTITKKQLEKGIEIL 371


>ARGD2_BORPA RecName: Full=Acetylornithine aminotransferase 2;      
             Short=ACOAT 2;         EC=2.6.1.11;
          Length = 396

 Score =  257 bits (656), Expect = 1e-70
 Identities = 158/377 (41%), Positives = 223/377 (59%), Gaps = 5/377 (1%)

Query: 23  MALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEP 82
           +  V+GQG+W+ D  G++YLDFV G AVN LGH  PE+  A+ +Q   L++ S  ++  P
Sbjct: 20  LVFVRGQGSWLEDHAGKRYLDFVQGWAVNTLGHCAPEMKRALAEQADKLMNPSPAFYNLP 79

Query: 83  QVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRT 142
            ++LA+ L   SC D+ FF NSGAEANEGAIKLARK+ + +     Y+IIT  + FHGRT
Sbjct: 80  SIELAQRLTSASCFDRVFFANSGAEANEGAIKLARKWGRVNRN-GAYKIITMNHGFHGRT 138

Query: 143 LATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAA 202
           LAT++A+G+  +     P  +GF     NDL++++  I   T AVMLEPVQGE GVIPA 
Sbjct: 139 LATMSASGKPGWDTMFAPQVEGFPKAEINDLDSVRALIDAQTVAVMLEPVQGEAGVIPAT 198

Query: 203 QAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGA 262
           + +++G+++L +E G+L I DEVQ G+GRTG    YQ + V PDI+T             
Sbjct: 199 REFMQGLRKLADEHGILFIVDEVQTGMGRTGSLFAYQQFDVIPDIMTXXXXXXXXXXXXX 258

Query: 263 MLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKL 322
              +E+V   F  GD   T+ GNPL A   +A  +T+   G +E A          L  L
Sbjct: 259 XXXREEVC-VFAHGDQGGTYNGNPLCAAVGVAVFDTITAPGFMEAAQARTRQLSEGLLAL 317

Query: 323 AAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQGLLINCTNGNVLRFLPPLIITK 379
           +A+                        IV        +GLL+N   GN+LRF+P L +T+
Sbjct: 318 SAKXXXXXXXXXXXXXXXXXXXXXXPAIVEAARMLAPEGLLLNAPRGNLLRFMPALNVTE 377

Query: 380 DEIDQAVQILKRAMLVV 396
            ++ + ++ L   +  V
Sbjct: 378 ADMARMLEQLDGVIAAV 394


>OAT_PLACH RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 414

 Score =  254 bits (650), Expect = 7e-70
 Identities = 138/389 (35%), Positives = 217/389 (55%), Gaps = 7/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP++  A+  Q K L
Sbjct: 19  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPDILNAMINQAKNL 78

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YAKQHLGPDKY 129
             CS  ++        + L      DK    N+GAEANE A KL RK  Y  + +  +  
Sbjct: 79  TICSRAFFSVSLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMA 138

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI-GPHTCAVM 188
           +I+   N+F GRTL  ++A+   K      P    F+ VP+NDLEAL+  +  P+ C  +
Sbjct: 139 KIVVCKNNFSGRTLGCISASTTNKCTSNFGPFAPQFSKVPYNDLEALEEELKDPNVCGFI 198

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EPVQGE GVI  +  YL GV  LC++  +L + DEVQ GLGRTGK L   HY V+PD++
Sbjct: 199 VEPVQGEAGVIVPSDNYLPGVYNLCKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVV 258

Query: 249 TLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            L KAL GG +PI A+LA + V    +PG+H ST+GGNPLAA+  + ++  L+ + + EN
Sbjct: 259 LLGKALSGGHYPISAVLANDSVMLVIKPGEHGSTYGGNPLAASICVESLNVLINEKLCEN 318

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCT 364
           A ++G  F   L K   +  +++++R               +++  CL   E GL+    
Sbjct: 319 ADKLGGPFLEGLKKELKDSKIIRDIRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDV 378

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 379 HDKTIRLTPPLCITKEQLDECTEIIVKTV 407


>ARGD_MYCTU RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 400

 Score =  254 bits (649), Expect = 9e-70
 Identities = 148/383 (38%), Positives = 193/383 (50%), Gaps = 13/383 (3%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Q  +MN YG  P+AL  G GA V D DGR Y+D + GIAVN LGH HP V EAV +Q+ T
Sbjct: 16  QAVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMST 75

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           L H SN+Y  EP +            D   + FFCNSGAEANE A KL+R   +  L   
Sbjct: 76  LGHTSNLYATEPGIXXXXXXXXXXXXDQRTRVFFCNSGAEANEAAFKLSRLTGRTKL--- 132

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
               + A ++FHGRT+ ++  TGQ   Q    PLP    +V +                 
Sbjct: 133 ----VAAHDAFHGRTMGSLALTGQPAKQTPFAPLPGDVTHVGYGXXXXXXXXXXXXXXXX 188

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
            LEP+ GE GV+     YL   + +   +G LL+ DEVQ G+GRTG F  +QH G+ PD+
Sbjct: 189 FLEPIMGESGVVVPPAGYLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQHDGITPDV 248

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
           +TLAK LGGG PIGA LA    A+   PG H STFGGNP                G++  
Sbjct: 249 VTLAKGLGGGLPIGACLAVGPAAELLTPGLHGSTFGGNPXXXXXXXXXXXXXXSDGLVRR 308

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVR-XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNG 366
           A  +G+  +  +  L    PL+  VR               KD  A   + G L+N    
Sbjct: 309 AEVLGKSLRHGIEALGH--PLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYLVNAAAP 366

Query: 367 NVLRFLPPLIITKDEIDQAVQIL 389
           +V+R  PPLII + ++D  V  L
Sbjct: 367 DVIRLAPPLIIAEAQLDGFVAAL 389


>ARGD_MYCBO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 400

 Score =  254 bits (649), Expect = 9e-70
 Identities = 148/383 (38%), Positives = 193/383 (50%), Gaps = 13/383 (3%)

Query: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Q  +MN YG  P+AL  G GA V D DGR Y+D + GIAVN LGH HP V EAV +Q+ T
Sbjct: 16  QAVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMST 75

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCAD---KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           L H SN+Y  EP +            D   + FFCNSGAEANE A KL+R   +  L   
Sbjct: 76  LGHTSNLYATEPGIXXXXXXXXXXXXDQRTRVFFCNSGAEANEAAFKLSRLTGRTKL--- 132

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
               + A ++FHGRT+ ++  TGQ   Q    PLP    +V +                 
Sbjct: 133 ----VAAHDAFHGRTMGSLALTGQPAKQTPFAPLPGDVTHVGYGXXXXXXXXXXXXXXXX 188

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
            LEP+ GE GV+     YL   + +   +G LL+ DEVQ G+GRTG F  +QH G+ PD+
Sbjct: 189 FLEPIMGESGVVVPPAGYLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQHDGITPDV 248

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
           +TLAK LGGG PIGA LA    A+   PG H STFGGNP                G++  
Sbjct: 249 VTLAKGLGGGLPIGACLAVGPAAELLTPGLHGSTFGGNPXXXXXXXXXXXXXXSDGLVRR 308

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVR-XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNG 366
           A  +G+  +  +  L    PL+  VR               KD  A   + G L+N    
Sbjct: 309 AEVLGKSLRHGIEALGH--PLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYLVNAAAP 366

Query: 367 NVLRFLPPLIITKDEIDQAVQIL 389
           +V+R  PPLII + ++D  V  L
Sbjct: 367 DVIRLAPPLIIAEAQLDGFVAAL 389


>ARGD_STRCL RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 400

 Score =  254 bits (648), Expect = 1e-69
 Identities = 142/390 (36%), Positives = 207/390 (53%), Gaps = 9/390 (2%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           M+NQE     Q  ++++YG   ++ V+G+G+ +WDADG  Y DFVSG+AVN LGHAHP V
Sbjct: 1   MSNQEFAQRWQGVMIDSYGTPGLSFVRGEGSTLWDADGTAYTDFVSGLAVNALGHAHPAV 60

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKY 119
             AV +Q+ +L H SN Y  EP + LA+ L+E      + FFCNSGAEANE A K+ R  
Sbjct: 61  VGAVSRQIASLGHISNFYSAEPTITLAERLIELFGRPGRVFFCNSGAEANETAFKIGRLT 120

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
            +         I+ A + FHGRT+ ++  TGQ   +    PLP    +VP+ D EAL+  
Sbjct: 121 GRSR-------IVAAQSGFHGRTMGSLALTGQPAKREPFLPLPGDVTHVPYGDAEALRAA 173

Query: 180 IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
           +   T  V+LEP+QGE GV+   + YL   +++ E  G LL+ DEVQ G+GRTG +   Q
Sbjct: 174 VTEDTAMVILEPIQGESGVVVPPKGYLRAAREITEATGTLLVLDEVQTGIGRTGHWFAAQ 233

Query: 240 HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
             GVE D++T                  + A+   PG HASTFGGNP++  A    ++T+
Sbjct: 234 AEGVEADVVTXXXXXXXXXXXXXXXXXXRAAELMTPGHHASTFGGNPVSC-ARTRVLDTI 292

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGL 359
              G+L+   Q+G        + AA +                       +     + G 
Sbjct: 293 AADGLLDRVKQLGSAPDEWSVRDAAAIRWSPMSGAGLMLGIVLNEPLAPQVQLAAQKAGF 352

Query: 360 LINCTNGNVLRFLPPLIITKDEIDQAVQIL 389
           L+N    +V+R +PPL+I + E+D  +Q L
Sbjct: 353 LVNVPAPDVVRLIPPLVIEETEVDAFLQAL 382


>ARGD_SCHPO RecName: Full=Probable acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 441

 Score =  253 bits (645), Expect = 3e-69
 Identities = 127/324 (39%), Positives = 189/324 (58%), Gaps = 11/324 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +++ Y R P+   KG+G++++D +GR+Y+DF SG+AV  LGHAHPEVA     Q   L+H
Sbjct: 47  IISVYARYPVVAAKGEGSYLFDKEGRKYIDFTSGVAVTSLGHAHPEVARLAADQCSKLVH 106

Query: 74  CSNIYWIEPQVKLAKLLVENSCAD--------KAFFCNSGAEANEGAIKLARKYAKQHLG 125
            SN+++ EP ++L+ + + NS A         K FF N G EANE A+K ARK A +  G
Sbjct: 107 SSNLFYNEPAIELSNV-INNSLAKNSGIAGPTKIFFANCGTEANETALKFARKAAFEKYG 165

Query: 126 PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTC 185
             K +I+   NSFHGR+L +++ T   KY+RG  PL        +ND  +++  +   T 
Sbjct: 166 EGKSQIVYFNNSFHGRSLGSLSITANPKYKRGFQPLLPDVVQAVYNDPASIEQFVNDKTA 225

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYG--V 243
           AV++EPVQGEGG+ PA   +L  +++ C++ G  LI+DE+QCGLGR+G    +       
Sbjct: 226 AVIVEPVQGEGGICPAKPEFLIALRKACDKVGASLIYDEIQCGLGRSGDLWAHSIVKDVA 285

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKG 303
            PDIIT+AK L  G PIGA +   ++A    PG+H STFGGNP+A       +  L    
Sbjct: 286 SPDIITVAKPLANGLPIGATIVSSKIAAEIHPGEHGSTFGGNPVACRVGTFCVNELGSSK 345

Query: 304 VLENAWQMGEYFKAELTKLAAEVP 327
           +L+N  +  +   +      A+ P
Sbjct: 346 ILQNVRKQHKALTSRFDDFVAKYP 369


>OAT_OCEIH RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 398

 Score =  252 bits (644), Expect = 3e-69
 Identities = 138/384 (35%), Positives = 210/384 (54%), Gaps = 5/384 (1%)

Query: 13  YVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL 72
           Y  + Y  LP+ + +  G WV D +G  Y+D +S  +    GH HP++ EA+  Q   + 
Sbjct: 15  YGAHNYHPLPIVVSEANGVWVKDPEGNSYMDMLSAYSAVNQGHRHPKIIEALKNQADKVT 74

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG--PDKYE 130
             S  +  E      K + + +  DK    N+G EA E AIK AR++A Q  G   ++ E
Sbjct: 75  LTSRAFHNELLGPWTKRMAKLTKKDKVLPMNTGVEAVETAIKAARRWAYQVKGVTENQAE 134

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190
           II A  +FHGRTL  ++ +      +   P   G   V + D+ A++  I  +T A++LE
Sbjct: 135 IIAADGNFHGRTLNAISLSNDPDATKNYGPFVPGINKVSYGDINAIEKAITENTAAIILE 194

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+QGE G+I   + YL+ V++LC EK +L I DEVQ G  RTGK    +   VEPDI  +
Sbjct: 195 PIQGEAGIIIPPEGYLKKVRELCSEKNILFIADEVQTGFARTGKMFACEWENVEPDIYVM 254

Query: 251 AKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAW 309
            KALGGG FP+ A+ A  ++   F PG H STFGGNPLA   S+A ++ + ++ ++  + 
Sbjct: 255 GKALGGGVFPVSAIAANNEIMDVFTPGSHGSTFGGNPLACAVSMAAIDVIEEENLVNKSL 314

Query: 310 QMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVL 369
           + G+YF  +L   A     +KEVR              ++I     ++G+L   T+ N +
Sbjct: 315 ESGKYFADKLR--AVNFEGIKEVRARGLFIGMEFHQPVREICEKLKDKGILCKETHVNTI 372

Query: 370 RFLPPLIITKDEIDQAVQILKRAM 393
           RF PPL+ITKDE+D A+Q ++  +
Sbjct: 373 RFAPPLVITKDEMDWAIQRIEEVL 396


>OAT_CAEEL RecName: Full=Probable ornithine aminotransferase,
           mitochondrial;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 422

 Score =  252 bits (643), Expect = 4e-69
 Identities = 137/393 (34%), Positives = 222/393 (56%), Gaps = 4/393 (1%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           + +Q+I    +++  + Y  LP+AL KG+G +VWD +G++Y DF++  +    GH HP++
Sbjct: 19  LTSQQIFDREKKFGCHNYKPLPVALSKGEGCFVWDVEGKKYFDFLAAYSAVNQGHCHPKL 78

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYA 120
            + V +Q  TL   S  ++     +  + + +    DK    N+G EA E A+KLAR++A
Sbjct: 79  LKVVQEQASTLTLTSRAFYNNVLGEYEEYVTKLFKYDKVLPMNTGVEACESAVKLARRWA 138

Query: 121 KQHLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKN 178
               G    E  ++ A N+F GR++A ++A+          P   GF  VP+N+L+A+++
Sbjct: 139 YDVKGVKDNEAVVVFAENNFWGRSIAAISASTDPDSFARFGPFVPGFKTVPYNNLKAVED 198

Query: 179 TI-GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLG 237
            I   +  A M+EP+QGE GV+     YL+GV  LC++  +L I DEVQ GLGR+GK L 
Sbjct: 199 AIKDKNVAAFMVEPIQGEAGVVLPDPGYLKGVSDLCKKYNVLFITDEVQSGLGRSGKLLA 258

Query: 238 YQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATM 296
           + H  V PDI+ L KAL GGF P+ A+L  + V    +PG+H ST+GGNPLA   ++A +
Sbjct: 259 HYHDNVRPDIVVLGKALSGGFYPVSAVLCDDNVMMNIKPGEHGSTYGGNPLACKVAIAAL 318

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLE 356
           E L ++ ++EN+  MG+   ++L  L  ++      +                +     E
Sbjct: 319 EILQEEKLVENSAVMGDLLMSKLKTLPKDIVSTVRGKGLFCAIVINKKYDAWKVCLKLKE 378

Query: 357 QGLLINCTNGNVLRFLPPLIITKDEIDQAVQIL 389
            GLL   T+G+++RF PPL I K++++QA  I+
Sbjct: 379 NGLLAKNTHGDIIRFAPPLCINKEQVEQAADII 411


>ARGD_KLULA RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 423

 Score =  252 bits (643), Expect = 4e-69
 Identities = 145/399 (36%), Positives = 222/399 (55%), Gaps = 17/399 (4%)

Query: 11  QQYVMNTYGRLP-MALVKGQGAWVWD-ADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV 68
           Q+Y   TY R   + L +G+ A ++D  + ++Y+DF +GIAV  LGHA+PEVAE + KQ 
Sbjct: 21  QKYQATTYARPNHLVLTRGKNAILYDDVNNKEYIDFTAGIAVTALGHANPEVAEIMYKQS 80

Query: 69  KTLLHCSNIYWIEPQVKLAKLLVENS-------CADKAFFCNSGAEANEGAIKLARKYAK 121
           K L+H SN+Y+ E  +KL++ LVE +        A + F CNSG EANE A+K A++Y  
Sbjct: 81  KKLIHSSNLYYNEECLKLSENLVEATKSFGGQYDASRVFLCNSGTEANEAALKFAKRYGI 140

Query: 122 QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFND----LEALK 177
               P K  II   NSFHGRT+  ++ T   KY+     L  G  ++  ND    L+   
Sbjct: 141 LK-SPSKQGIIAFQNSFHGRTMGALSVTSNPKYREPFGSLIPGVEFLNINDELTKLDQQV 199

Query: 178 NTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLG 237
           +++   T  +++EP+QGEGGV P     L G+K++CE+  +++I+DE+QCGLGR+GK   
Sbjct: 200 SSLKEKTAGLIVEPIQGEGGVFPIPLDTLVGLKKICEDHDIIVIYDEIQCGLGRSGKLWA 259

Query: 238 YQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLAT 295
           + +   E  PDI T AKALG GFPI A +  ++V    + GDH +T+GGNPL +      
Sbjct: 260 HSYLPKEAHPDIFTTAKALGNGFPIAATVTNDKVNDILKVGDHGTTYGGNPLGSAVGNYV 319

Query: 296 METLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHC 354
           +  + ++  L+   + GE     L KL    P  +K++R                IV   
Sbjct: 320 VNVIAEQKFLDEVNKKGEIITNRLRKLQERFPEHIKDIRGKGLMIGCDFDEAPAKIVDAA 379

Query: 355 LEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            + GLLI       +RF+P L I  + +++ + I ++A+
Sbjct: 380 RDSGLLIITAGKTTVRFVPALTIEDNLLEKGLNIFEKAV 418


>OAT_BRAJA RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 404

 Score =  251 bits (642), Expect = 6e-69
 Identities = 142/389 (36%), Positives = 208/389 (53%), Gaps = 8/389 (2%)

Query: 5   EILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV 64
           + LA   +   + Y  + + L +G+G WVWD DG +YLD +S  +    GH HP++  A+
Sbjct: 7   DYLATETRLGAHNYEPIGVVLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAM 66

Query: 65  CKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHL 124
            +Q   L   S  +  +      + +   + + K    NSGAEA E AIK  RK+  +  
Sbjct: 67  VEQAHRLTLTSRAFHNDQLAPFYEEIAALTGSHKVLPMNSGAEAVESAIKSVRKWGYEVK 126

Query: 125 G--PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGP 182
           G   D+ EII   ++FHGRTL  V  +   + +    P   GF  +PF D  AL+  I P
Sbjct: 127 GVPDDQAEIIVCADNFHGRTLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQAITP 186

Query: 183 HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYG 242
           +T A ++EP+QGE GVI     Y   V++LC    ++L+ DE+Q GLGRTGK L  QH G
Sbjct: 187 NTVAFLVEPIQGEAGVIIPPAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEG 246

Query: 243 VEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQ 301
           +E D+  L KAL GGF P+ A+L+  +V    +PG H STFGGNPLA   + A M  L++
Sbjct: 247 IEADVTLLGKALAGGFYPVSAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVE 306

Query: 302 KGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQG 358
           +G++ENA + G      L  + A    V+EVR                   +C     +G
Sbjct: 307 EGMIENAARQGARLLEGLKDIRANT--VREVRGRGLMLAVELHPEAGRARRYCEALQGKG 364

Query: 359 LLINCTNGNVLRFLPPLIITKDEIDQAVQ 387
           +L   T+G+ +R  PPL+IT DE+D A++
Sbjct: 365 ILAKDTHGHTIRIAPPLVITSDEVDWALE 393


>OAT1_STAS1 RecName: Full=Ornithine aminotransferase 1;       
           Short=OAT 1;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase 1;
          Length = 394

 Score =  251 bits (641), Expect = 8e-69
 Identities = 136/385 (35%), Positives = 211/385 (54%), Gaps = 5/385 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y    Y  L +AL KG+GA VWD +   Y+D +SG +V   GH HP++ +A+ +Q + +
Sbjct: 10  KYSSKNYSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQRI 69

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAK--QHLGPDKY 129
              S   + +   K  + + + +  +     N+G EA E AIK+ARK+    +++     
Sbjct: 70  TMVSRALYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMARKWGADIKNIDESSS 129

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVML 189
           EII    +FHGRTL +++ + Q  Y++G  PL     Y  F D+E LK  I   T A++L
Sbjct: 130 EIIAMNGNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQTTAIIL 189

Query: 190 EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI-I 248
           EP+QGEGGV      +++ V+QLC E  +LLI DE+Q GLGRTGK    +    EPDI  
Sbjct: 190 EPIQGEGGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEWENTEPDIYX 249

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENA 308
                    +PI A+LA + V     PG H STFGGNPLA   S+A ++ L ++ +++NA
Sbjct: 250 XXXXXXXXXYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEEHLVQNA 309

Query: 309 WQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNV 368
             +G+     L ++ +E  L+ EVR              +D     + +G+L   T GN+
Sbjct: 310 LDLGDRLLKHLQQIESE--LIVEVRGRGLFIGIELNVAAQDYCEQMINKGVLCKETQGNI 367

Query: 369 LRFLPPLIITKDEIDQAVQILKRAM 393
           +R  PPL+I KDEID+ ++++   +
Sbjct: 368 IRIAPPLVIDKDEIDEVIRVITEVL 392


>OAT_BACCQ RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  250 bits (638), Expect = 2e-68
 Identities = 138/403 (34%), Positives = 217/403 (53%), Gaps = 19/403 (4%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +  ++I+ +   Y  N Y  LP+ + K +G WV D +G +Y+D +S  +    GH HP++
Sbjct: 2   IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKI 61

Query: 61  AEAVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAI 113
             A+  Q   +   S  +       W E   KL          +     N+GAEA E AI
Sbjct: 62  INALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTN-------KEMVLPMNTGAEAVETAI 114

Query: 114 KLARKYAK--QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN 171
           K AR++A   + +  ++ EII   ++FHGRT+  V+ +   +Y+RG  P+  G   +P+ 
Sbjct: 115 KTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIVVIPYG 174

Query: 172 DLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGR 231
           DLEALK  I P+T A +LEP+QGE G+      +L+   ++C+++ +L + DE+Q GLGR
Sbjct: 175 DLEALKAAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGR 234

Query: 232 TGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           TGK       GV PD+  L KALGGG FPI  + A   +   F+PG H STFGGNPLA  
Sbjct: 235 TGKVFACDWDGVTPDMYILGKALGGGVFPISCVAANRDILGVFEPGSHGSTFGGNPLACA 294

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            S+A +E L ++ + E + Q+GE    +L ++  + P++ EVR              +  
Sbjct: 295 VSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPARPY 352

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  GLL   T+ NV+R  PPL+I++++++ A Q +K  +
Sbjct: 353 CEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVL 395


>OAT_BACC3 RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  247 bits (631), Expect = 1e-67
 Identities = 137/403 (33%), Positives = 216/403 (53%), Gaps = 19/403 (4%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +  ++I+ +   Y  N Y  LP+ + K +G WV D +G +Y+D +S  +    GH HP++
Sbjct: 2   IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKI 61

Query: 61  AEAVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAI 113
             A+  Q   +   S  +       W E   KL          +     N+GAEA E AI
Sbjct: 62  INALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTN-------KEMVLPMNTGAEAVETAI 114

Query: 114 KLARKYAK--QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN 171
           K AR++A   + +  ++ EII   ++FHGRT+  V+ +   +Y+RG  P+  G   +P+ 
Sbjct: 115 KTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYG 174

Query: 172 DLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGR 231
           DLEALK  I P+T A +LEP+QGE G+      +L+   ++C+++ +L + DE+Q GLGR
Sbjct: 175 DLEALKAAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGR 234

Query: 232 TGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           TGK        V PD+  L KALGGG FPI  + A   +   F+PG H STFGGNPLA  
Sbjct: 235 TGKVFACDWDNVTPDMYILGKALGGGVFPISCVAANRDILGVFEPGSHGSTFGGNPLACA 294

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            S+A +E L ++ + E + Q+GE    +L ++  + P++ EVR              +  
Sbjct: 295 VSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPARPY 352

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  GLL   T+ NV+R  PPL+I++++++ A Q +K  +
Sbjct: 353 CEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVL 395


>OAT_BACAN RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  246 bits (629), Expect = 2e-67
 Identities = 137/403 (33%), Positives = 215/403 (53%), Gaps = 19/403 (4%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +  ++I+ +   Y  N Y  LP+ + K +G WV D +G +Y+D +S  +    GH HP++
Sbjct: 2   IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKI 61

Query: 61  AEAVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAI 113
             A+  Q   +   S  +       W E   KL          +     N+GAEA E AI
Sbjct: 62  INALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTN-------KEMVLPMNTGAEAVETAI 114

Query: 114 KLARKYAK--QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN 171
           K AR++A   + +  ++ EII   ++FHGRT+  V+ +   +Y+RG  P+  G   +P+ 
Sbjct: 115 KTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYG 174

Query: 172 DLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGR 231
           DLEALK  I P+T A +LEP+QGE G+      +L+   ++C+++ +L + DE+Q GLGR
Sbjct: 175 DLEALKAAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGR 234

Query: 232 TGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           TGK        V PD+  L KALGGG FPI    A   +   F+PG H STFGGNPLA  
Sbjct: 235 TGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACA 294

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            S+A +E L ++ + E + Q+GE    +L ++  + P++ EVR              +  
Sbjct: 295 VSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPARPY 352

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  GLL   T+ NV+R  PPL+I++++++ A Q +K  +
Sbjct: 353 CEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVL 395


>OAT_BACAC RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  246 bits (629), Expect = 2e-67
 Identities = 137/403 (33%), Positives = 215/403 (53%), Gaps = 19/403 (4%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +  ++I+ +   Y  N Y  LP+ + K +G WV D +G +Y+D +S  +    GH HP++
Sbjct: 2   IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKI 61

Query: 61  AEAVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAI 113
             A+  Q   +   S  +       W E   KL          +     N+GAEA E AI
Sbjct: 62  INALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTN-------KEMVLPMNTGAEAVETAI 114

Query: 114 KLARKYAK--QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN 171
           K AR++A   + +  ++ EII   ++FHGRT+  V+ +   +Y+RG  P+  G   +P+ 
Sbjct: 115 KTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYG 174

Query: 172 DLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGR 231
           DLEALK  I P+T A +LEP+QGE G+      +L+   ++C+++ +L + DE+Q GLGR
Sbjct: 175 DLEALKAAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGR 234

Query: 232 TGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           TGK        V PD+  L KALGGG FPI    A   +   F+PG H STFGGNPLA  
Sbjct: 235 TGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACA 294

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            S+A +E L ++ + E + Q+GE    +L ++  + P++ EVR              +  
Sbjct: 295 VSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPARPY 352

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  GLL   T+ NV+R  PPL+I++++++ A Q +K  +
Sbjct: 353 CEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVL 395


>OAT_BACAA RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  246 bits (629), Expect = 2e-67
 Identities = 137/403 (33%), Positives = 215/403 (53%), Gaps = 19/403 (4%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +  ++I+ +   Y  N Y  LP+ + K +G WV D +G +Y+D +S  +    GH HP++
Sbjct: 2   IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKI 61

Query: 61  AEAVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAI 113
             A+  Q   +   S  +       W E   KL          +     N+GAEA E AI
Sbjct: 62  INALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTN-------KEMVLPMNTGAEAVETAI 114

Query: 114 KLARKYAK--QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN 171
           K AR++A   + +  ++ EII   ++FHGRT+  V+ +   +Y+RG  P+  G   +P+ 
Sbjct: 115 KTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYG 174

Query: 172 DLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGR 231
           DLEALK  I P+T A +LEP+QGE G+      +L+   ++C+++ +L + DE+Q GLGR
Sbjct: 175 DLEALKAAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGR 234

Query: 232 TGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           TGK        V PD+  L KALGGG FPI    A   +   F+PG H STFGGNPLA  
Sbjct: 235 TGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACA 294

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            S+A +E L ++ + E + Q+GE    +L ++  + P++ EVR              +  
Sbjct: 295 VSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPARPY 352

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  GLL   T+ NV+R  PPL+I++++++ A Q +K  +
Sbjct: 353 CEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVL 395


>OAT_BORPE RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 411

 Score =  245 bits (626), Expect = 4e-67
 Identities = 141/376 (37%), Positives = 198/376 (52%), Gaps = 9/376 (2%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           + Y  L + L +G G W++D  GR+YLD +S  +    GH HP +  A+ +Q + L   S
Sbjct: 19  HNYQPLDVVLARGSGVWLYDTAGRRYLDCLSAYSAVNQGHCHPRILAAMVEQAQRLTLTS 78

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG--PDKYEIIT 133
             +  +    L + L   + A K    NSGAEA E A+K  RK+  +  G    + EII 
Sbjct: 79  RAFRHDQLAPLYEDLARLTGAHKVLPMNSGAEAVETALKAVRKWGYEARGVPAGQAEIIV 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             N+FHGRTL  V  +     + G  P   GF  VPF D  AL+  + P T A ++EP+Q
Sbjct: 139 CANNFHGRTLGIVGFSTDPDARGGYGPFAPGFTVVPFGDFAALQAAVTPRTVAFLVEPIQ 198

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GVI     Y   V++LC E+ ++LI DE+Q GLGRTG FL   H G+E D+  + KA
Sbjct: 199 GEAGVILPPPGYFRQVRKLCSERDIVLILDEIQTGLGRTGAFLAEAHEGIEADVTLIGKA 258

Query: 254 LGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           L GGF P+ A+L+ + V   FQPG H STFGGNP               +G+++NA + G
Sbjct: 259 LSGGFYPVSAVLSNQAVLGIFQPGQHGSTFGGNPXXXXXXXXXXXXXHDEGMIDNAREQG 318

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQGLLINCTNGNVL 369
            YF   L  L      V+EVR                  A+C   + +G+L+  T+G  L
Sbjct: 319 AYFMQRLRALPGP---VREVRGRGLMLALELEPDAGPARAYCERLMARGMLVKDTHGQTL 375

Query: 370 RFLPPLIITKDEIDQA 385
           R  PPLI+T+++ID A
Sbjct: 376 RLSPPLIVTREQIDWA 391


>OAT_BORPA RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 411

 Score =  245 bits (626), Expect = 4e-67
 Identities = 141/376 (37%), Positives = 198/376 (52%), Gaps = 9/376 (2%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           + Y  L + L +G G W++D  GR+YLD +S  +    GH HP +  A+ +Q + L   S
Sbjct: 19  HNYQPLDVVLARGSGVWLYDTAGRRYLDCLSAYSAVNQGHCHPRILAAMVEQAQRLTLTS 78

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG--PDKYEIIT 133
             +  +    L + L   + A K    NSGAEA E A+K  RK+  +  G    + EII 
Sbjct: 79  RAFRHDQLAPLYEDLARLTGAHKVLPMNSGAEAVETALKAVRKWGYEARGVPAGQAEIIV 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             N+FHGRTL  V  +     + G  P   GF  VPF D  AL+  + P T A ++EP+Q
Sbjct: 139 CANNFHGRTLGIVGFSTDPDARGGYGPFAPGFTVVPFGDFAALQAAVTPRTVAFLVEPIQ 198

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GVI     Y   V++LC E+ ++LI DE+Q GLGRTG FL   H G+E D+  + KA
Sbjct: 199 GEAGVILPPPGYFRQVRKLCSERDIVLILDEIQTGLGRTGAFLAEAHEGIEADVTLIGKA 258

Query: 254 LGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           L GGF P+ A+L+ + V   FQPG H STFGGNP               +G+++NA + G
Sbjct: 259 LSGGFYPVSAVLSNQAVLGIFQPGQHGSTFGGNPXXXXXXXXXXXXXHDEGMIDNAREQG 318

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQGLLINCTNGNVL 369
            YF   L  L      V+EVR                  A+C   + +G+L+  T+G  L
Sbjct: 319 AYFMQRLRALPGP---VREVRGRGLMLALELEPDAGPARAYCERLMARGMLVKDTHGQTL 375

Query: 370 RFLPPLIITKDEIDQA 385
           R  PPLI+T+++ID A
Sbjct: 376 RLSPPLIVTREQIDWA 391


>OAT_BORBR RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 411

 Score =  245 bits (626), Expect = 4e-67
 Identities = 141/376 (37%), Positives = 198/376 (52%), Gaps = 9/376 (2%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           + Y  L + L +G G W++D  GR+YLD +S  +    GH HP +  A+ +Q + L   S
Sbjct: 19  HNYQPLDVVLARGSGVWLYDTAGRRYLDCLSAYSAVNQGHCHPRILAAMVEQAQRLTLTS 78

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG--PDKYEIIT 133
             +  +    L + L   + A K    NSGAEA E A+K  RK+  +  G    + EII 
Sbjct: 79  RAFRHDQLAPLYEDLARLTGAHKVLPMNSGAEAVETALKAVRKWGYEARGVPAGQAEIIV 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQ 193
             N+FHGRTL  V  +     + G  P   GF  VPF D  AL+  + P T A ++EP+Q
Sbjct: 139 CANNFHGRTLGIVGFSTDPDARGGYGPFAPGFTVVPFGDFAALQAAVTPRTVAFLVEPIQ 198

Query: 194 GEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKA 253
           GE GVI     Y   V++LC E+ ++LI DE+Q GLGRTG FL   H G+E D+  + KA
Sbjct: 199 GEAGVILPPPGYFRQVRKLCSERDIVLILDEIQTGLGRTGAFLAEAHEGIEADVTLIGKA 258

Query: 254 LGGGF-PIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMG 312
           L GGF P+ A+L+ + V   FQPG H STFGGNP               +G+++NA + G
Sbjct: 259 LSGGFYPVSAVLSNQAVLGIFQPGQHGSTFGGNPXXXXXXXXXXXXXHDEGMIDNAREQG 318

Query: 313 EYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC---LEQGLLINCTNGNVL 369
            YF   L  L      V+EVR                  A+C   + +G+L+  T+G  L
Sbjct: 319 AYFMQRLRALPGP---VREVRGRGLMLALELEPDAGPARAYCERLMARGMLVKDTHGQTL 375

Query: 370 RFLPPLIITKDEIDQA 385
           R  PPLI+T+++ID A
Sbjct: 376 RLSPPLIVTREQIDWA 391


>OAT_BACCR RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 396

 Score =  245 bits (626), Expect = 4e-67
 Identities = 136/403 (33%), Positives = 215/403 (53%), Gaps = 19/403 (4%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +  ++I+ +   Y  N Y  LP+ + K +G WV D +G +Y+D +S  +    GH HP++
Sbjct: 2   IQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKI 61

Query: 61  AEAVCKQVKTLLHCSNIY-------WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAI 113
             A+  Q   +   S  +       W E   KL          +     N+GAEA E AI
Sbjct: 62  INALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTN-------KEMVLPMNTGAEAVETAI 114

Query: 114 KLARKYAK--QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN 171
           K  R++A   + +  ++ EII   ++FHGRT+ +V+ +   +Y+RG  P+  G   +P+ 
Sbjct: 115 KTVRRWAYDVKKVEANRAEIIVCEDNFHGRTMGSVSMSSNEEYKRGFGPMLPGIVVIPYG 174

Query: 172 DLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGR 231
           DLEALK  I P+T A +LEP+QGE G+      YL+   ++C+++ +L + DE+Q GL R
Sbjct: 175 DLEALKAAITPNTAAFILEPIQGEAGINIPPAGYLKEAFEVCKKENVLFVADEIQTGLSR 234

Query: 232 TGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           TGK        V PD+  L KALGGG FPI  + A   +   F+PG H STFGGNPLA  
Sbjct: 235 TGKVFACDWDNVTPDMYILGKALGGGVFPISCVAANRDILGVFEPGSHGSTFGGNPLACA 294

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            S+A +E L ++ + E + Q+GE    +L ++  + P++ EVR              +  
Sbjct: 295 VSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPARPY 352

Query: 351 VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  GLL   T+ NV+R  PPL+I++++++ A Q +K  +
Sbjct: 353 CEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVL 395


>ARGD_BIFLO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 431

 Score =  244 bits (624), Expect = 7e-67
 Identities = 152/404 (37%), Positives = 212/404 (52%), Gaps = 28/404 (6%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q  MN +G     +  GQGA +WD DG +YLDF++GIAVN LG+AHP             
Sbjct: 22  QVHMNVFGTPLRVMDHGQGAHIWDVDGNEYLDFLAGIAVNSLGYAHPXXXXXXXXXXXXX 81

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCA---DKAFFCNSGAEANEGAIKLARKY------AKQ 122
            H SN +  EPQ++LA  LV+ + A    K +F NSGAE NE A+KLA+ Y      A  
Sbjct: 82  XHISNYFASEPQIELASKLVKLAGAPEGSKVYFGNSGAEGNEAALKLAKLYGRTLPGALP 141

Query: 123 HLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI-- 180
            +G     I+  T+ FHGRT+  ++AT +   ++  DPL     +V   D  AL +    
Sbjct: 142 SIGGKPARILAMTHGFHGRTMGALSATWKPGIRKPYDPLVPNIEFVRAGDKVALHDAFAQ 201

Query: 181 --------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
                   GP   AV+LE +QGE GV P    Y++ V++LC+    LLI DEVQ G+GRT
Sbjct: 202 TGLGRYGKGP-VAAVILELIQGEAGVQPLGADYVKFVRELCDINHALLIIDEVQTGIGRT 260

Query: 233 GKFLGYQH----YGVEPDIITLAKALGGGFPIGAMLA-KEQVAQAFQPGDHASTFGGNPL 287
           GK+  +Q      GV PD++T AK + GGFP+G M+A  E++A  F PG H STF     
Sbjct: 261 GKWFAFQRDDLSGGVTPDMVTFAKGVAGGFPMGGMIAFGEKLAALFTPGSHGSTFXXXXX 320

Query: 288 AATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXX 347
                    + +  + ++ NA   GE  +  +  +A   PL   VR              
Sbjct: 321 XXXXXXXXXDVIEDENLVANAEARGEQLRDGI--MATGNPLFVSVRGRGLLDAVELKHPC 378

Query: 348 KD-IVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
              ++ +CLE GL++N    N LRF PPLI+T  ++DQA+ ILK
Sbjct: 379 SHAVMNYCLEHGLIVNAVAPNALRFAPPLIVTAQDVDQALAILK 422


>ARGD_YEAST RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 423

 Score =  243 bits (621), Expect = 2e-66
 Identities = 136/400 (34%), Positives = 224/400 (56%), Gaps = 17/400 (4%)

Query: 13  YVMNTYGRLP-MALVKGQGAWVWD-ADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           + + TY R   + + +G+ A ++D  +G++Y+DF +GIAV  LGHA+P+VAE +  Q   
Sbjct: 23  FQVTTYSRPEDLCITRGKNAKLYDDVNGKEYIDFTAGIAVTALGHANPKVAEILHHQANK 82

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSC-------ADKAFFCNSGAEANEGAIKLARKYAKQH 123
           L+H SN+Y+ +  + L++ +VE +        A + F CNSG EANE A+K A+K+    
Sbjct: 83  LVHSSNLYFTKECLDLSEKIVEKTKQFGGQHDASRVFLCNSGTEANEAALKFAKKHGIMK 142

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFND----LEALKNT 179
             P K  I+   NSFHGRT+  ++ T  +KY+     L    +++  ND    L++   T
Sbjct: 143 -NPSKQGIVAFENSFHGRTMGALSVTWNSKYRTPFGDLVPHVSFLNLNDEMTKLQSYIET 201

Query: 180 IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                  +++EP+QGEGGV P     L G+K++C++  +++I DE+QCGLGR+GK   + 
Sbjct: 202 KKDEIAGLIVEPIQGEGGVFPVEVEKLTGLKKICQDNDVIVIHDEIQCGLGRSGKLWAHA 261

Query: 240 HYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME 297
           +   E  PDI T AKALG GFPI A +  E+V  A + GDH +T+GGNPLA + S   ++
Sbjct: 262 YLPSEAHPDIFTSAKALGNGFPIAATIVNEKVNNALRVGDHGTTYGGNPLACSVSNYVLD 321

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLE 356
           T+  +  L+   +  +  +  L ++ A+ P  +K +R               +++    E
Sbjct: 322 TIADEAFLKQVSKKSDILQKRLREIQAKYPNQIKTIRGKGLMLGAEFVEPPTEVIKKARE 381

Query: 357 QGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
            GLLI     + +RF+P L I  + I++ +   ++A+  V
Sbjct: 382 LGLLIITAGKSTVRFVPALTIEDELIEEGMDAFEKAIEAV 421


>ARGD_SULTO RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 387

 Score =  243 bits (621), Expect = 2e-66
 Identities = 131/379 (34%), Positives = 214/379 (56%), Gaps = 9/379 (2%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           YG   + +VKG+G +VWD  G +YLD  +GI V  LGH +  V E + +Q++ ++  S  
Sbjct: 7   YGDRGLTIVKGEGQYVWDISGTKYLDLHTGIGVAFLGHRNRRVIEYLSRQMENIMTLSTS 66

Query: 78  YWIEPQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           +    + ++ K L  ++    D     NSG EA E A+K ARK         + +II   
Sbjct: 67  FSTPIRDEMLKELDPLKPDKMDNIILLNSGTEAVEAALKTARKIT------GRKKIIAFK 120

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGE 195
           NSFHGRT  +++ T   +Y+   +PL     ++ +N+++ LKN I   T AV++EP+QGE
Sbjct: 121 NSFHGRTAGSLSVTWNKRYREPFEPLMSPVQFLTYNNIDELKN-IDEQTAAVIVEPIQGE 179

Query: 196 GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALG 255
            GVIPA + +++ +++  ++ G LL+ DEVQ G GRTGK   YQHYG+ PD++T  KA+G
Sbjct: 180 SGVIPANEDFMKALREQTQKVGALLVVDEVQTGFGRTGKVWAYQHYGIIPDLLTAGKAIG 239

Query: 256 GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYF 315
           GGFP+ A+   + +A+  + GDH ST+GGNP+A  A  A  + L +  V+E A   GE F
Sbjct: 240 GGFPVSALFLPDWIAEKLEEGDHGSTYGGNPMAMAAVTAASKVLKEDNVVEQASIKGEIF 299

Query: 316 KAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPL 375
           K  L +  +++  V+E+R                 +    ++ +L       V+RFL P 
Sbjct: 300 KKILREKLSDLKSVREIRGKGLMIGIEIRFPPAIALKVMQDERVLALKAGSTVIRFLAPY 359

Query: 376 IITKDEIDQAVQILKRAML 394
           +IT+ ++++A    ++ ++
Sbjct: 360 MITQSDMEEASNAARKGII 378


>OAT_PLAYO RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 414

 Score =  243 bits (619), Expect = 3e-66
 Identities = 133/389 (34%), Positives = 210/389 (53%), Gaps = 7/389 (1%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  +P+ L + +G +V+D + ++Y DF+S  +    GH HP +  A+  Q K L
Sbjct: 19  KYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNL 78

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YAKQHLGPDKY 129
             CS  ++  P     + L      DK    N+GAEANE A KL RK  Y  + +  +  
Sbjct: 79  TICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMA 138

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIG-PHTCAVM 188
           +I+   N+F GRTL  ++A+   K      P    F+ VP+            P+ CA +
Sbjct: 139 KIVVCKNNFSGRTLGCISASTTKKCTSNFGPFAPQFSKVPYXXXXXXXXXXXXPNVCAFI 198

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+QGE GVI  +  YL+GV  +C++  +L + DEVQ GLGRTGK L   HY V+PD+I
Sbjct: 199 VEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVI 258

Query: 249 TLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            L KAL GG +PI A+LA + +    +PG+H ST+GGNPLAA+  +  +  L+ + + EN
Sbjct: 259 LLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCEN 318

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCL---EQGLLINCT 364
           A ++G  F   L +   +  +V++VR               +++  CL   E GL+    
Sbjct: 319 AEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDV 378

Query: 365 NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +   +R  PPL ITK+++D+  +I+ + +
Sbjct: 379 HDKTIRLTPPLCITKEQLDECTEIIVKTV 407


>ARGD_PYRKO RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 362

 Score =  243 bits (619), Expect = 3e-66
 Identities = 137/366 (37%), Positives = 199/366 (54%), Gaps = 20/366 (5%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYW 79
           R  + LV+G+G +VWD  GR+YLD ++GI VN LGHAHPE    + +Q++ ++    ++ 
Sbjct: 5   RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFX 64

Query: 80  IEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
                     L      +  +  NSG EA E AIK AR      L   + EI+  TN+FH
Sbjct: 65  XXXXXXXXXXLSHWVDYEYVYMGNSGTEAVEAAIKFAR------LATGRSEIVAMTNAFH 118

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVI 199
           GRTL +++AT + KY+ G  PL  GF ++PFN++             V+ EP+QGEGG++
Sbjct: 119 GRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVXXXXXXXXXXXXXVIFEPIQGEGGIV 178

Query: 200 PAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFP 259
           PA + +++ ++ L E+ G LLI DEVQ GL RTGKFL  +HYGV PDI+T+ K +G GFP
Sbjct: 179 PADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNGFP 237

Query: 260 IGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAEL 319
           +   L   ++ +    G H STFGGNPLA  A   T+  L +  ++E A +    F  E 
Sbjct: 238 VSLTLTDLEIPR----GKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGEKFMEFSGE- 292

Query: 320 TKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITK 379
                    V + R               + V    E+G+L+N     V+R LPPLII  
Sbjct: 293 --------RVVKTRGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRLLPPLIIEG 344

Query: 380 DEIDQA 385
           D +++A
Sbjct: 345 DTLEEA 350


>ARGD_LACPL RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;
          Length = 387

 Score =  242 bits (618), Expect = 4e-66
 Identities = 142/382 (37%), Positives = 201/382 (52%), Gaps = 11/382 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           Q+V  TY R P A+  GQG  + D  G+ YLDF +GI V   G+  P++  AV +Q+  +
Sbjct: 2   QHVFPTYQRFPFAITDGQGVHLTDNHGKTYLDFTAGIGVCNFGYHQPQIQAAVTQQLTHI 61

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            H SN+Y  E Q  +A LL  N      +F NSG EANE A+KLARKY        K  I
Sbjct: 62  WHTSNLYENELQDAVAGLLA-NGEERLVYFANSGTEANEAALKLARKYT------GKTGI 114

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEP 191
           +   +SFHGRT   ++ TG    Q G  PL  G  +  +ND  AL + I P   AV+LE 
Sbjct: 115 LAFQHSFHGRTYGAMSMTGNPHIQAGYAPLVPGITFATYNDDAAL-DKITPELAAVILEV 173

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLA 251
           VQGEGGV     A+L+ V   C+  G+LLI DEVQ G+GRTG  + Y+ YG++PDI T+A
Sbjct: 174 VQGEGGVFAGQTAWLQAVNAKCQATGVLLIIDEVQTGIGRTGYRMAYEGYGLDPDIYTVA 233

Query: 252 KALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           K L  G P+GAM+ + Q+A AF PG H STF GN +A  A+   +   L   +L      
Sbjct: 234 KGLANGLPVGAMVGRRQLATAFGPGSHGSTFAGNAVAMAAAKCVLPQ-LTPALLTTVRAH 292

Query: 312 GEYFKAELTKLAAEVPLVKEV--RXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVL 369
            +     L      +P+VK++  +                ++     +GLL      N L
Sbjct: 293 AKLVWQSLATQVEPIPVVKQITGKGLMIGIHLDEQIPVNQVITRLQVEGLLTLSAGDNTL 352

Query: 370 RFLPPLIITKDEIDQAVQILKR 391
           R LPP+++   ++   + ++ +
Sbjct: 353 RLLPPIVMQPADLLAGIALIAK 374


>OAT_BACHD RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 398

 Score =  241 bits (615), Expect = 8e-66
 Identities = 131/385 (34%), Positives = 209/385 (54%), Gaps = 5/385 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           ++   ++Y    Y  LP+ + + +G WV D +GR+YLD +S  +    GH HP++ +A+ 
Sbjct: 8   VIEKTEKYGAKNYHPLPIVISEAKGVWVKDPEGRKYLDMLSAYSAVNQGHCHPKIIQALK 67

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLG 125
            Q   +   S  +  +      + + + +  +     N+GAEA E A+K AR++A    G
Sbjct: 68  DQADKITLTSRAFHNDQLAPFYEKVSKLTGKNMLLPMNTGAEAVETAVKAARRWAYDVKG 127

Query: 126 -PDKY-EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
            PD   EII   ++FHGRT+  V+ +   +Y+RG  P+  G   +P+ DLEALK  I  H
Sbjct: 128 VPDNQAEIIVCEDNFHGRTMTAVSLSSNDEYKRGFGPMLPGIKVIPYGDLEALKAAITSH 187

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A ++EP+QGE G+    + +L+    LC+ + +L I DE+Q GLGR+GK+       V
Sbjct: 188 TAAFLVEPIQGEAGIRIPQEGFLKEAYALCKRENVLFIADEIQSGLGRSGKWFACDWEDV 247

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
           +PD+  L KALGGG FPI  + A   +   F+PG H STFGGNPLA   S+A        
Sbjct: 248 KPDMYILGKALGGGVFPISVVCADRDILGVFEPGSHGSTFGGNPLACAVSIAAXXXXXXX 307

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
                +++ G Y   +L ++  + P++K+VR              +       E+GLL  
Sbjct: 308 XXXXRSYEYGNYLLTKLKEI--DNPIIKDVRGRGLFIGVELHEPARKYCEQLKEEGLLCK 365

Query: 363 CTNGNVLRFLPPLIITKDEIDQAVQ 387
            T+  V+RF PPL+I+K+++D A++
Sbjct: 366 ETHETVIRFAPPLVISKEDLDWAIE 390


>OAT_BOVIN RecName: Full=Ornithine aminotransferase, mitochondrial; 
                  EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 439

 Score =  239 bits (610), Expect = 3e-65
 Identities = 140/391 (35%), Positives = 211/391 (53%), Gaps = 10/391 (2%)

Query: 12  QYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTL 71
           +Y  + Y  LP+AL +G+G +VWD +GR+Y DF+S  +    GH HP++ +A+  QV  L
Sbjct: 49  KYGAHNYHPLPVALERGKGIYVWDVEGRKYFDFLSAYSAVNQGHCHPKIVDALKSQVDKL 108

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE- 130
              S  ++     +  + + +     K    N+G EA E A KLARK+     G  KY+ 
Sbjct: 109 TLTSRAFYNNVLGEYEEYVTKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIPKYKA 168

Query: 131 -IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI-GPHTCAVM 188
            I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  +  P+  A M
Sbjct: 169 KIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFEIIPYNDLPALERALQDPNVAAFM 228

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+QGE GV+     YL GV++LC +  +L I DE+Q GL RTG++L   H  V PDI+
Sbjct: 229 VEPIQGEAGVVVPDPGYLVGVRELCTQHQVLFIADEIQTGLARTGRWLAIDHENVRPDIV 288

Query: 249 TLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLEN 307
            L KAL GG +P+ A+L  +++    +PG+H ST+GGNPL                    
Sbjct: 289 LLGKALSGGLYPVSAVLCDDEIMLTIKPGEHGSTYGGNPLGCRXXXXXXXXXXXXXXXXX 348

Query: 308 AWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL---EQGLLINC 363
             +MG   + EL KL ++V  V  VR                D    CL   + GLL   
Sbjct: 349 XXKMGIILRNELMKLPSDV--VTTVRGKGLLNAIVIRETKDCDAWKVCLRLRDNGLLAKP 406

Query: 364 TNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
           T+G+++RF PPL+I +DEI +AV+I+ + +L
Sbjct: 407 THGDIIRFAPPLVIKEDEILEAVEIINKTIL 437


>ARGD_PYRHO RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 366

 Score =  239 bits (610), Expect = 3e-65
 Identities = 135/361 (37%), Positives = 197/361 (54%), Gaps = 20/361 (5%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYW 79
           R  + ++KG+G +VWD  GR+Y+D ++GI V  LGH HPE  E + +Q+  L+    ++ 
Sbjct: 5   RKRLKIIKGEGIYVWDDQGRRYVDLIAGIGVAILGHNHPEWVEGIREQLNKLVIAGPMFN 64

Query: 80  IEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
                       +    +  +  NSG EA E A+K AR Y        + EII   N+FH
Sbjct: 65  HXXXXXXXXXXSKFVNFEYLYMGNSGTEAVEAALKFARLYT------GRKEIIAMVNAFH 118

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVI 199
           GRT+  ++AT + KY++  +PL  GF ++PFND+EA K  I   T AV++EP+QGE GVI
Sbjct: 119 GRTMGALSATWKPKYKKDFEPLVPGFKHIPFNDVEAAKEAISKETAAVIVEPIQGESGVI 178

Query: 200 PAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFP 259
           PA + +++ ++ L E+ G LLI DEVQ GL RTGKFL  +HY +EPDI+T+ K +G G P
Sbjct: 179 PAKKEFMKALRDLTEDVGALLIVDEVQTGL-RTGKFLAVEHYKIEPDIVTMGKGIGNGIP 237

Query: 260 IGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAEL 319
           +G  L    V    + G H STFGGNPLA  A   T+  L ++ ++E         KA+ 
Sbjct: 238 VGLTLTNFDV----ERGKHGSTFGGNPLACKAVAITLRILRKERLIE---------KAKN 284

Query: 320 TKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITK 379
             +  +   V   R                 V     +G L++     V+R LPPLII+K
Sbjct: 285 KFIQIDADEVVTTRGKGLMIGIVFKTTIGKYVEELQNRGYLVHTAGQRVMRLLPPLIISK 344

Query: 380 D 380
           +
Sbjct: 345 E 345


>ARGD_PYRFU RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 366

 Score =  239 bits (610), Expect = 3e-65
 Identities = 138/366 (37%), Positives = 196/366 (53%), Gaps = 20/366 (5%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYW 79
           R  + LVKG+G +VWD+ G++Y+D ++GI VN LGH HPE    + +Q++ L+    ++ 
Sbjct: 5   RKRLRLVKGEGIYVWDSQGKKYIDLIAGIGVNVLGHNHPEWVSELQEQLEKLVVAGPMFD 64

Query: 80  IEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
                            +  +  NSG EA E A+K AR Y        + EII  TN+FH
Sbjct: 65  HXXXXXXXXXXXXFVTYEYVYIGNSGTEAVEAALKFARLYT------GRKEIIAMTNAFH 118

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVI 199
           GRT+  ++AT + KY+    PL  GF ++PFND+             V+ EP+QGEGGV+
Sbjct: 119 GRTMGALSATWKPKYREDFKPLVPGFKHIPFNDVXXXXXXXXXXXXXVIFEPIQGEGGVV 178

Query: 200 PAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFP 259
           PA + +++ ++ L E+KG LLI DEVQ GL RTGKFL  +HY VEPDI+T+ K +G G P
Sbjct: 179 PANEEFVKTLRDLTEDKGALLIADEVQSGL-RTGKFLAIEHYKVEPDIVTMGKGIGNGVP 237

Query: 260 IGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAEL 319
           +   L    V    + G H STFGGNPLA  A   T+  L ++ ++E A +     K E 
Sbjct: 238 VSLTLTNFDV----ERGKHGSTFGGNPLACKAVAVTLRILRREKLIEKAAEKFIEIKGEN 293

Query: 320 TKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITK 379
             L          R                +V     +G L++     V+R LPPLII+K
Sbjct: 294 VVL---------TRGKGLMIGIVMKKPVAKVVEELQNRGYLVHTAGQRVIRLLPPLIISK 344

Query: 380 DEIDQA 385
           DEI+QA
Sbjct: 345 DEINQA 350


>ARGD_THET8 RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 395

 Score =  239 bits (609), Expect = 4e-65
 Identities = 134/367 (36%), Positives = 206/367 (56%), Gaps = 11/367 (2%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y +  + +V+GQGA VWDA+G +Y+D V G  V  LGH +PEV EAV +Q +TL+     
Sbjct: 24  YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT 83

Query: 78  YWIEPQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                + +  + L  +     ++ F  NSG EANE A+K AR     H G  K+  + A 
Sbjct: 84  LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARA----HTGRKKF--VAAM 137

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGE 195
             F GRT+ +++ T + KY+    PL +   ++P+ND+EALK  +   T AV+LEPVQGE
Sbjct: 138 RGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGE 197

Query: 196 GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALG 255
           GGV PA   +L   +++ +EKG LLI DE+Q G+GRTGK   ++H+G+ PDI+T      
Sbjct: 198 GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTXXXXXX 257

Query: 256 GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYF 315
                   + +E+VA++   G H +TFGGNPLA  A +A +  L +  + E A ++G +F
Sbjct: 258 XXXXXXXXVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWF 317

Query: 316 KAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNG-NVLRFLPP 374
             +L  + +  P ++EVR                 +A   ++  ++    G  V+RFLPP
Sbjct: 318 MEKLRAIPS--PKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPP 375

Query: 375 LIITKDE 381
           L+I K++
Sbjct: 376 LVIEKED 382


>OAT_RAT RecName: Full=Ornithine aminotransferase, mitochondrial;   
                EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 439

 Score =  238 bits (608), Expect = 5e-65
 Identities = 141/401 (35%), Positives = 212/401 (52%), Gaps = 10/401 (2%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           +++ I     +Y  + Y  LP+AL +G+G ++WD +GRQY DF+S       GH HP++ 
Sbjct: 39  SSEYIFERESKYGAHNYHPLPVALERGKGIYMWDVEGRQYFDFLSAYGAVSQGHCHPKII 98

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAK 121
           EA+  QV  L   S  ++     +  + + +    +K    N+G EA E A KLAR++  
Sbjct: 99  EAMKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYNKVLPMNTGVEAGETACKLARRWGY 158

Query: 122 QHLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
              G  KY+  I+ A  +F GRTL+ V+++       G  P   GF  +P+NDL AL+  
Sbjct: 159 TVKGIQKYKAKIVFAVGNFWGRTLSAVSSSTDPTSYDGFGPFMPGFETIPYNDLPALERA 218

Query: 180 I-GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           +  P+  A M+EP+QGE GVI     YL GV++LC    +L I DE+Q GL RTG++L  
Sbjct: 219 LQDPNVAAFMVEPIQGEAGVIVPDPGYLTGVRELCTRHQVLFIADEIQTGLARTGRWLAV 278

Query: 239 QHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME 297
            H  V PDI+ L KAL GG +P+ A+L  + +    +PG+H ST+GGNPL          
Sbjct: 279 DHENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRIXXXXXX 338

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL- 355
                       +MG   + EL KL ++V  V  VR                D    CL 
Sbjct: 339 XXXXXXXXXXXDKMGAILRKELMKLPSDV--VTAVRGKGLLNAIVIRETKDCDAWKVCLR 396

Query: 356 --EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
             + GLL   T+G+++R  PPL+I +DEI ++V+I+ + +L
Sbjct: 397 LRDNGLLAKPTHGDIIRLAPPLVIKEDEIRESVEIINKTIL 437


>OAT_BREBN RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 399

 Score =  238 bits (608), Expect = 5e-65
 Identities = 125/393 (31%), Positives = 210/393 (53%), Gaps = 5/393 (1%)

Query: 6   ILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVC 65
           ++   +++  + Y  LP+ + K +G WV D +G +YLD +S  +    GH HP + +A+ 
Sbjct: 7   VIEQTEKFGAHNYHPLPIVISKAEGVWVHDPEGNKYLDMLSAYSALNQGHRHPRIIQALK 66

Query: 66  KQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAK--QH 123
            Q   +   S  ++ +   +  + L   +  +     N+GAEA E A+K  R++A   + 
Sbjct: 67  DQADKVTLTSRAFYNDQLGEFYEKLSAVTGKEMILPMNTGAEAVETALKAVRRWAYDVKK 126

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
           +  ++ EII    +FHGRT+   + +   +Y+RG  P   GF  +P+ D+EALK  I P+
Sbjct: 127 VPENQAEIIVCEGNFHGRTVTVTSFSSAEEYRRGFGPFTPGFKIIPYGDIEALKQAITPN 186

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A MLEP+QGE G+I   + +L+  +++C+   +LL+ DE+Q G GRTGK        V
Sbjct: 187 TAAFMLEPIQGEAGIIIPQEGFLKQAQEVCKANNVLLVSDEIQTGFGRTGKMFASDWENV 246

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PD+  + KALGGG FPI A+ A +++   F+PG H STFGGNPL              +
Sbjct: 247 VPDMYIMGKALGGGVFPISAVAADKEILSVFEPGSHGSTFGGNPLGCXXXXXXXXXXXXE 306

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
           G+++ + +MG YF  +L ++    P++KE+R              +              
Sbjct: 307 GLVQRSLEMGAYFMEKLKEI--NNPIIKEIRGRGLFIGLELTTAARPYXXXXXXXXXXXX 364

Query: 363 CTNGNVLRFLPPLIITKDEIDQAVQILKRAMLV 395
            T+   +RF PPL+I+K+++D A+  +K+ + V
Sbjct: 365 XTHETTIRFAPPLVISKEDLDWAIDRIKQVLHV 397


>ARGD_PYRAB RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 364

 Score =  238 bits (608), Expect = 5e-65
 Identities = 136/363 (37%), Positives = 202/363 (55%), Gaps = 20/363 (5%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYW 79
           R  + +V+G+G +VWD++G++YLD ++GI V  LGH HP+  E V  Q+  L+    ++ 
Sbjct: 5   RKRLKIVRGEGIYVWDSEGKRYLDLIAGIGVAILGHNHPKWVEEVGNQLNKLVVAGPMFX 64

Query: 80  IEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
                     L      +  +  NSG EA E A+K AR Y        + EII  TN+FH
Sbjct: 65  XXXXXXXXXXLSRWVNFEYVYMGNSGTEAVEAALKFARLYT------GRKEIIAMTNAFH 118

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVI 199
           GRT+  ++AT ++KY++  +PL  GF ++PFND+EA K  I   T AV+ EP+QGE G+I
Sbjct: 119 GRTMGALSATWKSKYKKDFEPLVPGFKHIPFNDVEAAKEAITRTTAAVIFEPIQGESGII 178

Query: 200 PAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFP 259
           PA + +++ ++ L E+ G LLI DEVQ GL RTGKFL  +HY VEPDI+TL K +G G P
Sbjct: 179 PAKEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAVEHYKVEPDIVTLGKGIGNGVP 237

Query: 260 IGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAEL 319
           +   L    V +    G H STFGGNPLA  A   T+  L ++ ++E A +  ++ K + 
Sbjct: 238 VSLTLTNFDVER----GKHGSTFGGNPLACKAVAVTLRILRKERLVEKASE--KFIKVKG 291

Query: 320 TKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITK 379
             +          R                 V     +G L++ +   V+R LPPLII+K
Sbjct: 292 KDVVT-------TRGRGLMIGIVLKKPVGRYVEELQNEGYLVHTSGQRVIRLLPPLIISK 344

Query: 380 DEI 382
           +++
Sbjct: 345 EKM 347


>ARGD_THET2 RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 395

 Score =  238 bits (607), Expect = 7e-65
 Identities = 134/367 (36%), Positives = 205/367 (55%), Gaps = 11/367 (2%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y +  + +V+GQGA VWDA+G +Y+D V G  V  LGH +PEV EAV +Q +TL+     
Sbjct: 24  YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT 83

Query: 78  YWIEPQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                + +  + L  +     ++ F  NSG EANE A+K AR     H G  K+  + A 
Sbjct: 84  LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARA----HTGRKKF--VAAM 137

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGE 195
             F GRT+ +++ T + KY+    PL +   ++P+ND+EALK  +   T AV+LEPVQGE
Sbjct: 138 RGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGE 197

Query: 196 GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALG 255
           GGV PA   +L   +++ +EKG LLI DE+Q G+GRTGK   ++H+G+ PDI+T      
Sbjct: 198 GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTXXXXXX 257

Query: 256 GGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYF 315
                     +E+VA++   G H +TFGGNPLA  A +A +  L +  + E A ++G +F
Sbjct: 258 XXXXXXXXXMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWF 317

Query: 316 KAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNG-NVLRFLPP 374
             +L  + +  P ++EVR                 +A   ++  ++    G  V+RFLPP
Sbjct: 318 MEKLRAIPS--PKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPP 375

Query: 375 LIITKDE 381
           L+I K++
Sbjct: 376 LVIEKED 382


>OAT_SCHPO RecName: Full=Probable ornithine aminotransferase;       
            EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 438

 Score =  237 bits (604), Expect = 1e-64
 Identities = 134/412 (32%), Positives = 228/412 (55%), Gaps = 22/412 (5%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           + ++I  +  +Y  + Y  LP+   K +GA VWD +GR+YLDF+S  +    GH HP++ 
Sbjct: 12  STEQIEVLENEYAAHNYHPLPVCFSKAKGAKVWDPEGREYLDFLSAYSAVNQGHCHPKII 71

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--Y 119
           EA+ +Q + +   S  ++ +     AK + E    +     N+GAEA E A KLAR   Y
Sbjct: 72  EALVEQAQRVTLSSRAFYNDKFGPFAKYITEYFGYEMVIPMNTGAEAVETACKLARLWGY 131

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDP-LPQ-------GFAYVPFN 171
             + +  D+  I++  ++FHGRT+  ++ +     +    P LP            + +N
Sbjct: 132 KAKKIPTDEAIILSCVDNFHGRTMGIISMSTDPDARDNYGPYLPNVGPKISGADRVLRYN 191

Query: 172 DLEALK---NTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCG 228
           ++E LK   +T GP   A ++EP+QGE GV+     YLE   +LC+   +L I DEVQ G
Sbjct: 192 NIEDLKYYLDTFGPKVAAFLVEPIQGEAGVMVPDDGYLEEAYKLCKAHNVLFIADEVQTG 251

Query: 229 LGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPL 287
           + RTGK L  +H  V+PD++ L KA+ GG +P+ A+L+  ++   F+PG H ST+GGNPL
Sbjct: 252 VARTGKMLCIEHSNVKPDVVILGKAISGGVYPVSAVLSSREIMLNFEPGTHGSTYGGNPL 311

Query: 288 AATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXX 347
            A  S+A +E + ++ + E A  +GE F+  L  +  + P+V++VR              
Sbjct: 312 GAAVSIAALEVVKEEKLTERAAVLGEKFRTAL--IECKSPIVQKVRGRGLLNAVVIDESK 369

Query: 348 K------DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  D+      +G+L   T+GN++RF PPL+IT++++ + ++++K+++
Sbjct: 370 TNGRTAWDLCLIMRSRGVLAKPTHGNIIRFSPPLVITEEDLMKGIEVIKKSL 421


>OAT_MOUSE RecName: Full=Ornithine aminotransferase, mitochondrial; 
                  EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 439

 Score =  236 bits (603), Expect = 2e-64
 Identities = 138/401 (34%), Positives = 213/401 (53%), Gaps = 10/401 (2%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           +++ I     +Y  + Y  LP+AL +G+G ++WD +GRQY DF+S       GH HP++ 
Sbjct: 39  SSEYIFERESKYGAHNYHPLPVALERGKGIYMWDVEGRQYFDFLSAYGAVSQGHCHPKII 98

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAK 121
           +A+  QV  L   S  ++     +  + + +    +K    N+G EA E A KLAR++  
Sbjct: 99  DAMKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYNKVLPMNTGVEAGETACKLARRWGY 158

Query: 122 QHLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT 179
              G  KY+  I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  
Sbjct: 159 TVKGIQKYKAKIVFADGNFWGRTLSAISSSTDPTSYDGFGPFMPGFETIPYNDLPALERA 218

Query: 180 I-GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           +  P+  A M+EP+QGE GVI     YL GV++LC    +L I DE+Q GL RTG++L  
Sbjct: 219 LQDPNVAAFMVEPIQGEAGVIVPDPGYLTGVRELCTRHQVLFIADEIQTGLARTGRWLAV 278

Query: 239 QHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME 297
            H  V PD++ L KAL GG +P+ A+L  +++    +PG+H ST+GGNPL          
Sbjct: 279 DHENVRPDMVLLGKALSGGLYPVSAVLCDDEIMLTIKPGEHGSTYGGNPLGCRXXXXXXX 338

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL- 355
                       +MG   + EL KL ++V  V  VR                D    CL 
Sbjct: 339 XXXXXXXXXXXDKMGAILRKELMKLPSDV--VTSVRGKGLLNAIVIRETKDCDAWKVCLR 396

Query: 356 --EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
             + GLL   T+G+++R  PPL+I +DEI ++V+I+ + +L
Sbjct: 397 LRDNGLLAKPTHGDIIRLAPPLVIKEDEIRESVEIINKTIL 437


>OAT_EXISA RecName: Full=Ornithine aminotransferase;       
           Short=OAT;         EC=2.6.1.13;AltName:
           Full=Ornithine--oxo-acid aminotransferase;
          Length = 400

 Score =  235 bits (599), Expect = 6e-64
 Identities = 126/391 (32%), Positives = 209/391 (53%), Gaps = 4/391 (1%)

Query: 5   EILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV 64
           +++ + +++  + Y  LP+ + + +G WV D +G +Y+D +S  +    GH HP++ +A+
Sbjct: 6   DVIELTEKFGAHNYHPLPIVISEAKGIWVTDPEGNRYMDMLSAYSAVNQGHCHPKIIQAL 65

Query: 65  CKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHL 124
             Q   +   S  ++ +   +    +V  +        N+GAEA E A+K AR++A    
Sbjct: 66  KDQADKITLTSRAFYNDQLGRFYDKVVTLTKKQMVLPMNTGAEAVETAVKTARRWAYDVK 125

Query: 125 G-PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH 183
           G P + EII  + +FHGRT+A V+ + + +YQRG  PL  GF  VP+ D++A +  I  +
Sbjct: 126 GIPGQAEIIVCSGNFHGRTMAAVSMSTEAEYQRGFGPLLPGFKVVPYGDIDAFEAAITEN 185

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           T A ++EP+QGE G+I     YL+   +LC+E  +L + DE+Q GLGR+GK+   +   V
Sbjct: 186 TAAFIVEPIQGEAGIIIPPAGYLKRASELCKEHNVLFVADEIQSGLGRSGKWFAIEWEDV 245

Query: 244 EPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQK 302
            PD+  L KALGGG FPI  + A +++   F PG H STFGG                  
Sbjct: 246 TPDMYILGKALGGGVFPISCVAADQEILSVFNPGSHGSTFGGXXXXXXXXXXXXXXXXXX 305

Query: 303 GVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLIN 362
                + ++G YF   L  +  + P++++VR              +       E+GLL  
Sbjct: 306 XXXXRSLELGTYFMDRLKSI--DNPMIRDVRGRGLFIGIELTESARPYCEALKERGLLCK 363

Query: 363 CTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            T+  V+R  PPL+ITK+E+DQA + ++  +
Sbjct: 364 ETHETVIRLAPPLVITKEELDQAFEAIEAVL 394


>ARGD_DEIRA RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 429

 Score =  234 bits (597), Expect = 1e-63
 Identities = 141/401 (35%), Positives = 215/401 (53%), Gaps = 21/401 (5%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           N  + LA  ++Y    Y +  + +V+GQGA VWD +GR Y+D V G  V  LGH+HP+V 
Sbjct: 7   NPSKWLAAEKKYDSGVYNKHDVVMVRGQGATVWDENGRSYIDCVVGYGVATLGHSHPDVV 66

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVE-----NSCADKAFFCNSGAEANEGAIKLA 116
           +AV +Q   L+         P  K A+ L E         D+ F CNSG EA E A    
Sbjct: 67  KAVQEQAGKLMVMPQTV---PNDKRAEFLQELVGVLPQGLDRVFLCNSGTEAMEAA---- 119

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFA--YVPFNDLE 174
           +K+A    G  ++  ++    F GR+L  ++ T + KY+          +  +V + +L+
Sbjct: 120 KKFAITATGRSRF--VSMKRGFSGRSLGALSFTWEPKYREPFGDAVDNKSVDFVTYGNLD 177

Query: 175 ALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK 234
            L+  +   T AV++EPVQGEGGV PA+  +++  +++  EKG LLI DE+Q G  RTGK
Sbjct: 178 ELRAAVTEQTAAVIMEPVQGEGGVRPASAEFIQEARRITREKGALLILDEIQTGFCRTGK 237

Query: 235 FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLA 294
               +H+GV PD +TLAKA+ GG P  A     +VA     G H +TFGGNPL+  A +A
Sbjct: 238 MFACEHFGVIPDGMTLAKAIAGGTPTAAFAMMSEVADRMPAGGHGTTFGGNPLSMAAGVA 297

Query: 295 TMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHC 354
           ++  + ++G+ E A + G Y   +L   A + P ++EVR                 + H 
Sbjct: 298 SLRAMKREGLAEQAREKGAYMMDKLR--AIQSPKIREVRGLGLMIGVELKEKSAPYI-HA 354

Query: 355 LE--QGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +E  +G+L       V+RFLPP +I+K++IDQ V   +R +
Sbjct: 355 MEHDEGVLCLAATPLVVRFLPPAVISKEQIDQVVAAFERVL 395


>OAT_HUMAN RecName: Full=Ornithine aminotransferase, mitochondrial; 
                  EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 439

 Score =  231 bits (588), Expect = 1e-62
 Identities = 135/400 (33%), Positives = 211/400 (52%), Gaps = 10/400 (2%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           + +I     +Y  + Y  LP+AL +G+G ++WD +GR+Y DF+S  +    GH HP++  
Sbjct: 40  SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVN 99

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
           A+  QV  L   S  ++     +  + + +     K    N+G EA E A KLARK+   
Sbjct: 100 ALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYT 159

Query: 123 HLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
             G  KY+  I+ A  +F GRTL+ ++++       G  P   GF  +P+NDL AL+  +
Sbjct: 160 VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERAL 219

Query: 181 -GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
             P+  A M+EP+QGE GV+     YL GV++LC    +L I DE+Q GL RTG++L   
Sbjct: 220 QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVD 279

Query: 240 HYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +  V PDI+ L KAL GG +P+ A+L  + +    +PG+H ST+GGNPL           
Sbjct: 280 YENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRXXXXXXXX 339

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-DIVAHCL-- 355
                      ++G   + EL KL ++V  V  VR                D    CL  
Sbjct: 340 XXXXXXXXXXDKLGIILRNELMKLPSDV--VTAVRGKGLLNAIVIKETKDWDAWKVCLRL 397

Query: 356 -EQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAML 394
            + GLL   T+G+++RF PPL+I +DE+ ++++I+ + +L
Sbjct: 398 RDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTIL 437


>OAT_DICDI RecName: Full=Probable ornithine aminotransferase;       
            EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 416

 Score =  228 bits (580), Expect = 9e-62
 Identities = 126/399 (31%), Positives = 210/399 (52%), Gaps = 12/399 (3%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           ++E++ M  ++  +TY  +P+   K  G  VWD + +QY DF+S  +    GH+HP++  
Sbjct: 13  SKELIEMESEFAAHTYHPIPVVFKKASGVHVWDVEEKQYFDFLSAYSAVNQGHSHPKIVS 72

Query: 63  AVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK--YA 120
           A+  Q +     S  ++ E   + AK + E    +     N+GAEA E +IKLAR+  Y 
Sbjct: 73  ALITQAQKCALSSRAFYNEVFPQYAKYITEYFGYEMVLPMNTGAEAVETSIKLARRWGYV 132

Query: 121 KQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI 180
           K+ +  D+  +I+    FHGRT+  ++ +          PL  G   + +N  + L+  +
Sbjct: 133 KKGIAEDQAIVISCKGCFHGRTIGVISMSDDPSSYNKYGPLMNGIIKIDYNSTQQLEEVL 192

Query: 181 GPH---TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLG 237
             H    C  ++EP+QGE GV+   +              +LL+ DE+Q GL RTG+ L 
Sbjct: 193 SQHADRVCGFIVEPIQGEAGVVVPDEGXXXXXXXXXXXXNVLLVADEIQTGLCRTGRMLC 252

Query: 238 YQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATM 296
               G++PD++ L KA+ GG  PI A+L  + V    +PG+H ST+GG+PLA+  ++A +
Sbjct: 253 SDWDGIKPDLVLLGKAISGGLLPISAVLGGKDVMLTIKPGEHGSTYGGSPLASAVAMAAL 312

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----DIVA 352
           + L  + + ENA ++GE+F+A+++ +    P ++ VR                   DI  
Sbjct: 313 DVLRDENLAENAQKLGEHFRAQISNI--NHPAIQLVRGKGLLNAIVIDPNFTVSAWDICI 370

Query: 353 HCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKR 391
              E GLL   T+ N++R  PPL IT ++IDQ V I+K+
Sbjct: 371 KFAENGLLAKPTHDNIIRLAPPLTITLEQIDQCVSIIKK 409


>PAT_ENTS8 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 465

 Score =  227 bits (579), Expect = 1e-61
 Identities = 144/377 (38%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G+++LD + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFLDCLGGFGIFNVGHRNPVVVSAVENQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E AIKLA+ Y        K+  + A+ +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAAIKLAKAYQSPR---GKFTFVAASGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTIGP------HTCAVMLEPVQGEGGVIPAAQA 204
           +  +++   PL  GF +VPF +++AL+  +G          AV+LEP+QGEGGVI     
Sbjct: 193 KAAFRKPFMPLLPGFRHVPFGNIDALRELLGECKKTGDDVAAVILEPIQGEGGVILPPSG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G LLIFDEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLPAVRKLCDEYGALLIFDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 VATEEVFSVLFDNPFLHTTTFGGNPLACAAALATIHVLLEENLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPHLVQEARGRGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +Q +   +RA+
Sbjct: 433 LTIEQCEQVLTAARRAL 449


>PAT_ECOL5 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  223 bits (569), Expect = 2e-60
 Identities = 139/377 (36%), Positives = 210/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALSECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +Q ++  ++A+
Sbjct: 433 LTIEQCEQVIKAARKAL 449


>ARGD_CANGA RecName: Full=Acetylornithine aminotransferase,
           mitochondrial;         Short=ACOAT;       
           EC=2.6.1.11;Flags: Precursor;
          Length = 427

 Score =  223 bits (569), Expect = 2e-60
 Identities = 134/397 (33%), Positives = 207/397 (52%), Gaps = 17/397 (4%)

Query: 13  YVMNTYGR-LPMALVKGQGAWVWDA-DGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70
           Y + TY R   + + +G  A ++D  + ++Y+DF +GIAV  LGHA+P+VAE +  Q   
Sbjct: 26  YQVTTYARPSDLCITRGLNAKLFDDFNNKEYIDFTAGIAVTALGHANPKVAEILQTQATK 85

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSC-------ADKAFFCNSGAEANEGAIKLARKYAKQH 123
           L+H SN+Y+ +  + L++ L+E +        A K F CNSG EANE A+K A+K+    
Sbjct: 86  LVHSSNLYFTKECLDLSEKLIEKTKKFGGQHDASKVFLCNSGTEANEAALKFAKKHGITK 145

Query: 124 LGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFND-LEALK---NT 179
             P K  II   NSFHGRT+  ++ T   KY+     L    +++  ND L  +K   NT
Sbjct: 146 -NPKKQGIIAFENSFHGRTMGALSVTWNKKYRTPFGDLVPHVSFLNINDELSKIKDFINT 204

Query: 180 IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                  +++EP+QGEGG+ P     L  +K++C++  +++I+DE+QCGLGRTG    + 
Sbjct: 205 KKDEIAGLIIEPIQGEGGIFPIPIEKLVALKEICQKNDIIVIYDEIQCGLGRTGNLWAHA 264

Query: 240 HY--GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME 297
                  PDI T AKALG GFPI A +  E+V  A Q GDH +T+GGNPL    S   ++
Sbjct: 265 ALPKAAHPDIFTSAKALGNGFPIAATVVNEKVNNALQVGDHGTTYGGNPLGCAVSNYVLD 324

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLE 356
            +  +  L++                 + P  + +VR                IV    E
Sbjct: 325 VIGDQAFLDSVTXXXXXXXXXXXXXXXQHPDKISDVRGSGLIWGVEFKDAPGAIVQKARE 384

Query: 357 QGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            GLL+       +RF+P L I  + +++ + I  +A+
Sbjct: 385 LGLLVITAGKTTVRFVPSLTIEDEVVEEGLTIFNKAV 421


>PAT_KLEP3 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  222 bits (566), Expect = 4e-60
 Identities = 143/368 (38%), Positives = 202/368 (54%), Gaps = 23/368 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVENQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E AIKLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAAIKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF D+ A++  +      G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGDINAMRTMLSECKKTGDDVAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G LLI DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLPAVRKLCDEFGALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL + +   A Q G+        
Sbjct: 313 VATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLTQNLPAQAAQKGDMLLDGFRL 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV EVR                 D  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAQEYPDLVNEVRGKGMLMAIEFVDNEIGYDFASEMFRQRVLVAGTLNNAKTIRVEPPLT 432

Query: 377 ITKDEIDQ 384
           +T ++ +Q
Sbjct: 433 LTLEQCEQ 440


>OAT_EMENI RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 454

 Score =  221 bits (564), Expect = 6e-60
 Identities = 126/397 (31%), Positives = 212/397 (53%), Gaps = 22/397 (5%)

Query: 2   NNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           + QE +     +  + Y  LP+   + QG  VWD +GR YLDF+S  +    GH HP++ 
Sbjct: 17  STQEAIQAENDFAAHNYHPLPVVFARAQGTSVWDPEGRHYLDFLSAYSAVNQGHCHPKLV 76

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAK 121
            A+  Q   L   S  ++ +   K A+++ +    D     N+GAEA E  IK+ARK+  
Sbjct: 77  AALVDQASRLTLSSRAFYNDVFPKFAEMVTKYFGFDMVLPMNTGAEAVETGIKIARKWGY 136

Query: 122 QHLGPDKYE--IITATNSFHGRTLATVTATGQTKYQRGLDP--------LPQGFAYVPFN 171
           +  G  + E  I++A N+FHGRT+A ++ +   + +    P        +P     + +N
Sbjct: 137 KVKGIPENEAIILSAENNFHGRTMAAISLSSDPESRENYGPYVPNIGCTIPGTEKPITYN 196

Query: 172 DLEALKNTI---GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCG 228
           D  AL+      G +  A ++EP+QGE G+I     YL+  + LC++  +LLI DE+Q G
Sbjct: 197 DKAALREAFEKAGSNLAAFLVEPIQGEAGIIVPDDDYLQLARSLCDQHNVLLICDEIQTG 256

Query: 229 LGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPL 287
           + RTGK L ++  G++PD++ L KA+ GG +P+  +L ++ V    +PG H ST+GGNPL
Sbjct: 257 IARTGKLLCHEWSGIKPDMVLLGKAISGGMYPVSCVLGRKDVMLTVEPGTHGSTYGGNPL 316

Query: 288 AATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXX 347
           A   ++  +E + ++ ++E A ++G+ F++ L   A + P+++ VR              
Sbjct: 317 ACAVAIRALEVVQEENMVERAEKLGQAFRSGLE--AIQNPIIQTVRGKGLLNAIVIDESK 374

Query: 348 K------DIVAHCLEQGLLINCTNGNVLRFLPPLIIT 378
                  D+     E+GLL   T+ N++R  PPL+IT
Sbjct: 375 TNGHTAWDLCMLMKEKGLLAKPTHQNIIRLAPPLVIT 411


>PAT_ECOUT RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOSE RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOLU RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALSECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOLI RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOK1 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOHS RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECODH RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOBW RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO81 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO5E RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO57 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO55 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO45 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO27 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO24 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  221 bits (562), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 209/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_KLEP7 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  220 bits (561), Expect = 1e-59
 Identities = 142/368 (38%), Positives = 201/368 (54%), Gaps = 23/368 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVENQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E AIKLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAAIKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF D+ A++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGDINAMRTMLSECKKTGDDVAAVILEPIQGEGGVILPPTG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G LLI DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLPAVRKLCDEFGALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL + +   A Q G+        
Sbjct: 313 VATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLTQNLPAQAAQKGDMLLDGFRL 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV EVR                 D  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAQEYPDLVNEVRGKGMLMAIEFVDNEIGYDFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQ 384
           +T ++ +Q
Sbjct: 433 LTLEQCEQ 440


>PAT_ECOLC RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  220 bits (561), Expect = 1e-59
 Identities = 138/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G +++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGEEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ESCF3 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  220 bits (560), Expect = 2e-59
 Identities = 138/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF  +EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGHIEAMRTALSECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>OAT_YEAST RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 424

 Score =  220 bits (560), Expect = 2e-59
 Identities = 134/423 (31%), Positives = 220/423 (52%), Gaps = 37/423 (8%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +++++ +    +Y  + Y  LP+   K +GA VWD +G+ YLDF+S  +    GH HP +
Sbjct: 6   LSSKQTIEWENKYSAHNYHPLPVVFHKAKGAHVWDPEGKLYLDFLSAYSAVNQGHCHPHI 65

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK-- 118
            +A+ +Q +TL   S  +  +   + AK + E    +     N+GAEA E A+KLAR+  
Sbjct: 66  IKALTEQAQTLTLSSRAFHNDVYAQFAKFVTEFFGFETVLPMNTGAEAVETALKLARRWG 125

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQ----------------RGLDPLP 162
           Y K+++  DK  I+ A  +FHGRT   ++ +  T Y+                  +  + 
Sbjct: 126 YMKKNIPQDKAIILGAEGNFHGRTFGAISLS--TDYEDSKLHFGPFVPNVASGHSVHKIR 183

Query: 163 QGFA--YVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLL 220
            G A  +VP      L++  G +  A++LEP+QGE G++     Y   V  LC +  +LL
Sbjct: 184 YGHAEDFVPI-----LESPEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLL 238

Query: 221 IFDEVQCGLGRTGKFLGYQHYGVE--PDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGD 277
           I DE+Q G+GRTG+ L Y HY  E  PDI+ L KAL GG  P+  +L+   +   F PG 
Sbjct: 239 IVDEIQTGIGRTGELLCYDHYKAEAKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPGS 298

Query: 278 HASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEV-PLVKEVRXXX 336
           H STFGGNPLA+  ++A +E +  + + + A Q+G  F A+L  L A+   ++ EVR   
Sbjct: 299 HGSTFGGNPLASRVAIAALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMG 358

Query: 337 XXXXXXXXXXXK------DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
                             D+     + GLL   T+ +++R  PPL+I+++++   V+ + 
Sbjct: 359 LLTAIVIDPSKANGKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPLVISEEDLQTGVETIA 418

Query: 391 RAM 393
           + +
Sbjct: 419 KCI 421


>PAT_SHIFL RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  219 bits (559), Expect = 2e-59
 Identities = 138/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  +  FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGVFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_SHIF8 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  219 bits (559), Expect = 2e-59
 Identities = 138/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  +  FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGVFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOL6 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  219 bits (558), Expect = 3e-59
 Identities = 138/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA+   +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMLTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECO7I RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  219 bits (558), Expect = 3e-59
 Identities = 137/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPL   A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLTCAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ECOSM RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  219 bits (557), Expect = 4e-59
 Identities = 138/368 (37%), Positives = 204/368 (55%), Gaps = 23/368 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALSECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQ 384
           +T ++ +Q
Sbjct: 433 LTIEQCEQ 440


>PAT_ECO8A RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  218 bits (556), Expect = 5e-59
 Identities = 137/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK +  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTVAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++   +A+
Sbjct: 433 LTIEQCELVIKAAHKAL 449


>PAT_SALPK RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  218 bits (555), Expect = 7e-59
 Identities = 140/377 (37%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDSFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV E R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHEARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALPA RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  218 bits (555), Expect = 7e-59
 Identities = 140/377 (37%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDSFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV E R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHEARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>ARGD_PYRAE RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 383

 Score =  218 bits (554), Expect = 9e-59
 Identities = 137/392 (34%), Positives = 199/392 (50%), Gaps = 36/392 (9%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y    + +VKG   +VWD  G++Y+D  +   V  LGHA+P++ EAV KQV+ +      
Sbjct: 8   YREYGIRIVKGFMQYVWDDKGQRYIDCNTNHGVVFLGHANPKIVEAVKKQVEEI------ 61

Query: 78  YWIEPQ-----------VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGP 126
            W  P             + +KLL         F  N+G EA E AIK+A+K  +     
Sbjct: 62  -WAVPLNFATPARERFIEEFSKLLPPKFGV--VFLQNTGTEAVEVAIKIAKKVTR----- 113

Query: 127 DKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCA 186
            K  I+  TNSFHGRT+ +++ T   KY++  +PL     +  FN    +   IG  TC 
Sbjct: 114 -KPTIVAFTNSFHGRTMGSLSITWNEKYKKAFEPLYPHVRFGKFNVPHEVDKLIGEDTCC 172

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EP+QGEGGV PA   +L+ +++  + KG LLIFDEVQ G GRTG    +Q YGVEPD
Sbjct: 173 VVVEPIQGEGGVNPATPEFLKALREEAQRKGALLIFDEVQTGFGRTGAVWAFQKYGVEPD 232

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLE 306
           I T  K + GG PIG  +A+E     F+PG+H STF GN             L ++ V  
Sbjct: 233 IFTAGKPVAGGLPIGLAVAREDFGDVFEPGEHGSTFAGNXXXXXXXXXXSRLLREEDVPG 292

Query: 307 NAWQMGEYFKAELTKLAAEV--PLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCT 364
            A ++G    AEL K   +    L   V+                 +   LE+G++    
Sbjct: 293 RAERIG----AELAKALGDTGSRLAVRVKGMGLMLGLELRVKADQFIQPLLERGVMALTA 348

Query: 365 NGNVLRFLPPLIITKDEID----QAVQILKRA 392
             N LRFLPP +I+K++++       ++LK+A
Sbjct: 349 GVNTLRFLPPYMISKEDVEVVHAAVTEVLKKA 380


>PAT_SHISS RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  217 bits (553), Expect = 1e-58
 Identities = 137/377 (36%), Positives = 208/377 (55%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++    L  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMQLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQADQKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_SALTI RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  217 bits (553), Expect = 1e-58
 Identities = 140/377 (37%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV E R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHEARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALHS RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  217 bits (553), Expect = 1e-58
 Identities = 140/377 (37%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV E R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHEARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALTY RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALSV RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALNS RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALG2 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLIAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALEP RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLIAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALDC RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLIAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALA4 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_CITK8 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  216 bits (550), Expect = 3e-58
 Identities = 136/368 (36%), Positives = 205/368 (55%), Gaps = 23/368 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FF NSG E+ E A+KLA+ Y        K+  I  + +FHG++L +++AT 
Sbjct: 136 LTPGKLKYSFFSNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGSLSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALSECKKTGDDVAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  P+GA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPVGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFLQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV++ R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQDARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNSKTIRIEPPLT 432

Query: 377 ITKDEIDQ 384
           +T ++ +Q
Sbjct: 433 LTIEQCEQ 440


>PAT_SALPC RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  215 bits (548), Expect = 5e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSIFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALCH RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  215 bits (548), Expect = 5e-58
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSIFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>PAT_SALPB RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  215 bits (547), Expect = 6e-58
 Identities = 139/377 (36%), Positives = 204/377 (54%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LAPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ ++R   PL  GF +VPF +++A+          G    AV+LEP+QGEGGVI   Q 
Sbjct: 193 KSTFRRPFMPLLPGFRHVPFGNIDAMSMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTEVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQ 372

Query: 322 LAAEVP-LVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV + R                    +    Q +L+  T  N    R  PPL 
Sbjct: 373 LAREYPNLVHDARGKGMLMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTTRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T +  +Q ++  + A+
Sbjct: 433 LTIELCEQVLKSARNAL 449


>YKAB_BACPF RecName: Full=Uncharacterized aminotransferase in katA
           3'region;         EC=2.6.-.-;AltName: Full=ORF B;
          Length = 445

 Score =  214 bits (546), Expect = 8e-58
 Identities = 139/415 (33%), Positives = 219/415 (52%), Gaps = 51/415 (12%)

Query: 23  MALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS-NIYWIE 81
           + +VK +G + +  DG +YLDF SGIAV  +GH HP++ +A+ +    L H    +   E
Sbjct: 27  LPVVKEEGCYYYGVDGVKYLDFTSGIAVTNVGHRHPKIVQAIKEAADHLTHGPIGVIQYE 86

Query: 82  PQVKLAKLLVE--NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
             +KLA  L +      D  FF NSG EA EGA+KLA+   K+        +++ T  FH
Sbjct: 87  SILKLADELADILPGDLDCFFFANSGTEAIEGALKLAKFVTKRPY------VVSFTGCFH 140

Query: 140 GRTLATV-TATGQTKYQRGLDPLPQGFAY-VPF-------------NDLEALK------- 177
           GRT  ++  +T ++KY++ L P   G  Y VP+               +E+L        
Sbjct: 141 GRTQGSLGVSTSKSKYRKFLQP--NGLTYQVPYFKPSDPRILDEEGEVVESLACELLEEE 198

Query: 178 -------NTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLG 230
                  +       AV+LEPV GEGG I    ++L  V+++C    +LLIFDEVQ G G
Sbjct: 199 FTNLFKYHVSSEEVAAVILEPVLGEGGYIIPPASWLAKVREICNRHDILLIFDEVQTGFG 258

Query: 231 RTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAAT 290
           RTG++   Q +GV PDI+ +AK +  G P+ A +A   + Q +  G H +TFGGNP+A +
Sbjct: 259 RTGEWFAAQTFGVTPDIMAIAKGIASGLPLSATVANHTLMQQWPLGSHGTTFGGNPIACS 318

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD- 349
           A+LAT++ L ++ +L+NA ++G Y +  L  L  +  ++  +R                 
Sbjct: 319 AALATLDVLKEENLLDNAREVGAYARERLNLLKEKYEMIGSIRSVGLMIGIEIIDPQTKK 378

Query: 350 --------IVAHCLEQGLLIN-CTN-GNVLRFLPPLIITKDEIDQAVQILKRAML 394
                   I+   L++G+L   C N G V+R +PPL +TK++ID  + +L+RA++
Sbjct: 379 PDGAAVLRILDLALQEGVLFYLCGNEGEVIRMIPPLSVTKEQIDDGLDMLQRALV 433


>PAT_ERWCT RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 468

 Score =  213 bits (542), Expect = 2e-57
 Identities = 135/330 (40%), Positives = 187/330 (56%), Gaps = 29/330 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKG--QGAWVW---------DADGRQYLDFVSGIAVN 51
           NQE+L+  ++YV   +     ++  G   GA  W         D  G +YLD + G  + 
Sbjct: 35  NQEVLSCFREYVNPGFLEYRKSVTTGGDYGAVEWRASGPNTLIDTQGNEYLDCLGGYGIF 94

Query: 52  CLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVENSCADK--AFFCNSGAE 107
            +GH +P V  AV  Q+ +  LH   +  ++P +  LAK L   +  +   +FF NSG E
Sbjct: 95  NVGHRNPNVIAAVESQLARQPLHSQEL--LDPLRGLLAKTLAALTPGNLKYSFFSNSGTE 152

Query: 108 ANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAY 167
           + E A+KLA+ Y        KY  I AT +FHG++L  ++AT +  ++R   PL  GF +
Sbjct: 153 SVEAALKLAKAYQSPR---GKYTFIAATGAFHGKSLGALSATAKPAFRRPFMPLLPGFHH 209

Query: 168 VPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLI 221
           V F D+ A++  +      G    A++LEP+QGEGGVI   + YL  V+ LC+E G LLI
Sbjct: 210 VAFGDISAMRKQVQQCQKTGDDVAAIILEPIQGEGGVIVPPENYLPAVRALCDEVGALLI 269

Query: 222 FDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAF--QPGDH 278
            DEVQ G+GRTGK    +HYGV+PDI+ LAKALGGG  PIGA +A E V       P  H
Sbjct: 270 LDEVQTGMGRTGKMFACEHYGVQPDILCLAKALGGGVMPIGATVATEAVFSVLFENPFLH 329

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLENA 308
            +TFGGNPLA  A+LAT+  LL K + E A
Sbjct: 330 TTTFGGNPLACAAALATVNELLTKNLPEQA 359


>ARGD_BACAM RecName: Full=Acetylornithine aminotransferase;       
           Short=ACOAT;         EC=2.6.1.11;Flags: Fragment;
          Length = 229

 Score =  211 bits (537), Expect = 9e-57
 Identities = 115/232 (49%), Positives = 147/232 (63%), Gaps = 9/232 (3%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           +  TYGR  + + K +G +V D +G+ YLDF+ GIAV+ LGH H  V EAV KQ+ ++ H
Sbjct: 4   LFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDSVWH 63

Query: 74  CSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            SN++    Q + A+ L  +S  D  FFCNSGAEANEGAIKLARK         K +IIT
Sbjct: 64  VSNLFQNSLQEQAAQKLAAHSAGDLVFFCNSGAEANEGAIKLARK------ATGKTKIIT 117

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPH--TCAVMLEP 191
              SFHGRT A + ATGQ K + G  P+  GF Y+P+ND  A K  +G      AVMLE 
Sbjct: 118 FLQSFHGRTYAGMAATGQDKIKTGFGPMLGGFHYLPYNDPSAFK-ALGEEGDIAAVMLET 176

Query: 192 VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
           VQGEGGV PA+  +L  V+  C+EK  LLI DE+Q G+GRTG    YQH+G+
Sbjct: 177 VQGEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGTRFAYQHFGL 228


>PAT_SHIBS RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  211 bits (536), Expect = 1e-56
 Identities = 134/377 (35%), Positives = 202/377 (53%), Gaps = 23/377 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FFCNSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF ++EA++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E G L+I DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPLA  A+LAT+               G+       +
Sbjct: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVXXXXXXXXXXXXKGDMLLDGFRQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           LA E P LV+E R                 +  +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILKRAM 393
           +T ++ +  ++  ++A+
Sbjct: 433 LTIEQCELVIKAARKAL 449


>PAT_ENT38 RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  210 bits (534), Expect = 2e-56
 Identities = 138/374 (36%), Positives = 202/374 (54%), Gaps = 26/374 (6%)

Query: 35  DADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVE 92
           D  G++++D + G  +  +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L  
Sbjct: 78  DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTLAA 135

Query: 93  NSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATG 150
            +      +FF NSG E+ E A+KLA+ Y        K+  I  + +FHG++L  ++AT 
Sbjct: 136 LTPGKLKYSFFSNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192

Query: 151 QTKYQRGLDPLPQGFAYVPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQA 204
           ++ +++   PL  GF +VPF D+ A++  +      G    AV+LEP+QGEGGVI     
Sbjct: 193 KSTFRKPFMPLLPGFRHVPFGDINAMRTMLTECRKTGDDVAAVILEPIQGEGGVILPPLG 252

Query: 205 YLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAM 263
           YL  V++LC+E   LLI DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA 
Sbjct: 253 YLPAVRKLCDEFDALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312

Query: 264 LAKEQVAQAF--QPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTK 321
           +A E+V       P  H +TFGGNPL+  A+LAT+  LL++ +   A Q G+       +
Sbjct: 313 VATEEVFSVLFDNPFLHTTTFGGNPLSCAAALATINVLLEQNLPAQAEQKGDMLLDGFLQ 372

Query: 322 LAAEVP-LVKEVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLI 376
           L  E P LV++ R                    +    Q +L+  T  N   +R  PPL 
Sbjct: 373 LGREYPDLVQDARGKGMLIAIEFVDNEIGYSFASEMFRQRILVAGTLNNSKTIRIEPPLT 432

Query: 377 ITKDEIDQAVQILK 390
           +T   I+Q  Q+LK
Sbjct: 433 LT---IEQCEQVLK 443


>PAT_SALAR RecName: Full=Putrescine aminotransferase;       
           EC=2.6.1.82;AltName: Full=Putrescine--2-oxoglutaric acid
           transaminase;
          Length = 459

 Score =  209 bits (533), Expect = 3e-56
 Identities = 144/420 (34%), Positives = 220/420 (52%), Gaps = 34/420 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKG--QGAWVWDA---------DGRQYLDFVSGIAVN 51
           N+E++   +++V   +     ++  G   GA  W A          G++++D + G  + 
Sbjct: 35  NREVIDYFKEHVNPGFLEYRKSVTAGGDYGAVEWQAGSLNTLVNTQGQEFIDCLGGFGIF 94

Query: 52  CLGHAHPEVAEAVCKQV-KTLLHCSNIYWIEP-QVKLAKLLVENSCADK--AFFCNSGAE 107
            +GH +P V  AV  Q+ K  LH   +  ++P +  LAK L   +      +FFCNSG E
Sbjct: 95  NVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAILAKTLAALTPGKLKYSFFCNSGTE 152

Query: 108 ANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAY 167
           + E A+KLA+ Y        K+  I  + +FHG++L  ++AT ++ +++   PL  GF +
Sbjct: 153 SVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRH 209

Query: 168 VPFNDLEALKNTI------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLI 221
           V F ++ A++         G    AV+LEP+QGEGGVI   Q YL  V++LC+E G L+I
Sbjct: 210 VTFGNINAMRMAFSEGKKTGDEIAAVILEPIQGEGGVILPPQGYLTEVRKLCDEFGALMI 269

Query: 222 FDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAF--QPGDH 278
            DEVQ G+GRTGK    +H  V+PDI+ LAKALGGG  PIGA +A E+V       P  H
Sbjct: 270 LDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPFLH 329

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVP-LVKEVRXXXX 337
            +TFGGNPLA  A+LAT+  LL++ +   A Q G+       +LA E P LV + R    
Sbjct: 330 TTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDTLLDGFRQLAREYPDLVHDARGKGM 389

Query: 338 XXXXXXXXXXKD--IVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                           +    Q +L+  T  N   +R  PPL +T +  +Q ++  + A+
Sbjct: 390 LMAIEFVDNETGYRFASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIELCEQVLKSARNAL 449


>GABT_ECOLI RecName: Full=4-aminobutyrate aminotransferase;       
           EC=2.6.1.19;AltName: Full=Gamma-amino-N-butyrate
           transaminase;         Short=GABA transaminase;
          Length = 426

 Score =  209 bits (531), Expect = 4e-56
 Identities = 137/424 (32%), Positives = 216/424 (50%), Gaps = 41/424 (9%)

Query: 2   NNQEILAMGQQYVMNTYGRL-PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           +N+E++    Q +    G++ P+   + +   VWD +GR+YLDF  GIAV   GH HP+V
Sbjct: 3   SNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKV 62

Query: 61  AEAVCKQVKTLLH-CSNIYWIEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLA 116
             AV  Q+K L H C  +   EP ++L +++   V    A K     +G+EA E A+K+A
Sbjct: 63  VAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIA 122

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTK-YQRGLDPLPQGFAY-----VPF 170
           R   K+         I  + ++HGRT  T+  TG+   Y  G+  +P G  Y      P 
Sbjct: 123 RAATKRS------GTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMP-GHVYRALYPCPL 175

Query: 171 NDLEA----------LKNTIGPHT-CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLL 219
           + +             KN   P    A+++EPVQGEGG   ++ A+++ ++ LC+E G++
Sbjct: 176 HGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIM 235

Query: 220 LIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA 279
           LI DEVQ G GRTG     +  GV PD+ T AK++ GGFP+  +  + +V  A  PG   
Sbjct: 236 LIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLG 295

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR------ 333
            T+ GNP+A  A+L  ++   Q+ +L+ A  +G+  K  L  +A + P + +VR      
Sbjct: 296 GTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMI 355

Query: 334 ----XXXXXXXXXXXXXXKDIVAHCLEQGL-LINC-TNGNVLRFLPPLIITKDEIDQAVQ 387
                              +IVA   ++GL L++C    NVLR L PL I   +I Q ++
Sbjct: 356 AIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLE 415

Query: 388 ILKR 391
           I+ +
Sbjct: 416 IISQ 419


>GABT_BACSU RecName: Full=Probable 4-aminobutyrate aminotransferase;
                   EC=2.6.1.19;AltName: Full=Gamma-amino-N-butyrate
           transaminase;
          Length = 436

 Score =  208 bits (530), Expect = 6e-56
 Identities = 126/407 (30%), Positives = 217/407 (53%), Gaps = 45/407 (11%)

Query: 26  VKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS-NIYWIEPQV 84
           VKG+GA ++D DGR+++DF   I    +GH+HP+V EAV +Q + L+H   N+      +
Sbjct: 34  VKGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYI 93

Query: 85  KLAKLL---VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGR 141
           +LA+ L      S   KA F NSGAEA E A+K+ARKY K+        +++ T  FHGR
Sbjct: 94  ELAEKLCGIAPGSHEKKAIFLNSGAEAVENAVKIARKYTKRQ------GVVSFTRGFHGR 147

Query: 142 TLATVTATGQTK-YQRGLDPL---------------PQGFAYVPFNDL--EALKN----T 179
           T  T++ T + K Y+ G  P                P G +   ++D+  +A  +    +
Sbjct: 148 TNMTMSMTSKVKPYKFGFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIAS 207

Query: 180 IGPHTCA-VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           + P T A V++EPVQGEGG I  ++ +++ V   C+E G++ + DE+Q G  RTG +   
Sbjct: 208 VAPETVACVVMEPVQGEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAI 267

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
           +H+ V PD+IT++K+L  G P+  ++ + ++  A  PG+   T+ G+PL   A+LA ++ 
Sbjct: 268 EHFDVVPDLITVSKSLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDI 327

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR----------XXXXXXXXXXXXXXK 348
           + ++G+ E + ++G+  + +  +   E P + ++R                         
Sbjct: 328 IEEEGLNERSEEIGKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDKTKXX 387

Query: 349 DIVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                  + GLL+     NGN++RFL PL+I+   +++ + IL+  +
Sbjct: 388 XXXXXXNQNGLLLLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGL 434


>YHXA_BACSU RecName: Full=Uncharacterized aminotransferase yhxA;    
               EC=2.6.-.-;
          Length = 450

 Score =  203 bits (517), Expect = 2e-54
 Identities = 134/413 (32%), Positives = 212/413 (51%), Gaps = 45/413 (10%)

Query: 27  KGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKL 86
           K +GAWV D DGR+YLD +SG+    +G+   E+AEA  +Q+K L +        P ++L
Sbjct: 40  KAEGAWVTDTDGRRYLDAMSGLWCVNIGYGRKELAEAAYEQLKELPYYPLTQSHAPAIQL 99

Query: 87  AKLLVENSCADKA-FFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLAT 145
           A+ L E    D   FF NSG+EANE A K+AR+Y  Q+    +Y+ I+   ++HG TL  
Sbjct: 100 AEKLNEWLGGDYVIFFSNSGSEANETAFKIARQYHLQNGDHSRYKFISRYRAYHGNTLGA 159

Query: 146 VTATGQTKYQRGLDPLPQGFA-------YVPFNDLEALKNT----------IGPHTCAVM 188
           ++ATGQ + +   +PL QGF        Y   +D + L++           +      V+
Sbjct: 160 LSATGQAQRKYKYEPLSQGFLHAAPPDIYRNPDDADTLESANEIDRIMTWELSETIAGVI 219

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+   GG++     Y++ V+ +C   G LLI DEV CG GRTG+  G+ HYGV+PDII
Sbjct: 220 MEPIITGGGILMPPDGYMKKVEDICRRHGALLICDEVICGFGRTGEPFGFMHYGVKPDII 279

Query: 249 TLAKALGGGF-PIGAMLAKEQVAQAFQ---PGD---HASTFGGNPLAATASLATMETLLQ 301
           T+AK +   + P+ A   K  + +A+Q   P D   H +TFGG+P A   +L  ++ +  
Sbjct: 280 TMAKGITSAYLPLSATAVKRDIFEAYQGEAPYDRFRHVNTFGGSPAACALALKNLQIMED 339

Query: 302 KGVLENAWQMGEYFKAELTKLAAEVPLVKEVR-----------XXXXXXXXXXXXXXKDI 350
           + +++ +  +G     EL  L  E P V +VR                           +
Sbjct: 340 EQLIQRSRDLGAKLLGELQAL-REHPAVGDVRGKGLLIGIELVKDKLTKEPADAAKVNQV 398

Query: 351 VAHCLEQGLLINCTNG-------NVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           VA C E+GL+I   NG       NV++  PP  +T++++   V+ +K +   +
Sbjct: 399 VAACKEKGLIIG-KNGDTVAGYNNVIQLAPPFCLTEEDLSFIVKTVKESFQTI 450


>ARGD_SULSO RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 388

 Score =  203 bits (517), Expect = 2e-54
 Identities = 116/371 (31%), Positives = 194/371 (52%), Gaps = 9/371 (2%)

Query: 25  LVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQV 84
           ++KG+G +VWD    +YLD  +G  V  LGH +  + + + KQ++ +   S  +    + 
Sbjct: 15  IIKGEGQYVWDEKNNKYLDMHAGHGVAFLGHRNKVIIDHLKKQMEEISTLSLAFDTPIRE 74

Query: 85  KLAKLLVE--NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRT 142
           ++ K L E      D  F  NSG+EA E A+                  +   NSFHGR+
Sbjct: 75  EMIKELDELKPEDLDNLFLLNSGSEAVELALXXXXXXXXXXXX------VAFKNSFHGRS 128

Query: 143 LATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAA 202
           +  ++ T   KY+   +PL     ++ +N++++LK+ I   T AV++EPVQGEGGVIPA 
Sbjct: 129 MGALSVTWNKKYREPFEPLIGPVEFLEYNNVDSLKS-ITEDTAAVIVEPVQGEGGVIPAK 187

Query: 203 QAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGA 262
           + +++ ++++ E+   LLI DEVQ G GRTGK   YQH+ ++PDI+T  KA+GGGFP+ A
Sbjct: 188 KEFVKSLREVTEKVNALLIIDEVQTGFGRTGKIWAYQHFDIKPDILTAGKAIGGGFPVSA 247

Query: 263 MLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKL 322
           +     +++  + GDH ST+GGNPL              + + E A + GE F   L + 
Sbjct: 248 VFLPNWISEKIEEGDHGSTYGGNPLXXXXXXXXXXXXXSEKIAEQAQKKGELFMRILKEK 307

Query: 323 AAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEI 382
             +  +V+E+R                 +    ++ +L        +RFLPP +IT+ ++
Sbjct: 308 LEDFKIVREIRGLGLMIGIDLKVNPSIAIKVLQDEKVLSLKAGLTTIRFLPPYLITQSDM 367

Query: 383 DQAVQILKRAM 393
           + A    ++ +
Sbjct: 368 EWASDATRKGI 378


>AGT22_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
           homolog 2, mitochondrial;         EC=2.6.1.44;AltName:
           Full=Beta-alanine-pyruvate aminotransferase 2;
          Length = 477

 Score =  202 bits (513), Expect = 5e-54
 Identities = 135/406 (33%), Positives = 200/406 (49%), Gaps = 41/406 (10%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYW 79
           R P+ +V G+  +++D  GR+YLD  +GIAV   GH HP+V E V  Q+K L H + +Y 
Sbjct: 78  RKPLNIVDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYL 137

Query: 80  IEPQVKLAKLLVENSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
                  ++ L      D    FF NSG EANE A+ +A+ Y          +I+   N 
Sbjct: 138 NHAIADFSEALASKLPGDLKVVFFTNSGTEANELALMMAKLYTGCQ------DIVAVRNG 191

Query: 138 FHGRTLATVTATGQTKYQ---------RGLDPLP-------QGFAYVPFNDLEAL--KNT 179
           +HG   AT+ ATGQ+ ++           L+P P        G  Y    DL+ L    T
Sbjct: 192 YHGNAAATMGATGQSMWKFNVVQNSVHHALNPDPYRGVFGSDGEKYA--KDLQDLIQYGT 249

Query: 180 IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
            G H    + E +QG GG++  A  YL       ++ G L I DEVQ G  RTG F G++
Sbjct: 250 TG-HIAGFICEAIQGVGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFE 308

Query: 240 HYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETL 299
            + V PDI+T+AK +G GFP+GA++   ++A       + +TFGGN ++ TA LA +  +
Sbjct: 309 AHNVVPDIVTMAKGIGNGFPLGAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAVLNVI 368

Query: 300 LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK----------D 349
            ++ + ENA  +G Y K +LT+L  +  ++ +VR              K           
Sbjct: 369 EKEKLQENAAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVELVSDRKLKTPATAETLH 428

Query: 350 IVAHCLEQGLLINCTN--GNVLRFLPPLIITKDEIDQAVQILKRAM 393
           I+    E G+LI      GNV R  PPL  TKD+ D  V+ +  +M
Sbjct: 429 IMDQMKELGVLIGKGGYFGNVFRITPPLCFTKDDADFLVEAMDYSM 474


>PUUE_ECOLI RecName: Full=4-aminobutyrate aminotransferase;       
           EC=2.6.1.19;AltName: Full=Gamma-amino-N-butyrate
           transaminase;         Short=GABA transaminase;
          Length = 421

 Score =  189 bits (480), Expect = 4e-50
 Identities = 126/396 (31%), Positives = 193/396 (48%), Gaps = 37/396 (9%)

Query: 29  QGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS-NIYWIEPQVKLA 87
           + A + D +G +Y+DF +GIAV   GH HP++  AV +Q++   H +  I   E  V LA
Sbjct: 30  ENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLA 89

Query: 88  K---LLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLA 144
           +    L   S   K  F  +GAEA E A+K+AR     H G  +  +I  +  FHGRT  
Sbjct: 90  EKINALAPVSGQAKTAFFTTGAEAVENAVKIARA----HTG--RPGVIAFSGGFHGRTYM 143

Query: 145 TVTATGQTK-YQRGLDPLPQGFAYVPF----------NDLEALKNTI-----GPHTCAVM 188
           T+  TG+   Y+ G  P P    +VP+          + L+A++             A++
Sbjct: 144 TMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAII 203

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
            EPVQGEGG   A +  +  +++LC+E G+++I DEVQ G  RTGK     HY  +PD++
Sbjct: 204 FEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLM 263

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENA 308
           T+AK+L GG P+  ++    +  A  PG    T+ GNPLA  A+ A +  + ++ + E A
Sbjct: 264 TMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERA 323

Query: 309 WQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLEQGLLINC----- 363
            Q+G+  K  L      VP +  VR                  +  + Q +         
Sbjct: 324 NQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIXXXXXXXXX 383

Query: 364 ------TNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                   GNV+RFL PL I   + D A++IL+ A+
Sbjct: 384 XXXTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDAL 419


>AGT23_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
           homolog 3, mitochondrial;         EC=2.6.1.44;AltName:
           Full=Beta-alanine-pyruvate aminotransferase 3;
          Length = 481

 Score =  185 bits (469), Expect = 7e-49
 Identities = 131/422 (31%), Positives = 203/422 (48%), Gaps = 39/422 (9%)

Query: 5   EILAMGQQYVMNT---YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA 61
           EI+A  ++++      +   P+ +V+ +  +V+D +GR+YLD   GIA    GH HPEV 
Sbjct: 63  EIIAKRREFLSPALFHFYNTPLNIVEAKMQYVFDENGRRYLDAFGGIATVSCGHCHPEVV 122

Query: 62  EAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADK--AFFCNSGAEANEGAIKLARKY 119
            +V KQ+K + H + +Y        A+ LV     D    FF NSG EANE A+ +AR Y
Sbjct: 123 NSVVKQLKLINHSTILYLNHTISDFAEALVSTLPGDLKVVFFTNSGTEANELAMMMARLY 182

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKY-----QRGLDPL--PQGFAYVPFND 172
              +      +I++  NS+HG   AT+ AT Q+ +     Q G+     P  +  +  +D
Sbjct: 183 TGCN------DIVSLRNSYHGNAAATMGATAQSNWKFNVVQSGVHHAINPDPYRGIFGSD 236

Query: 173 LEALKNTI--------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDE 224
            E   + +               + E +QG GG++  A  YL     +  + G + I DE
Sbjct: 237 GEKYASDVHDLIQFGTSGQVAGFIGESIQGVGGIVELAPGYLPAAYDIVRKAGGVCIADE 296

Query: 225 VQCGLGRTGK-FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFG 283
           VQ G  RTG  F G+Q +GV PDI+T+AK +G G P+GA++   ++A       + +TFG
Sbjct: 297 VQSGFARTGTHFWGFQSHGVIPDIVTMAKGIGNGIPLGAVVTTPEIAGVLSRRSYFNTFG 356

Query: 284 GNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR------XXXX 337
           GNP+   A  A +  L ++ + ENA  +G + K  LT L  +  L+ +VR          
Sbjct: 357 GNPMCTAAGHAVLRVLHEEKLQENANLVGSHLKRRLTLLKNKYELIGDVRGRGLMLGVEF 416

Query: 338 XXXXXXXXXXKDIVAHCLEQ----GLLINCTN--GNVLRFLPPLIITKDEIDQAVQILKR 391
                     K    H ++Q    G+L+      GNV R  PPL  T  + D  V ++  
Sbjct: 417 VKDRDLKTPAKAETLHLMDQMKEMGVLVGKGGFYGNVFRITPPLCFTLSDADFLVDVMDH 476

Query: 392 AM 393
           AM
Sbjct: 477 AM 478


>DAT_HAEIN RecName: Full=Diaminobutyrate--2-oxoglutarate
           aminotransferase;         EC=2.6.1.76;AltName:
           Full=L-2,4-diaminobutyrate:2-ketoglutarate
           4-aminotransferase;
          Length = 454

 Score =  179 bits (455), Expect = 3e-47
 Identities = 117/368 (31%), Positives = 186/368 (50%), Gaps = 46/368 (12%)

Query: 4   QEILAMGQQYV---------MNTYGR-LPMALVKGQGAWVWDADGRQYLDFVSGIAVNCL 53
           Q ILA  Q ++         + +Y R LP A  K QG WV D +G +YLDF++G     L
Sbjct: 8   QAILASNQHFLDRQDVMESNVRSYPRKLPFAYAKAQGCWVTDVEGNEYLDFLAGAGTLAL 67

Query: 54  GHAHPEVAEAVCKQVKT-LLHCSNIYWIEPQVKLAKLLVENSCADK---AFFCNSGAEAN 109
           GH HP + +A+   + +             +   ++ L+     DK    F   SGA+AN
Sbjct: 68  GHNHPILMQAIKDVLDSGXXXXXXXXXXXXKDAFSEELLSFFPKDKYILQFTGPSGADAN 127

Query: 110 EGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVP 169
           E AIKLA+ Y        +  II  +  FHG T   +  TG    +  ++ L  G  ++P
Sbjct: 128 EAAIKLAKTYT------GRGNIIAFSGGFHGMTQGALALTGNLGAKNAVENLMPGVQFMP 181

Query: 170 F------------------------NDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAY 205
           +                        N +E +++ +     AV+LE +QGEGGV+ A  ++
Sbjct: 182 YPHEYRCPFGIGGEAGAKAVEQYFENFIEDVESGV-VKPAAVILEAIQGEGGVVSAPISF 240

Query: 206 LEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           L+ V+++ ++ G+L+I DEVQ G  R+G+   ++H G+EPDII ++KA+GG  P+ A+LA
Sbjct: 241 LQKVREVTQKHGILMIVDEVQAGFCRSGRMFAFEHAGIEPDIIVMSKAVGGSLPL-AVLA 299

Query: 266 KEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
             +   A+QP  H  TF GN LA     A+++ +  + + +NA + GEY    L +L+ E
Sbjct: 300 IRKEFDAWQPAGHTGTFRGNQLAMATGYASLKIMRDENLAQNAQERGEYLTNALRELSKE 359

Query: 326 VPLVKEVR 333
            P +  VR
Sbjct: 360 YPCIGNVR 367


>Y4UB_RHISN RecName: Full=Uncharacterized aminotransferase y4uB;    
               EC=2.6.1.-;
          Length = 467

 Score =  177 bits (450), Expect = 1e-46
 Identities = 125/422 (29%), Positives = 209/422 (49%), Gaps = 48/422 (11%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLL--HCSNI 77
           R P  +  G+G  + DA G Q +D  +G+    +G+   EVAEA+ +Q   L   H    
Sbjct: 32  REPTIVETGKGIRIQDARGNQLIDGFAGLYCVNVGYGRTEVAEAISRQAYRLAYYHSYAA 91

Query: 78  YWIEPQVKLAKLLVENSCA--DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           +  +    L+  LV+ +     K F+  SG++ANE   KL   Y      P K +II+  
Sbjct: 92  HTTDELAILSDRLVKMAPGKMSKVFYGMSGSDANETQAKLVWYYNNLRGKPTKKKIISRE 151

Query: 136 NSFHGRTLATVTATGQTKYQRGLD-PLPQ--------------------GFAYVPFNDLE 174
             +HG ++ + + TG + Y   +D PLPQ                     F+     +L+
Sbjct: 152 RGYHGCSVVSGSMTGMSFYHDHMDLPLPQICHTGVPHHYWGANPGETEREFSARRAAELD 211

Query: 175 ALKNTIGPHTC-AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
            +  T+GP    A + EPV G GG+ P  + Y E ++ + ++  +LLI DEV  G GRTG
Sbjct: 212 EMIETLGPDNVGAFIAEPVLGTGGITPPPEGYWEAIQAVLKKHDVLLIADEVITGFGRTG 271

Query: 234 KFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPG-------DHASTFGGN 285
              G QHYG+EPD+IT+AK L    FP+ A +  E+V +  + G        H  T+ G+
Sbjct: 272 SMFGSQHYGIEPDLITVAKGLTSAYFPLSASIVGEKVYKVLEDGADRVGAFSHGYTYSGH 331

Query: 286 PLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXX 345
           P+ A A+ A ++ + ++ +  NA ++G YF+A+L +  A++P+V EVR            
Sbjct: 332 PIGAAAANAVLDIVEKEDLPGNAREVGGYFQAQLKEKFAQLPIVGEVRGVGLMGAIEFVG 391

Query: 346 XXKD-------------IVAHCLEQGLLINC-TNGNVLRFLPPLIITKDEIDQAVQILKR 391
             ++             +     ++GL+     +G++L F PPL+ TK+E+D+ V + ++
Sbjct: 392 DRENKKRFDPLLKVGARVSKAARDRGLIARAMPHGDILGFAPPLVTTKEEVDEIVAMAEK 451

Query: 392 AM 393
           A+
Sbjct: 452 AV 453


>Y1815_ARCFU RecName: Full=Uncharacterized aminotransferase AF_1815;
                   EC=2.6.1.-;
          Length = 424

 Score =  176 bits (446), Expect = 3e-46
 Identities = 127/374 (33%), Positives = 175/374 (46%), Gaps = 16/374 (4%)

Query: 29  QGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAK 88
           +G W WD DGR+ +D      V  LGH HPE+ + + + +  L   ++    E + +LA+
Sbjct: 41  EGVWYWDLDGRKLMDCHCNGGVFNLGHRHPEIVKTLVEALDELDIGNHHLISEQRARLAE 100

Query: 89  LLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATV 146
            L E    D  +  F   G EA + AIKLAR     H G  K  II A   +HG T    
Sbjct: 101 KLAELMPGDISRTVFGVGGGEAIDFAIKLARG----HTGRKK--IIYAKGGYHGHT-GFA 153

Query: 147 TATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYL 206
            A G  KY++  +PL  GF  VPF                 + E +    G+    + + 
Sbjct: 154 LAAGDEKYRKPFEPLAPGFVEVPFGXXXXXXXXXXXXXXXXLFETIPATLGMPLPPEDFY 213

Query: 207 EGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLA 265
             V+++C+EKG L+I DEVQ GLGRTGK  G +HY V PD+I  AK L GG +PI A   
Sbjct: 214 RRVREICDEKGCLMIMDEVQTGLGRTGKMWGIEHYKVVPDVIVTAKGLSGGVYPISATCF 273

Query: 266 KEQV--AQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLA 323
           KE +    A  P  H STFGG  L    +   +E   ++  LEN  + GE     L KL 
Sbjct: 274 KEGLDDFMAENPFIHVSTFGGAELGCVVAEKVLEITSRESFLENVRKTGEALSEILGKLK 333

Query: 324 AEVPLVKEVRXXXXXXXXXXXXXXKD--IVAHCLEQGLLINCTNG--NVLRFLPPLIITK 379
            E   V E+R                  +   C   G+L    N   +V++FLPPLI+ +
Sbjct: 334 DEYDFVDEIRQKGLFIGIKMVEEGWGPLLSISCYHSGILAVYANNDTSVMQFLPPLIVGE 393

Query: 380 DEIDQAVQILKRAM 393
            E+D   + L  AM
Sbjct: 394 KEVDYIREKLAGAM 407


>ECTB_NOCFA RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 436

 Score =  174 bits (441), Expect = 1e-45
 Identities = 126/399 (31%), Positives = 198/399 (49%), Gaps = 35/399 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P      +GAW+ D DG+ YLDF +G      GH +P + + +   + +  + H  ++  
Sbjct: 24  PTVFTTAKGAWLQDEDGKDYLDFFAGAGALNYGHNNPVLKQPLIDYIASDGITHGLDMST 83

Query: 80  IEPQVKLAKLLVENSCADKA------FFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
              + KL + L +   A +       F   +GA A E A+KLARK   +        +++
Sbjct: 84  AAKR-KLLETLRDTVFAPRGLDYKVQFPGPTGANAVEAALKLARKVTGRET------VLS 136

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFN--------DLEALKNTIGPHT- 184
            TN+FHG TL  ++ TG    + G        A++P++        D + ++  +   + 
Sbjct: 137 FTNAFHGMTLGALSVTGNAAKRAGAGVPLVHAAHMPYDGYFDNTTADFQWMERVLDDTSS 196

Query: 185 -----CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                 AV++E VQGEGG+  A   +L+ + QLC E+ +LLI D+VQ G GRTG F  ++
Sbjct: 197 GFDRPAAVIVETVQGEGGINVARVEWLQHLAQLCAEREILLIVDDVQMGCGRTGPFFSFE 256

Query: 240 HYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
             G+ PDI+TL+K++GG G P+  +L K ++ Q + PG+H  TF GN  A   +   +ET
Sbjct: 257 VAGITPDIVTLSKSIGGYGLPLALVLFKPELDQ-WAPGEHNGTFRGNNPAFVTAQVALET 315

Query: 299 LLQKGVLENAWQ-MGEYFKAELTKLAAEVP-LVKEVRXXXXXXXXXXXXXXKDIVAHCLE 356
               G LE A +  GE    EL  +A   P L    R                +     E
Sbjct: 316 FWSDGALEAATKAKGEKVATELATVAGHFPGLSTRGRGLVHGIAFEDPSQAGKVCQVAFE 375

Query: 357 QGLLINCTNGN--VLRFLPPLIITKDEIDQAVQILKRAM 393
           +GLL+  +  +  V++ LPPL IT DE+DQ +QIL  A+
Sbjct: 376 RGLLVETSGSSDEVVKLLPPLTITDDELDQGLQILTGAI 414


>OAT_VIGAC RecName: Full=Ornithine aminotransferase;       
           EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid
           aminotransferase;
          Length = 426

 Score =  173 bits (439), Expect = 2e-45
 Identities = 106/335 (31%), Positives = 170/335 (50%), Gaps = 8/335 (2%)

Query: 1   MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV 60
           + ++++    Q+Y  + Y        KG      D +G++Y DF+S  +    GH HP++
Sbjct: 40  VTSEQVFEREQKYGAHNYHHCSAYRAKGVSL---DMEGKRYFDFLSAYSAVNQGHCHPKI 96

Query: 61  AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLAR--K 118
              + +Q + L   S  ++ +   +  + L +    DK    N+G E  E A K+AR   
Sbjct: 97  VNTMVEQAQRLTLTSRAFYTDVLGEYEEFLTKLFNYDKVLPMNTGVEGGETACKIARCWA 156

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKN 178
           Y K+ +  ++ +II A N+F GRTL+ ++A+        L P   GF  V +ND  AL+ 
Sbjct: 157 YMKKKVPENQAKIIFAENNFWGRTLSAISASTDPMSYDELRPYMPGFEIVKYNDTAALEK 216

Query: 179 TI-GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLG 237
               P+ CA M+EP+QGE GV+     YL  V++LC +  +L I DEVQ GL RTG+ L 
Sbjct: 217 AFQDPNVCAYMVEPIQGEAGVVALDAGYLTEVRELCTKYNVLFIADEVQTGLARTGRMLA 276

Query: 238 YQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATM 296
             H  V+PD++ L KAL GG +P+ A+L  + +    QPG H +    +P     + +  
Sbjct: 277 VDHEDVKPDLLILGKALSGGLYPVSAVLRDDHIMDCIQPGLHTAMDVMDPRMRILAASRY 336

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAE-VPLVK 330
              + +   ENA     Y + EL  L  + VP+V+
Sbjct: 337 YVRVARERCENAQIQATYLRKELNTLPKDVVPVVR 371


>YFZ7_SCHPO RecName: Full=Uncharacterized aminotransferase
           C1039.07c;         EC=2.6.-.-;
          Length = 448

 Score =  171 bits (432), Expect = 1e-44
 Identities = 118/413 (28%), Positives = 189/413 (45%), Gaps = 49/413 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P  +V+ +G  V+D      LDF SG     LGH+HP++   + K +  L+H  + +   
Sbjct: 33  PKIIVRAKGCCVYDEQDNAILDFTSGQMSAILGHSHPDITACIEKNLPKLVHLFSGFLSP 92

Query: 82  PQVKLAKLLVE--NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P V+LA  L +      DK  F ++G EANE A+++A+ Y       +KYE +  ++S+H
Sbjct: 93  PVVQLATELSDLLPDGLDKTLFLSTGGEANEAALRMAKVYT------NKYECVAFSSSWH 146

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVP--------FNDLEAL--------------- 176
           G T    + T     +RG  P   G   +P        F D +                 
Sbjct: 147 GVTGGAASLTFAAA-RRGYGPALPGSYTIPEPNPKLSPFRDAKGNYDWQKELDYSFYMLD 205

Query: 177 KNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFL 236
           K + G   C ++ E +   GG+I   Q YL+ +K+ CEE+G+LLI DE Q G+GRTG   
Sbjct: 206 KQSTGSLACMIV-ETILSTGGIIELPQGYLKALKKKCEERGMLLIIDEAQTGIGRTGSMF 264

Query: 237 GYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAATASLA 294
            ++H+G+ PDI+TL+K+LG G  + A++  E++ +          +T   +PL A     
Sbjct: 265 SFEHHGIVPDILTLSKSLGAGTALAAVITSEEIEKVCYDNGFVFYTTHASDPLPAAIGST 324

Query: 295 TMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD----- 349
            ++ + +  ++E A   GE             PL+ +VR                     
Sbjct: 325 VLKVVKRDNLVEKAKISGEXXXXXXXXXXXXHPLIVDVRGLGLLQGIEIASCTDPSKPSD 384

Query: 350 -----IVAHCLEQGLLINCTN----GNVLRFLPPLIITKDEIDQAVQILKRAM 393
                I   CLE G+  N  +    G V R  PPL +T +EI +A++I   A+
Sbjct: 385 FLGTVIGDKCLELGMNCNIVHLRGIGGVFRIAPPLTVTDEEIHKAIEIFDSAL 437


>TPA_BILWA RecName: Full=Taurine--pyruvate aminotransferase;        
           EC=2.6.1.77;
          Length = 456

 Score =  171 bits (432), Expect = 1e-44
 Identities = 139/445 (31%), Positives = 209/445 (46%), Gaps = 54/445 (12%)

Query: 5   EILAMGQQYVMNTYGRL----PMALVKGQGAWVWDADGRQYLDFVSG--IAVNCLGHAHP 58
           E++A+ ++YV +   +     P   VKG+G  + D DG+ YLD VSG    VN +G+   
Sbjct: 7   ELVALDKKYVWHHLTQHKNFEPAIYVKGEGMRITDIDGKTYLDAVSGGVWTVN-VGYGRK 65

Query: 59  EVAEAVCKQVKTLLHCSNIYWIEPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLAR 117
           E+ +AV KQ+  + + +N     P +K + KL+ +     + +  NSG+EANE A K+ R
Sbjct: 66  EIVDAVAKQMMEMCYFANGIGNVPTIKFSEKLISKMPGMSRVYLSNSGSEANEKAFKIVR 125

Query: 118 KYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVP-------- 169
           +  +   G  K  I+     +HG T+ T++A GQ + +    P   GF   P        
Sbjct: 126 QIGQLKHGGKKTGILYRARDYHGTTIGTLSACGQFERKVQYGPFAPGFYEFPDCDVYRSK 185

Query: 170 FND-----------LEALKNTIGPHTC-AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKG 217
           F D           LE +  T+GP    AV++EP+   GG++     Y E ++++C++  
Sbjct: 186 FGDCADLGVKMAKQLEEVILTVGPDELGAVIVEPMTAGGGILVPPAGYYETIREICDKYE 245

Query: 218 LLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAF--Q 274
           LLLI DEV CGLGRTGK+ GYQH+ V+PDI+T+AK +  G+ PI   +  E+V Q F   
Sbjct: 246 LLLIIDEVVCGLGRTGKWFGYQHFNVQPDIVTMAKGVASGYAPISCTVTTEKVFQDFVND 305

Query: 275 PGD------HASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPL 328
           P D        STFGG                         +MG+     L  L A+ P+
Sbjct: 306 PADTDAYFRDISTFGGCTSGPXXXXXXXXXXXXXXXXXXCTKMGDRLLEGLKGLMAKHPI 365

Query: 329 VKEVR-----------XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTN------GNVLRF 371
           + +VR                                   G+LI  T+       N L  
Sbjct: 366 IGDVRGKGLFAGIEIVKDRATKEPIXXXXXXXXXXXXXXXGVLIGKTSRSFREFNNTLTL 425

Query: 372 LPPLIITKDEIDQAVQILKRAMLVV 396
            P LI T+ +ID+ V  + +A   V
Sbjct: 426 CPALIATEADIDEIVAGIDKAFTTV 450


>AGT2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase 2,
           mitochondrial;         Short=AGT 2;       
           EC=2.6.1.44;AltName:
           Full=(R)-3-amino-2-methylpropionate--pyruvate
           transaminase;
          Length = 513

 Score =  171 bits (432), Expect = 1e-44
 Identities = 129/450 (28%), Positives = 210/450 (46%), Gaps = 70/450 (15%)

Query: 6   ILAMGQQY---VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +LA+ +Q+   V   Y R P+ L +G   W++D++G +YLDF SGI    +GH HP+V+ 
Sbjct: 65  VLAIHKQHLSPVDTAYFRKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVSVGHCHPKVSA 124

Query: 63  AVCKQVKTLLHCSNIYWIEPQ----VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARK 118
              KQ+  L H S++++  P      KL+ LL E       F  NSG+EAN+ A+ +AR 
Sbjct: 125 VAKKQIDRLWHTSSVFFHSPMHEYAEKLSALLPEP--LKVIFLVNSGSEANDLAMVMARA 182

Query: 119 YAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL------------DPLPQGFA 166
           ++         +II+   ++HG +  T+  T    Y+  +            D     + 
Sbjct: 183 HSNHT------DIISFRGAYHGCSPYTLGLTNVGIYKMEVPGGIGCQSTMCPDVFRGPWG 236

Query: 167 YVPFND----------------------LEALKNTIGPHTCAVML----EPVQGEGGVIP 200
            +   D                      +E  K+T+       +     EP+QG  GV+ 
Sbjct: 237 GIHCRDSPVQTVRDCSCAPDCCQAKERYIEQFKDTLNTSVATSIAGFFAEPIQGVNGVVQ 296

Query: 201 AAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVEPDIITLAKALGGGFP 259
             + +L+    L  E+G + I DEVQ G GR G  F G+Q + V PDI+T+AK +G GFP
Sbjct: 297 YPKEFLKEAFALVRERGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFP 356

Query: 260 IGAMLAKEQVAQAFQPGD-HASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAE 318
           + A++   ++A++      H STFGGNPLA     A +E + ++ +  N+ ++G Y   +
Sbjct: 357 MAAVVTTPEIAKSLAKRLLHFSTFGGNPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLK 416

Query: 319 LTKLAAEVPLVKEVR-----------XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN 367
             KL  E  +V +VR                           I   C + GLL+    GN
Sbjct: 417 FAKLRDEFDIVGDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVG-RGGN 475

Query: 368 ---VLRFLPPLIITKDEIDQAVQILKRAML 394
                R +PP+ +TK E+D A ++ + A++
Sbjct: 476 FSQTFRIVPPMCVTKMEVDFAYEVFRAALI 505


>AGT21_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
           homolog 1, mitochondrial;         EC=2.6.1.44;AltName:
           Full=Beta-alanine-pyruvate aminotransferase 1;
          Length = 476

 Score =  169 bits (429), Expect = 3e-44
 Identities = 120/407 (29%), Positives = 187/407 (45%), Gaps = 46/407 (11%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y + P+ +V+G+  +++D  GR+YLD  +GI     GH HP++  A+ +Q K L H + I
Sbjct: 74  YYQKPLNIVEGKMQYLYDESGRRYLDAFAGIVTVSCGHCHPDILNAITEQSKLLQHATTI 133

Query: 78  YWIEPQVKLAKLLVENSCADK--AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
           Y        A+ L      +    +F NSG+EANE A+ +AR Y          E+I+  
Sbjct: 134 YLHHAIGDFAEALAAKMPGNLKVVYFVNSGSEANELAMMMARLYT------GSLEMISLR 187

Query: 136 NSFHGRTLATV--TATGQTKYQRGLDPLPQGFAYVPFN----------DLEALKNTIGPH 183
           N++HG +  T+  TA    KY     PLPQG  +   N          D       +  H
Sbjct: 188 NAYHGGSSNTIGLTALNTWKY-----PLPQGEIHHVVNPDPYRGVFGSDGSLYAKDVHDH 242

Query: 184 --------TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK- 234
                       + E +QG GG +  A  YL+ V ++    G + I DEVQ G GRTG  
Sbjct: 243 IEYGTSGKVAGFIAETIQGVGGAVELAPGYLKSVYEIVRNAGGVCIADEVQTGFGRTGSH 302

Query: 235 FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLA 294
           + G+Q   V PDI+T+AK +G G P+GA++   ++A         +TFGGNP+ +   LA
Sbjct: 303 YWGFQTQDVVPDIVTMAKGIGNGLPLGAVVTTPEIASVLASKILFNTFGGNPVCSAGGLA 362

Query: 295 TMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD----- 349
            +  + ++   E+  ++G +    L  +     ++ +VR              KD     
Sbjct: 363 VLNVIDKEKRQEHCAEVGSHLIQRLKDVQKRHDIIGDVRGRGLMVGIELVSDRKDKTPAK 422

Query: 350 -----IVAHCLEQGLLI--NCTNGNVLRFLPPLIITKDEIDQAVQIL 389
                +     E G+L+     +GNV R  PP+  TKD+ D  V  L
Sbjct: 423 AETSVLFEQLRELGILVGKGGLHGNVFRIKPPMCFTKDDADFLVDAL 469


>AGT2_PONAB RecName: Full=Alanine--glyoxylate aminotransferase 2,
           mitochondrial;         Short=AGT 2;       
           EC=2.6.1.44;AltName:
           Full=(R)-3-amino-2-methylpropionate--pyruvate
           transaminase;
          Length = 514

 Score =  167 bits (422), Expect = 2e-43
 Identities = 120/435 (27%), Positives = 197/435 (45%), Gaps = 61/435 (14%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           V+  Y + P+ L +G   W++DA+G +YLDF SGI    +GH HP+V     KQ+  L H
Sbjct: 77  VVTAYFQKPLLLHQGHMEWLFDAEGNRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGRLWH 136

Query: 74  CSNIYWIEP--QVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            S +++  P  +                F  NSG+EANE A+ +AR ++      +  +I
Sbjct: 137 TSTVFFHPPMHEYXXXXXXXXXXXXXVIFLVNSGSEANELAMLMARAHS------NNIDI 190

Query: 132 ITATNSFHGRTLATVTATGQTKYQR------GLDPL--------PQGFAYVPFNDLEALK 177
           I+   ++HG +  T+  T    Y+       G  P         P G ++   + ++ ++
Sbjct: 191 ISFRGAYHGCSPYTLGLTNIGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIR 250

Query: 178 N-TIGPHTCAV-----------------------MLEPVQGEGGVIPAAQAYLEGVKQLC 213
             +  P  C                           EP+QG  GV+   + +L+   +L 
Sbjct: 251 KCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPKGFLKEAFELV 310

Query: 214 EEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQA 272
             +G + I DEVQ G GR G  F G+Q + V PDI+T+AK +G GFP+ A++   ++A++
Sbjct: 311 RARGGVCIADEVQTGFGRLGSHFRGFQTHDVLPDIVTMAKGIGNGFPMAAVVTTPEIAKS 370

Query: 273 FQPG-DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKE 331
                 H +TFGGNP+A     A +E + ++ + EN+ ++G Y   +  KL  E  +V +
Sbjct: 371 LVKRLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLQFAKLRDEFEIVGD 430

Query: 332 VR-----------XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTN--GNVLRFLPPLIIT 378
           VR                           I   C   GLL+   +      R  P + IT
Sbjct: 431 VRGKGLMIGIEMVQDKISRRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCIT 490

Query: 379 KDEIDQAVQILKRAM 393
           K E+D AV++ + A+
Sbjct: 491 KPEVDFAVEVFRSAL 505


>AGT2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase 2,
           mitochondrial;         Short=AGT 2;       
           EC=2.6.1.44;AltName:
           Full=(R)-3-amino-2-methylpropionate--pyruvate
           transaminase;
          Length = 514

 Score =  167 bits (422), Expect = 2e-43
 Identities = 120/435 (27%), Positives = 197/435 (45%), Gaps = 61/435 (14%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           V+  Y + P+ L +G   W++DA+G +YLDF SGI    +GH HP+V     KQ+  L H
Sbjct: 77  VVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGRLWH 136

Query: 74  CSNIYWIEP--QVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
            S +++  P  +                F  NSG+EANE A+ +AR ++      +  +I
Sbjct: 137 TSTVFFHPPMHEYXXXXXXXXXXXXXVIFLVNSGSEANELAMLMARAHS------NNIDI 190

Query: 132 ITATNSFHGRTLATVTATGQTKYQR------GLDPL--------PQGFAYVPFNDLEALK 177
           I+   ++HG +  T+  T    Y+       G  P         P G ++   + ++ ++
Sbjct: 191 ISFRGAYHGCSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIR 250

Query: 178 N-TIGPHTCAV-----------------------MLEPVQGEGGVIPAAQAYLEGVKQLC 213
             +  P  C                           EP+QG  GV+   + +L+   +L 
Sbjct: 251 KCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPKGFLKEAFELV 310

Query: 214 EEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQA 272
             +G + I DEVQ G GR G  F G+Q + V PDI+T+AK +G GFP+ A++   ++A++
Sbjct: 311 RARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAAVITTPEIAKS 370

Query: 273 FQPG-DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKE 331
                 H +TFGGNP+A     A +E + ++ + EN+ ++G Y   +  KL  E  +V +
Sbjct: 371 LAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAKLRDEFEIVGD 430

Query: 332 VR-----------XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTN--GNVLRFLPPLIIT 378
           VR                           I   C   GLL+   +      R  P + IT
Sbjct: 431 VRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCIT 490

Query: 379 KDEIDQAVQILKRAM 393
           K E+D AV++ + A+
Sbjct: 491 KPEVDFAVEVFRSAL 505


>AGT2_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase 2,
           mitochondrial;         Short=AGT 2;       
           EC=2.6.1.44;AltName:
           Full=(R)-3-amino-2-methylpropionate--pyruvate
           transaminase;
          Length = 514

 Score =  165 bits (417), Expect = 7e-43
 Identities = 127/443 (28%), Positives = 198/443 (44%), Gaps = 75/443 (16%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           V   Y   P+ L +G   W++D +G +YLDF SGI    +GH HP+V  A  +Q+  L H
Sbjct: 77  VHTAYFPEPLLLHQGHVEWLFDHEGNRYLDFFSGIVTVSVGHCHPKVNAAAQRQLGRLWH 136

Query: 74  CSNIYWI----EPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKY 129
            S++++     E   KL+ LL E       F  NSG+EAN+ A+ +AR ++      +  
Sbjct: 137 TSSVFFHPLIHEYAEKLSALLPEP--LKVVFLVNSGSEANDLAMLMARAHS------NST 188

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVP-------------------- 169
           +II+   ++HG +  T+  T    Y+  L   P G    P                    
Sbjct: 189 DIISFRGAYHGCSPYTLGLTNVGIYKMDL---PHGMGCQPTMCPDIFHGPWGGSHCRDSP 245

Query: 170 -----------------------FNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYL 206
                                  F D   L  ++         EP+QG  GV+   + +L
Sbjct: 246 VQTIRKCSCAPDCCQAKDQYIEQFKD--TLSTSVAKSIAGFFAEPIQGVNGVVQYPKGFL 303

Query: 207 EGVKQLCEEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVEPDIITLAKALGGGFPIGAMLA 265
           +   +L  E+G + I DEVQ G GR G  F G+Q + V PDI+T+AK +G GFP+ A++ 
Sbjct: 304 KEAFELVRERGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAAVVT 363

Query: 266 KEQVAQAFQPGD-HASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAA 324
              +A++      H +TFGGNP+A     A +E + ++ + EN+ ++G Y   +L KL  
Sbjct: 364 TPDIAKSLTKRMLHFNTFGGNPMACAVGSAVLEVIKEENLQENSQEVGTYMLLKLAKLRD 423

Query: 325 EVPLVKEVRXXXXXXXXXXXXXXK-----------DIVAHCLEQGLLINCTN--GNVLRF 371
           E  +V +VR              +            I   C   GLLI          R 
Sbjct: 424 EFEIVGDVRGKGLMIGIEMVKDKESRQPLPREEVNQIHHDCKCMGLLIGRGGLFSQTFRI 483

Query: 372 LPPLIITKDEIDQAVQILKRAML 394
            P + ITK E+D AV++ + A++
Sbjct: 484 APSMCITKPEVDFAVEVFRSALI 506


>DAT_ACIBA RecName: Full=Diaminobutyrate--2-oxoglutarate
           aminotransferase;         EC=2.6.1.76;AltName:
           Full=L-2,4-diaminobutyrate:2-ketoglutarate
           4-aminotransferase;
          Length = 445

 Score =  164 bits (415), Expect = 1e-42
 Identities = 114/410 (27%), Positives = 189/410 (46%), Gaps = 44/410 (10%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT-LLHCSNIY 78
           +LP+A+ K QG WV D +G QYLD ++G     LGH HP V +++   + +         
Sbjct: 34  KLPLAIAKAQGCWVTDVEGTQYLDCLAGAGTLALGHNHPAVIQSIQDTLASGXXXXXXXX 93

Query: 79  WIEPQVKLAKLLVENSCADKAFFC-----NSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
               +    + L+      K  +C      SGA+A E AIKLA+ Y        +  +I+
Sbjct: 94  XXXXKDAFTEALLAYLPGGKEEYCLQFCGPSGADATEAAIKLAKTYT------GRSSVIS 147

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPF----------------------- 170
            +  +HG T  ++  TG    +  ++ L  G  ++P+                       
Sbjct: 148 FSGGYHGMTHGSLAMTGNLSAKNAVNGLMPGVQFMPYPHEYRCPLGLGGEAGVDALTYYF 207

Query: 171 -NDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL 229
            N +E +++ +     AV+LE +QGEGGV+ A   +L+ ++++ E+  ++LI DEVQ G 
Sbjct: 208 ENFIEDVESGV-TKPAAVILEAIQGEGGVVTAPVKWLQKIREVTEKHNIVLILDEVQAGF 266

Query: 230 GRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAA 289
            R+GK   ++H G+EPD++ ++K             K +   A+QP  H  TF GN LA 
Sbjct: 267 ARSGKMFAFEHAGIEPDVVVMSKXXXXXXXXXXXXIKRKF-DAWQPAGHTGTFRGNQLAM 325

Query: 290 TASLATMETLLQKGVLENAWQMGEY---FKAELTKLAAEVPLVKEVR-XXXXXXXXXXXX 345
              L  +ET+ ++ + +NA + GE+          L   V +V E +             
Sbjct: 326 GTGLVVLETIKEQNLAQNAQERGEFPCIGNVRGRGLMIGVEIVDERKPADRIGSHPADSQ 385

Query: 346 XXKDIVAHCLEQGLLI--NCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
               I   C    LL+     NG V+R L PLIIT++E  + +   K+A+
Sbjct: 386 LAAAIQTACFNNNLLLEKGGRNGTVIRLLCPLIITQEECVEVIARFKKAV 435


>AGT2_RAT RecName: Full=Alanine--glyoxylate aminotransferase 2,
           mitochondrial;         Short=AGT 2;       
           EC=2.6.1.44;AltName:
           Full=(R)-3-amino-2-methylpropionate--pyruvate
           transaminase;
          Length = 512

 Score =  163 bits (412), Expect = 3e-42
 Identities = 122/438 (27%), Positives = 199/438 (45%), Gaps = 67/438 (15%)

Query: 14  VMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH 73
           V   Y + P+ L +G   W++D++G +YLDF SGI    +GH HP+V     KQ+  L H
Sbjct: 75  VNTAYFQKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVGVGHCHPKVTAVAKKQMDRLWH 134

Query: 74  CSNIYWIEPQ----VKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKY 129
            S++++  P      +L+ LL E       F  NSG+EAN+ A+ +AR Y+         
Sbjct: 135 TSSVFFHSPMHEYAERLSALLPEP--LKVIFLVNSGSEANDLAMVMARAYSNHT------ 186

Query: 130 EIITATNSFHGRTLATVTATGQTKYQRGLDPL--------------PQGFAYVPFNDLEA 175
           +II+   ++HG +  T+  T    Y+  +                 P G ++   + ++ 
Sbjct: 187 DIISFRGAYHGCSPYTLGLTNVGIYKMKVPSTIACQSTMCPDVFRGPWGGSHCRDSPVQT 246

Query: 176 LKN-TIGPHTCAV-----------------------MLEPVQGEGGVIPAAQAYLEGVKQ 211
           ++  +  P  C                           EP+QG  GV+   + +L+    
Sbjct: 247 VRKCSCAPDGCQAKERYIEQFKDTLNTSVATSIAGFFAEPIQGVNGVVQYPKEFLKEAFA 306

Query: 212 LCEEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVA 270
           L  E+G + I DEVQ G GR G  F G+Q +   PDI+T+AK +G GFP+ A++   ++A
Sbjct: 307 LVRERGGVCIADEVQTGFGRLGSHFWGFQTHDTMPDIVTMAKGIGNGFPMAAVVTTPEIA 366

Query: 271 QAFQPG-DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLV 329
            +      H STFGG+PLA     A +E + ++ +  N+ ++G Y   +  KL  E  +V
Sbjct: 367 SSLAKHLHHFSTFGGSPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLKFAKLRDEFDIV 426

Query: 330 KEVR-----------XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGN---VLRFLPPL 375
            +VR                           I   C + GLL+    GN     R  PP+
Sbjct: 427 GDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVG-RGGNFSQTFRIAPPM 485

Query: 376 IITKDEIDQAVQILKRAM 393
            +TK E+D A ++ + A+
Sbjct: 486 RVTKLEVDFAFEVFRSAL 503


>ARGD_AERPE RecName: Full=Acetylornithine/acetyl-lysine
           aminotransferase;         Short=ACOAT;       
           EC=2.6.1.11;         EC=2.6.1.-;
          Length = 388

 Score =  162 bits (410), Expect = 5e-42
 Identities = 98/292 (33%), Positives = 148/292 (50%), Gaps = 15/292 (5%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           YG   + +VKG   +VWD  GR+YLD  +G     LGH++P + EAV +Q + L+  S+ 
Sbjct: 11  YGYRGLRIVKGSMQYVWDDSGRKYLDCHAGHGAAFLGHSNPAIVEAVVRQARELVAASSS 70

Query: 78  YWIEPQVKLAKLLVENS-----CADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
           +       L + L E S      A++  F N+                          I+
Sbjct: 71  F---STPSLEEALTEFSRIAPPWAEEIVFLNTXXXXXXXXXXXXXXXXXXR------GIV 121

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPV 192
              NSFHGRTLA+++ T   +Y+RG+  L   F   P  D   ++  +   T A+++EP+
Sbjct: 122 ALKNSFHGRTLASLSVTWNPRYRRGVPVLDTRFLS-PSTDPGEVEKLVPEDTAAIIVEPI 180

Query: 193 QGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAK 252
           QGEGG+        + +++  +  G LLIFDE+Q G GRTG+   ++  GVEPDI+T  K
Sbjct: 181 QGEGGLTKIYAELAKALREAADRVGALLIFDEIQTGFGRTGRVWAHESLGVEPDIMTAGK 240

Query: 253 ALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGV 304
           ++ GG P  A+L++E V      G H ST   NPL+  A  A    L ++GV
Sbjct: 241 SIAGGLPASAVLSREGVLATLASGRHGSTHAANPLSMAAVAAASRFLREEGV 292


>ECTB_CHRSD RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 423

 Score =  160 bits (404), Expect = 2e-41
 Identities = 116/412 (28%), Positives = 200/412 (48%), Gaps = 41/412 (9%)

Query: 15  MNTYGR-LPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--L 71
           + TY R  P    + +GA +   DG QY+DF++G      GH HP++ +A+   + +  +
Sbjct: 13  VRTYSRSFPTVFTEAKGARLHAEDGNQYIDFLAGAGTLNYGHNHPKLKQALADYIASDGI 72

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCN------SGAEANEGAIKLARKYAKQHLG 125
           +H  ++ W   +    + L E     +           +G  A E AI+LAR    +H  
Sbjct: 73  VHGLDM-WSAAKRDYLETLEEVILKPRGLDYKVHLPGPTGTNAVEAAIRLARNAKGRH-- 129

Query: 126 PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-QGFAYVPFND--------LEAL 176
                I+T TN FHG T+  +  TG  K++     +P QG +++PF+         L   
Sbjct: 130 ----NIVTFTNGFHGVTMGALATTGNRKFREATGGIPTQGASFMPFDGYMGEGVDTLSYF 185

Query: 177 KNTIGPHT------CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLG 230
           +  +G ++       AV++E VQGEGG+ PA   +L+ ++++C +  +LLI D++Q G G
Sbjct: 186 EKLLGDNSGGLDVPAAVIIETVQGEGGINPAGIPWLQRLEKICRDHDMLLIVDDIQAGCG 245

Query: 231 RTGKFLGYQHYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAA 289
           RTGKF  ++H G+ PDI+T +K+L G G P   +L + ++   ++PG +  TF G  LA 
Sbjct: 246 RTGKFFSFEHAGITPDIVTNSKSLSGFGLPFAHVLMRPEL-DIWKPGQYNGTFRGFNLAF 304

Query: 290 TASLATMETLLQKGVLE-NAWQMGEYFKAELTKLAAEV-----PLVKEVRXXXXXXXXXX 343
             + A M         E +  + G   +    KLA+ +     P  +  R          
Sbjct: 305 VTAAAAMRHFWSDDTFERDVQRKGRVVEDRFQKLASFMTEKGHPASERGRGLMRGLDVGD 364

Query: 344 XXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                 I A   + GL+I  +  +G V++ L PL IT +++   + IL++++
Sbjct: 365 GDMADKITAQAFKNGLIIETSGHSGQVIKCLCPLTITDEDLVGGLDILEQSV 416


>GSA2_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  159 bits (401), Expect = 5e-41
 Identities = 103/307 (33%), Positives = 157/307 (51%), Gaps = 23/307 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG+G+ ++D DG  Y+D++       LGHAHP V  A+ +     L  S   
Sbjct: 32  GGNPVYIEKGEGSRIFDVDGNSYIDYIGSWGPLILGHAHPRVLAAITEVAA--LGTSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E + ++AKL+ E     +     NSG EA   A++LAR Y +++      +I+     
Sbjct: 90  PTERETEMAKLVCEIVPSVEVVRMVNSGTEATMSALRLARGYTRRN------KIMKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAV 187
           +HG   + +   G      GL     +P+G A+    VP+NDLE++K      G    AV
Sbjct: 144 YHGHADSLLIKAGSGVATLGLPDSPGVPEGTAHNTITVPYNDLESVKLAFEAFGDDLAAV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EP+ G  GV+P    +LEG++++ E+ G LLIFDEV  G  R       + YG+ PD+
Sbjct: 204 IVEPIGGNMGVVPPQPGFLEGLREITEKHGTLLIFDEVMTGF-RVALGGAQELYGITPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   K ++ Q   P      A T  GNPLA  A L T++ L + G 
Sbjct: 263 TTMGKVIGGGLPVGAYGGKREIMQQVAPAGPIYQAGTLSGNPLAMAAGLTTLQELSKPGA 322

Query: 305 LENAWQM 311
            E   +M
Sbjct: 323 YERLEKM 329


>GSA_METMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  158 bits (400), Expect = 7e-41
 Identities = 103/326 (31%), Positives = 162/326 (49%), Gaps = 27/326 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++ L  G    +  +   P  +   +  +++D DG +++D+        LGHA+  +  
Sbjct: 17  SKKYLVGGVNSPVRLFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILN 76

Query: 63  AVCKQVKTLLHCSNIYWI--EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKY 119
           AV    K+ +     Y +  E ++ LAK ++    CA+   F NSG EA  GAI+LAR  
Sbjct: 77  AV----KSQMDLGTAYGVPSEKEITLAKEVINRIPCAEMVRFVNSGTEATMGAIRLARGV 132

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFND 172
            K++      +II    +FHG     +  TG      G    P       +    +PFND
Sbjct: 133 TKRN------KIIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTLLIPFND 186

Query: 173 LEALKNTIGPHT---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL 229
            EA++  I  +      ++LEPV G  G IP    YL+ ++++ EE G+LLIFDEV  G 
Sbjct: 187 EEAVRKVISENKEEIACIILEPVMGNVGCIPPKDGYLQFLREITEENGILLIFDEVITGF 246

Query: 230 GRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
            R  K    ++YG++ D+ T+ K LGGGFPIGA+  K++  + F P      A TF GNP
Sbjct: 247 -RLSKGGAQEYYGIKSDLATVGKILGGGFPIGAITGKKEYMEQFSPNGQIYQAGTFNGNP 305

Query: 287 LAATASLATMETLLQKGVLENAWQMG 312
           ++ TA + T++ L  K   E   + G
Sbjct: 306 ISVTAGIETLKNLDDKFYKETTKKAG 331


>GSA_SHEAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  157 bits (398), Expect = 1e-40
 Identities = 109/324 (33%), Positives = 157/324 (48%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P  + K  GA+++DADG+ Y+D+V       LGH HP + EAV K V   L   
Sbjct: 27  NGVGGTPRFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPSIREAVLKAVHNGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V +A+ ++E     D+    +SG EA   AI+LAR Y K+       +I+  
Sbjct: 87  AP--TELEVIMAEKVIEMVPSMDQVRMVSSGTEATMSAIRLARGYTKRD------KILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---T 184
              +HG     +   G    T  Q     +P+ FA       +NDLE++++    +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLESVQSFFDQYPEDI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP    +LEG++ LC++ G L I DEV  G  R  +     HYGV 
Sbjct: 199 ACIIIEPVAGNMNCIPPVPGFLEGLRALCDKYGALFIIDEVMTGF-RVSRSGAQGHYGVT 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   K+ V Q   P      A T  GNP+A TA LA ++ L  
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGKKDVMQYLAPAGPVYQAGTLSGNPIAMTAGLAQLDALCA 317

Query: 302 KGVLE----NAWQMGEYFKAELTK 321
            G+ E       ++ E FKA   K
Sbjct: 318 DGLYEELAAKTKRIAEGFKAAADK 341


>RHBA_RHIME RecName: Full=Diaminobutyrate--2-oxoglutarate
           aminotransferase;         EC=2.6.1.76;AltName:
           Full=L-2,4-diaminobutyrate:2-ketoglutarate
           4-aminotransferase;
          Length = 470

 Score =  157 bits (397), Expect = 1e-40
 Identities = 127/422 (30%), Positives = 185/422 (43%), Gaps = 57/422 (13%)

Query: 20  RLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYW 79
           R P+AL    G  V D DGR YLD ++G     LGH HPEV E + + + + L    +  
Sbjct: 48  RFPVALKSASGCIVTDVDGRSYLDCLAGAGTLALGHNHPEVIETLQQVLGSGLPLHTLDL 107

Query: 80  IEPQVK-------LAKLLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEI 131
             P VK          L        K  FC+ SG +A E AIKLA+          + ++
Sbjct: 108 TTP-VKDRFVSDIFGTLPAGLRDEAKIQFCSPSGTDAVEAAIKLAKT------ATGRTDL 160

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPF------------NDL------ 173
           ++   ++H               +  +  L  G  + P+            N+       
Sbjct: 161 VSFRGAYHXXXXXXXXXXXXXXPKASVGQLVPGAHFFPYPYAYRCPFGRGGNETATLAAE 220

Query: 174 ---EALKNTIGP--HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCG 228
               AL++  G      AV+LE VQGEGGVIPA   +L  V+++  + G+ LI DEVQ G
Sbjct: 221 YFERALRDPEGGINRPAAVILEAVQGEGGVIPAPVEWLRAVRRVTRDLGIPLIVDEVQSG 280

Query: 229 LGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLA 288
           +GRTG F  +Q  G+ PD++ L+KA+GGG P+  ++ +E +   ++PG HA TF GN LA
Sbjct: 281 VGRTGSFYAFQKAGIIPDVVVLSKAIGGGLPLAVVIYREDL-DLWKPGAHAGTFRGNQLA 339

Query: 289 ATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR--XXXXXXXXXXXXX 346
             A   T                G   +A L ++AA+ P + EVR               
Sbjct: 340 MAAGSKTXXXXXXXXXXXXXXXXGRRLRANLERIAAQTPYIGEVRGEGLMLGVEVVDPEG 399

Query: 347 XKDIVAH--------------CLEQGLLINCTN--GNVLRFLPPLIITKDEIDQAVQILK 390
             D + H                  G+++      G+VLR LPPL+I+  EIDQ    L 
Sbjct: 400 LPDALGHPPHGQEIARMIQHEMFRAGIILETGGRFGSVLRLLPPLVISDAEIDQVSGALA 459

Query: 391 RA 392
            A
Sbjct: 460 AA 461


>GSA_CHLCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  157 bits (396), Expect = 2e-40
 Identities = 112/322 (34%), Positives = 162/322 (50%), Gaps = 26/322 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG GA++ D DG  YLD+V       LG  HP +  A+   +K +   S   
Sbjct: 33  GGTPIYMAKGSGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAALEYTLKNI-GTSFGT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++++A+LL +     +     NSG EA   A++LAR Y     G DK  II     
Sbjct: 92  PIEMEIEIAELLCQIVPSLEMVRMVNSGTEATMSAVRLARGYT----GRDK--IIKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPH---TCAV 187
           +HG   + +   G      G    P       Q      +ND+E++K  +  +     A+
Sbjct: 146 YHGHGDSFLIKAGSGALTLGAPDSPGVTKGTAQDTLNATYNDIESVKLLVQENKGNVAAI 205

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GVIPA   +L  ++QLC+E+G++LIFDEV CG  R         YGV PD+
Sbjct: 206 IIEPVAGNTGVIPAQPGFLAALRQLCDEEGIVLIFDEVMCGF-RVALGGAQSLYGVTPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETLLQKG- 303
            T+ K +GGG P+GA   K ++ +   P GD   A T  GNPLA TA L T++ L+ +  
Sbjct: 265 TTMGKIIGGGLPVGAFGGKRKLMERVAPLGDVYQAGTLSGNPLALTAGLETLKILMDENP 324

Query: 304 ---VLENAWQMGEYFKAELTKL 322
              +   A  + E FKA L KL
Sbjct: 325 YPELERKAVILEEGFKANLAKL 346


>GSA_SHEON RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  156 bits (395), Expect = 3e-40
 Identities = 106/323 (32%), Positives = 159/323 (49%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++ EAV   V   L   
Sbjct: 27  NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHNGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVIAMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL+++++    +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRSLFEQYPTEIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +LEG++ LC+E G LLI DEV  G  R  K     HYGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLEGLRSLCDEFGALLIIDEVMTGF-RVSKSGAQGHYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEALSAKTKRIAEGFKAAADK 341


>GSA_SHESH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  155 bits (393), Expect = 4e-40
 Identities = 106/324 (32%), Positives = 160/324 (49%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P  + K  GA+++DADG+ Y+D+V       LGH HP++ EAV   V+  L   
Sbjct: 27  NGVGGSPRFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V +A+ ++E     ++    +SG EA   AI+LAR +  +       +I+  
Sbjct: 87  AP--TELEVTMAEKVIEMVPSMEQVRMVSSGTEATMSAIRLARGFTSRD------KILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---T 184
              +HG     +   G    T  Q     +P+ FA       +NDLE++K     +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNDLESVKALFEQYPEEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             ++LEPV G    IP  + +L+G++ +C++ G L+I DEV  G  R  K     HYGV 
Sbjct: 199 SCIILEPVAGNMNCIPPVEGFLQGLRAICDQYGALMIIDEVMTGF-RVSKSGAQGHYGVT 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA M+ L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMDALCE 317

Query: 302 KGVLE----NAWQMGEYFKAELTK 321
           +GV E       ++ E FKA   K
Sbjct: 318 EGVYEELAAKTKRIAEGFKAAANK 341


>GSA_SHEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  155 bits (393), Expect = 4e-40
 Identities = 107/324 (33%), Positives = 160/324 (49%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P  + K  GA+++DADG++Y+D+V       LGH HP++  AV + V+  L   
Sbjct: 27  NGVGGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIRAAVLEAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V +A+ ++E     ++    +SG EA   AI+LAR +  +       +I+  
Sbjct: 87  AP--TELEVTMAEKVIEMVPSMEQVRMVSSGTEATMSAIRLARGFTSRD------KILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPHTCA- 186
              +HG     +   G    T  Q     +P+ FA       +NDL+++K     +  A 
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNDLDSVKALFEQYPDAI 198

Query: 187 --VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             ++LEPV G    IP  + +LEG++ +C++ G L+I DEV  G  R  K     HYGV 
Sbjct: 199 SCIILEPVAGNMNCIPPVEGFLEGLRAICDQYGALMIIDEVMTGF-RVSKSGAQGHYGVT 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCE 317

Query: 302 KGVLENAWQMGEY----FKAELTK 321
            GV E      +Y    FKA   K
Sbjct: 318 DGVYEQLAAKTQYIAEGFKAAANK 341


>GSA_NATTJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  155 bits (393), Expect = 4e-40
 Identities = 100/316 (31%), Positives = 158/316 (50%), Gaps = 23/316 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ +  G G+ V+D D  +Y+D+V+      LGH HP++ +A+ +Q+       +   +E
Sbjct: 35  PLFIKDGSGSKVYDVDDNEYIDYVASYGPLILGHCHPQIRDALKEQIDYGTGYGSPTELE 94

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +  +A+L++E     +     NSG EA   A++LAR Y        K +I+  T  +HG
Sbjct: 95  NE--MAELVIEAVPSIEMVRMVNSGTEATMSALRLARGYT------GKNKIVKLTGCYHG 146

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAVMLE 190
            + + +   G      GL   P       +    VP+N+LE ++   N  G     V+LE
Sbjct: 147 HSDSLLIKAGSGVTTLGLPDSPGVPASIAENTITVPYNNLEVMEQVFNKYGDDIAGVILE 206

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  GV+P  + YLEG+++L  + G LLIFDEV  G  R        +YGV PD+  L
Sbjct: 207 PVAGNMGVVPPNEGYLEGLRELTSKYGSLLIFDEVMTGF-RVSYGGAQAYYGVTPDLTCL 265

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA   KE++ +   P      A T  GNP+A  A + T++ L Q+G  + 
Sbjct: 266 GKVIGGGLPVGAYGGKEEIMEYIAPAGSIYQAGTLSGNPIAMRAGIETLKVLRQEGSYDQ 325

Query: 308 AWQMGEYFKAELTKLA 323
                ++    L K+A
Sbjct: 326 LESKSKHLAEGLAKVA 341


>GSA2_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  155 bits (393), Expect = 4e-40
 Identities = 103/295 (34%), Positives = 151/295 (51%), Gaps = 23/295 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +GQGA ++D DG +Y+D+V       LGHA P+V EA+ +  +         
Sbjct: 33  GMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILGHADPQVVEALKRVAEQGTSFGAPT 92

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E +  LAKL++E     +     NSG EA   A++LAR Y K++      +II    S
Sbjct: 93  LLENE--LAKLVIERVPSVEIVRMVNSGTEATMSALRLARGYTKRN------KIIKFEGS 144

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAV 187
           +HG   + +   G      GL     +PQ  A     VP+NDL++++      G    AV
Sbjct: 145 YHGHGDSLLIKAGSGVATLGLPDSPGVPQSVAQHTITVPYNDLDSVRYAFERFGEDIAAV 204

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GV+P    +LEG++ + ++ G LLIFDEV  G  R        +YGVEPD+
Sbjct: 205 IVEPVAGNMGVVPPVPGFLEGLRDVTKQYGALLIFDEVMTGF-RVDYHCAQGYYGVEPDL 263

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
             L K +GGG P+GA   K ++ +   P      A T  GNPLA TA   T+  L
Sbjct: 264 TCLGKVIGGGLPVGAYGGKAEIMEQVAPSGPVYQAGTLSGNPLAMTAGYETLRQL 318


>GSA_SHEWM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  155 bits (392), Expect = 6e-40
 Identities = 105/324 (32%), Positives = 162/324 (50%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P  + K  GA+++DADG+ Y+D+V       LGH HP++ +AV + V+  L   
Sbjct: 27  NGVGGSPRFIDKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRQAVLEAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +VK+A+ ++E     ++    +SG EA   AI+LAR +       ++ +I+  
Sbjct: 87  AP--TELEVKMAEKVIEMVPSMEQVRMVSSGTEATMSAIRLARGFT------NRDKILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---T 184
              +HG     +   G    T  Q     +P+ FA       +N+LE++K     +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNELESVKTLFEQYPEEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             ++LEPV G    IP  + +LEG++ +C++ G LLI DEV  G  R  K     HYG+ 
Sbjct: 199 SCIILEPVAGNMNCIPPVEGFLEGLRAICDQYGALLIIDEVMTGF-RVSKSGAQGHYGIT 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L  
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEELCA 317

Query: 302 KGVLE----NAWQMGEYFKAELTK 321
           +G+ +       ++ E FKA   K
Sbjct: 318 EGLYQELAAKTKRIAEGFKAAANK 341


>GSA2_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  155 bits (392), Expect = 6e-40
 Identities = 100/295 (33%), Positives = 151/295 (51%), Gaps = 23/295 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +GQGA ++D DG +Y+D+V       LGHA+P+V EA+ +  +         
Sbjct: 33  GMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILGHANPQVVEALKRVAEQGTSFGAPT 92

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E +  LAKL++E     +     NSG EA   A++LAR Y K++      +I+    S
Sbjct: 93  LLENE--LAKLVIERVPSVEIVRMVNSGTEATMSALRLARGYTKRN------KIMKFEGS 144

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAV 187
           +HG   + +   G      GL   P       Q    VP+NDL++++      G    AV
Sbjct: 145 YHGHGDSLLIKAGSGVATLGLPDSPGVPESVAQHTITVPYNDLDSVRYAFERFGEDIAAV 204

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GV+P    +LEG++++ ++ G LLIFDEV  G  R        +YG+EPD+
Sbjct: 205 IVEPVAGNMGVVPPVPGFLEGLREVTKQYGALLIFDEVMTGF-RVDYHCAQGYYGIEPDL 263

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
             L K +GGG P+GA   K ++ +   P      A T  GNPLA TA   T+  L
Sbjct: 264 TCLGKVIGGGLPVGAYGGKAEIMELVAPSGPVYQAGTLSGNPLAMTAGYETLRQL 318


>GSA_SHESA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  155 bits (391), Expect = 7e-40
 Identities = 104/323 (32%), Positives = 160/323 (49%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++ EAV   V   L   
Sbjct: 27  NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHNGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVIAMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL+++++    +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRSLFEQYPTEIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +LEG++ +C+E G LLI DEV  G  R  +     HYGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLEGLRAMCDEFGALLIIDEVMTGF-RVSRSGAQGHYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   +++V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKEVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEALSAKTKRIAEGFKAAADK 341


>GSA_SHEPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  155 bits (391), Expect = 7e-40
 Identities = 104/321 (32%), Positives = 160/321 (49%), Gaps = 27/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + K  GA+++DADG++Y+D+V       LGH HP++ EAV K V+  L      
Sbjct: 30  GGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIREAVLKAVENGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ +A+ ++E     ++    +SG EA   AI+LAR +       ++ +I+     
Sbjct: 89  -TELEITMAEKVIEMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P+ FA       +NDL+++K     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNDLDSVKAIFEQYPEEISCI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L+G++ +C++ G L+I DEV  G  R  K     HYGV PD+
Sbjct: 202 IIEPVAGNMNCIPPIDGFLQGLRAICDQYGALMIIDEVMTGF-RVSKSGAQGHYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++GV
Sbjct: 261 TTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEEGV 320

Query: 305 LENAWQMGEY----FKAELTK 321
            E      +Y    FKA   K
Sbjct: 321 YEQLAAKTQYIAEGFKAAANK 341


>GSA_SHELP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  155 bits (391), Expect = 7e-40
 Identities = 106/324 (32%), Positives = 161/324 (49%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P  + K  GA+++DADG+ Y+D+V       LGH HP++ +AV   V+  L   
Sbjct: 27  NGVGGSPRFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRQAVLDAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V++A+ ++E     ++    +SG EA   AI+LAR +       ++ +I+  
Sbjct: 87  AP--TELEVRMAEKVIEMVPSMEQVRMVSSGTEATMSAIRLARGFT------NRDKILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---T 184
              +HG     +   G    T  Q     +P+ FA       +N+LE++K     +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNELESVKTLFEQYPEEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             ++LEPV G    IP    +LEG++ LC++ G LLI DEV  G  R  K     HYG+ 
Sbjct: 199 ACIILEPVAGNMNCIPPIPGFLEGLRALCDQYGALLIIDEVMTGF-RVSKSGAQGHYGIT 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   +++V Q   P      A T  GNP+A +A LA ME L  
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKEVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEELCA 317

Query: 302 KGVLE----NAWQMGEYFKAELTK 321
           +G+ E       ++ E FKA   K
Sbjct: 318 EGLYEELAAKTKRIAEGFKAAANK 341


>GSA_GEOSF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  155 bits (391), Expect = 7e-40
 Identities = 103/310 (33%), Positives = 156/310 (50%), Gaps = 23/310 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           GR P+ + K  G  + D DG Q++DFV       LGH HP+VA AV   V +   CS   
Sbjct: 32  GRDPLFIKKASGCKIEDVDGNQFIDFVGSWGPMILGHCHPQVASAVKAAVDS--GCSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA++++      +     +SG EA   AI+LAR Y     G DK  I+  +  
Sbjct: 90  PTELEITLAEMVINAVPSIEMVRMVSSGTEATMSAIRLARGYT----GRDK--ILKFSGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNTIGPH---TCAV 187
           +HG + + +   G      G+     +PQ FA       +N LE+++  I  +      +
Sbjct: 144 YHGHSDSLLVKAGSGAATFGVPDSPGVPQDFARHTLTADYNSLESVRTLIAENKGQVACI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G +P  + +LEG++ LC ++G++LIFDEV  G  R       + YGV PD+
Sbjct: 204 IVEPVAGNMGTVPPREGFLEGLRTLCTQEGIVLIFDEVMSGF-RVAYGGAQEVYGVTPDM 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++     P      A T  GNPLA TA + T++ L  +G 
Sbjct: 263 TTLGKIIGGGLPVGAFGGKKEIMTLLSPSGGVYQAGTLSGNPLAMTAGIETLKLLQAEGF 322

Query: 305 LENAWQMGEY 314
             N  +   Y
Sbjct: 323 YRNLEEKSSY 332


>GSA_GEOUR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  154 bits (390), Expect = 1e-39
 Identities = 101/321 (31%), Positives = 162/321 (50%), Gaps = 23/321 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  G+ ++D DG +++D+V       LGH HP+V  AV   V     CS   
Sbjct: 32  GTDPLFIEKASGSRIYDVDGNEFIDYVGSWGPMILGHCHPQVVAAVKSAVDN--GCSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA++++E     +     +SG EA   AI+LAR Y     G DK  I+  +  
Sbjct: 90  PTELEITLAEMVIEAVPSIEMVRMVSSGTEATMSAIRLARGYT----GRDK--ILKFSGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNTIGPHT---CAV 187
           +HG + + +   G      G+     +PQ FA       +NDLE++   +  +      +
Sbjct: 144 YHGHSDSLLVKAGSGAATFGVPDSPGVPQDFAKHTLTATYNDLESVNKLVAENKNQISCI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G +P  + +LEG++ LC E+G++LIFDEV  G  R       + Y V PD+
Sbjct: 204 IVEPVAGNMGTVPPREGFLEGLRSLCTEEGIVLIFDEVMSGF-RVAYGGAQELYNVTPDM 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++     P      A T  GNPLA TA + T++ L  +G 
Sbjct: 263 TTLGKIIGGGLPVGAFGGKKEIMSLLSPSGGVYQAGTLSGNPLAMTAGIETLKLLQTEGF 322

Query: 305 LENAWQMGEYFKAELTKLAAE 325
            ++  +  +Y  + + K A +
Sbjct: 323 YQDLDRKSDYVASGIAKAAKD 343


>GSA_SHESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  154 bits (389), Expect = 1e-39
 Identities = 104/323 (32%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++ EAV   V   L   
Sbjct: 27  NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHNGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVIAMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPIEIA 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +LEG++ +C+E G LLI DEV  G  R  +     HYGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLEGLRTMCDEFGALLIIDEVMTGF-RVSRSGAQGHYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEALSAKTKRIAEGFKAAADK 341


>GSA_CHLPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  154 bits (389), Expect = 1e-39
 Identities = 104/295 (35%), Positives = 153/295 (51%), Gaps = 22/295 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KGQGA++ D DG  YLD+V       LG  HP +  A+ +   T +  S   
Sbjct: 33  GGTPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAI-ENTLTKIGTSFGT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++++A+LL +     +     NSG EA   A++LAR Y     G DK  II     
Sbjct: 92  PIEMEIEIAELLTQIVPSIEMVRMVNSGTEATMSAVRLARGYT----GRDK--IIKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALKNTIGPHT---CAV 187
           +HG   + +   G      G    P   +G A       +ND+E+++  +  +     A+
Sbjct: 146 YHGHGDSFLIKAGSGALTLGAPDSPGVTKGTANDTLNAKYNDIESVRVLVKENKDSIAAI 205

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GVIPA   +L+ ++ LC E+G++LIFDEV CG  R       + YG+ PD+
Sbjct: 206 IIEPVAGNTGVIPAKTDFLQALRDLCTEEGIVLIFDEVMCGF-RVALGGAQERYGITPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETL 299
            T+ K +GGG P+GA   K ++ Q   P GD   A T  GNPLA TA L T++ L
Sbjct: 265 TTMGKIIGGGLPVGAFGGKREIMQRVAPIGDVYQAGTLSGNPLALTAGLETLKIL 319


>GSA_SHESR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  153 bits (387), Expect = 2e-39
 Identities = 103/323 (31%), Positives = 159/323 (49%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++ EAV   V   L   
Sbjct: 27  NGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILGHNHPKIREAVLAAVHNGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVIAMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTEIA 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G LLI DEV  G  R  +     HYGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLKGLRTMCDEFGALLIIDEVMTGF-RVSRSGAQGHYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   +++V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKEVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEALSAKTKRIAEGFKAAADK 341


>GSA_PROA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  153 bits (386), Expect = 3e-39
 Identities = 101/295 (34%), Positives = 152/295 (51%), Gaps = 22/295 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KGQGA++ D DG  YLD+V       LG  HP +  A+ +   T +  S   
Sbjct: 33  GGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAL-EHTLTKIGTSFGT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++++A+LL +     +     NSG EA   A++LAR Y  +       +II     
Sbjct: 92  PIEMEIEIAELLCQIVPSIEMVRMVNSGTEATMSAVRLARGYTSRD------KIIKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALKNTIGPHT---CAV 187
           +HG   + +   G      G    P   +G A       +ND+E+++  +  +     A+
Sbjct: 146 YHGHGDSFLIKAGSGALTLGAPDSPGVTKGTANDTLNAKYNDIESVRLLVNENKGNIAAI 205

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GVIPA   +L+ ++ LC E+G++LIFDEV CG  R       + YGV PD+
Sbjct: 206 IIEPVAGNTGVIPAKPGFLQALRDLCTEEGIVLIFDEVMCGF-RVALGGAQERYGVTPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETL 299
            T+ K +GGG P+GA   K ++ +   P GD   A T  GNPLA TA L T++ L
Sbjct: 265 TTMGKIIGGGLPVGAFGGKREIMERIAPLGDVYQAGTLSGNPLALTAGLETLKIL 319


>ECTB_VIBCH RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 411

 Score =  153 bits (386), Expect = 3e-39
 Identities = 116/418 (27%), Positives = 198/418 (47%), Gaps = 37/418 (8%)

Query: 5   EILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV 64
           +I    +  V +     P+     +G+W++   G  YLDF+SG      GH +  + +A+
Sbjct: 2   DIFKHHESQVQSYANHFPVLFGTAKGSWLYSQQGDAYLDFLSGAGALNYGHNNAVLKQAL 61

Query: 65  CKQVKT--LLHCSNIYWIEPQVKLAKLLVENSCADKA------FFCNSGAEANEGAIKLA 116
            + ++   L H  +++  E +    + L  +    +       F   +G  A E A+KLA
Sbjct: 62  LEYIERDGLTHGLDMH-SEAKAHFIQALQTHILEPRGLNYKLQFTGPTGTNAVEAALKLA 120

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEAL 176
           RK   +H       ++T TN FHG +L  + ATG   +++G      G   VP++    +
Sbjct: 121 RKVTGRH------NVVTFTNGFHGCSLGALAATGNQHHRQGAGLALSGVYRVPYDGYAGV 174

Query: 177 K-----------NTIG-PHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDE 224
                       N+ G     AV+LE VQGEGG+  A+ A+L+ V+ +C  + +LLI D+
Sbjct: 175 DGLTLFETMLQDNSSGLDKPAAVLLETVQGEGGLNVASDAWLQRVQAICRAQQILLIVDD 234

Query: 225 VQCGLGRTGKFLGYQHYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFG 283
           +Q G GRTG F  ++  G+EPD++TL+K+L G G P+  +L K +  Q ++PG+H  TF 
Sbjct: 235 IQAGCGRTGTFFSFEPSGIEPDMVTLSKSLSGYGLPMALVLFKPEWDQ-WKPGEHNGTFR 293

Query: 284 GNPLAATASLATMETL-----LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXX 338
           GN  A   +   +E        Q  +   + Q+ +     L++       +K  R     
Sbjct: 294 GNNHAFVTATRALEAYWANQDFQTHIAARSEQVTQALLQCLSRYPTLFSGLKG-RGLMQG 352

Query: 339 XXXXXXXXXKDIVAHCLEQGLLINCTNG--NVLRFLPPLIITKDEIDQAVQILKRAML 394
                    +DI A C ++GL+I        VL+   PL IT+ ++   + I++R +L
Sbjct: 353 LACHNGDIARDIAALCFQKGLIIETAGAEDEVLKVFCPLTITEADLAHGLTIIERVLL 410


>DGDA_BURCE RecName: Full=2,2-dialkylglycine decarboxylase;       
           Short=DGD;         EC=4.1.1.64;
          Length = 433

 Score =  153 bits (386), Expect = 3e-39
 Identities = 120/411 (29%), Positives = 185/411 (45%), Gaps = 46/411 (11%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           PM + + +G++V+DADGR  LDF SG     LGH HPE+   + +    L H  +     
Sbjct: 26  PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGMLSR 85

Query: 82  PQVKLAKLL--VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P V LA  L  +     D+A   ++GAE+NE AI++A+      L   KYEI+    S+H
Sbjct: 86  PVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAK------LVTGKYEIVGFAQSWH 139

Query: 140 GRTLATVTATGQTKYQRGLDP-------LPQGFAYVPFND--------------LEALKN 178
           G              ++G+ P       +P  F Y P  +               + +  
Sbjct: 140 GMXXXXXXXXXXXX-RKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFDLIDR 198

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
               +  A + EP+   GG+I     Y+  +K+ CE +G+LLI DE Q G+GRTG     
Sbjct: 199 QSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC 258

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAATASLATM 296
           Q  GV PDI+TL+K LG G P+ A++    + +      +   +T   +PL A   L  +
Sbjct: 259 QRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL 318

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK-------- 348
           + + + G++  A  M                 + +                +        
Sbjct: 319 DVVQRDGLVARANVMXXXXXXXXXXXMERFDCIGDXXXXXXXXXXEIVKDRRTKEPADGL 378

Query: 349 --DIVAHCLEQGLLINCTN----GNVLRFLPPLIITKDEIDQAVQILKRAM 393
              I   C+  GL +N       G V R  PPL +++DEID  + +L +A+
Sbjct: 379 GAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI 429


>GSA_SHEHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  152 bits (385), Expect = 4e-39
 Identities = 103/321 (32%), Positives = 159/321 (49%), Gaps = 27/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + K  GA+++DADG++Y+D+V       LGH HP++ EAV   V+  L      
Sbjct: 30  GGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIREAVLAAVENGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ +A+ ++E     ++    +SG EA   AI+LAR +       ++ +I+     
Sbjct: 89  -TELEITMAEKVIEMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P+ FA       +NDL+++K     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNDLDSVKAIFEQYPEEISCI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L+G++ +C++ G L+I DEV  G  R  K     HYGV PD+
Sbjct: 202 IIEPVAGNMNCIPPIDGFLQGLRAICDQYGALMIIDEVMTGF-RVSKSGAQGHYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++GV
Sbjct: 261 TTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEEGV 320

Query: 305 LENAWQMGEY----FKAELTK 321
            E      +Y    FKA   K
Sbjct: 321 YEQLAAKTQYIAEGFKAAANK 341


>GSA_METM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  152 bits (385), Expect = 4e-39
 Identities = 99/316 (31%), Positives = 159/316 (50%), Gaps = 27/316 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++ L  G    + ++   P  +   +  +++D DG +++D+        LGHA+  +  
Sbjct: 17  SRKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILN 76

Query: 63  AVCKQVKTLLHCSNIYWI--EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKY 119
           AV    K+ +     Y +  E ++ LAK ++    CA+   F NSG EA  GAI+LAR  
Sbjct: 77  AV----KSQMDLGTAYGVPSEKEIILAKEVINRIPCAEMVRFVNSGTEATMGAIRLARGV 132

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFND 172
            K++      +II    +FHG     +  TG      G    P       +    +PFND
Sbjct: 133 TKRN------KIIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTLLIPFND 186

Query: 173 LEALKNTIGPHT---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL 229
            +A+K  I  +      ++LEPV G  G I     YL+ ++++ EE G++LIFDEV  G 
Sbjct: 187 EDAVKKVISENKDEIACIILEPVMGNVGCILPKDGYLQFLREITEENGIILIFDEVITGF 246

Query: 230 GRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
            R  K    ++YG++ D+ T+ K LGGGFPIGA+  K++  + F P      A TF GNP
Sbjct: 247 -RLSKGGAQEYYGIKSDLATVGKILGGGFPIGAITGKKEYMEQFSPNGQIYQAGTFNGNP 305

Query: 287 LAATASLATMETLLQK 302
           ++ TA + T++ L  K
Sbjct: 306 VSVTAGIETLKNLDDK 321


>GSA_META3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  152 bits (385), Expect = 4e-39
 Identities = 101/314 (32%), Positives = 160/314 (50%), Gaps = 29/314 (9%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +Q+ L  G    +  +   P  +   +  ++ D DG +Y+D+        LGHA+  +A 
Sbjct: 20  SQKYLVKGVNSPVRYFKPFPFFVNNAKDYYLVDVDGNKYIDYCLAYGPAVLGHANENIAN 79

Query: 63  AVCKQVK--TLLHCSNIYWIEPQVKLAKLLVENS-CADKAFFCNSGAEANEGAIKLARKY 119
           AV +Q+K  T   C      E ++ LAK +++   CA+   F NSG EA   AI+LAR  
Sbjct: 80  AVIEQLKHGTAYGCPT----EKEITLAKEIIKRMPCAEMVRFVNSGTEATMSAIRLARGI 135

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFND 172
            K++      +II    ++HG     +  +G      G    P       +     PFND
Sbjct: 136 TKRN------KIIKFDGAYHGAHDYVLVKSGSGALTHGAPNSPGIPEDTTKHTILAPFND 189

Query: 173 ----LEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCG 228
               +E +KN      C +++EPV G  G IP  + YL+ ++++ EE  ++LIFDEV  G
Sbjct: 190 KDAIVEIIKNNKDEIAC-IIVEPVMGNVGCIPPREDYLKFLREITEENNIILIFDEVITG 248

Query: 229 LGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGN 285
             R  K    ++YGV PD+ T+ K +GGGFPIGA++ K+++ + F P      A TF GN
Sbjct: 249 F-RIAKGGAQEYYGVVPDLATVGKIMGGGFPIGAIVGKKELMENFSPNGTIYQAGTFNGN 307

Query: 286 PLAATASLATMETL 299
           P++ TA + T++ L
Sbjct: 308 PISMTAGIETLKNL 321


>BIOA_HAEIN RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
           aminotransferase;         EC=2.6.1.62;AltName:
           Full=7,8-diamino-pelargonic acid aminotransferase;
          Length = 430

 Score =  152 bits (385), Expect = 4e-39
 Identities = 123/419 (29%), Positives = 203/419 (48%), Gaps = 34/419 (8%)

Query: 1   MNNQEILAMGQQYVMNTYGR----LPM-ALVKGQGAWVWDADGRQYLDFVSGIAVNCLGH 55
           ++ Q +LA   Q++ + Y      +P+ A+ +  G  +   DGR+ +D +S       G+
Sbjct: 2   VDEQSLLAFDTQHIWHPYSSVSSDMPLYAVERADGVMITLKDGRRLIDGMSSWWAALHGY 61

Query: 56  AHPEVAEAVCKQVKTLLHCS-NIYWIEPQVKLAKLLVE--NSCADKAFFCNSGAEANEGA 112
            HP +  A   Q+  + H     +  +P V+LA+LLV+   +  DK FF +SG+ A E A
Sbjct: 62  NHPRLNAAAQNQLAKMSHIMFGGFTHDPAVELAQLLVQILPNGLDKIFFADSGSVAVEVA 121

Query: 113 IKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGL--DPLPQGFAY--- 167
           +K+A +Y        + +  T  + +HG T   ++    T     L    LP  +     
Sbjct: 122 MKMAIQYQHAKGEVQRQKFATIRSGYHGDTWNAMSVCDPTTGMHHLFHHSLPVQYFLPQP 181

Query: 168 -VPFND------LEALKNTI---GPHTCAVMLEPV-QGEGGVIPAAQAYLEGVKQLCEEK 216
            +PFN+      +E L + +   G    A++LEPV QG GG+   +  YL   + LC++ 
Sbjct: 182 NIPFNESWNDCAIEPLADLLKKKGNEIAALILEPVVQGAGGMYFYSPTYLVKAQALCKQY 241

Query: 217 GLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQP 275
           G+LLIFDE+  G GRTGK    +H G+ PDI+ + KAL GG+  + A +   ++AQ    
Sbjct: 242 GILLIFDEIATGFGRTGKLFAAEHAGISPDIMCIGKALTGGYLTLSASITTTEIAQTICS 301

Query: 276 GD-----HASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVK 330
           G+     H  TF  NPLA   +  ++  LL+    +N  ++    K +L+ L +E   VK
Sbjct: 302 GEAKCFMHGPTFMANPLACAIAAESIRLLLESPWQQNIQRIESSLKQQLSPL-SEKDYVK 360

Query: 331 EVR--XXXXXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQ 387
           EVR                K +V   +EQG+ I    G ++  +PP +I  DE+ +  +
Sbjct: 361 EVRALGAIGVVEMKSAVNMKTLVPRFVEQGVWIR-PFGKLVYVMPPFVIKDDELQKLTE 418


>GSA_THERP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  152 bits (384), Expect = 5e-39
 Identities = 104/330 (31%), Positives = 165/330 (50%), Gaps = 25/330 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+  V+G+GA++ DADGR++LD++        GHAHP V + + + ++     ++  
Sbjct: 32  GEEPVVAVRGEGAYLIDADGRRFLDYICSWGALLAGHAHPHVVDRLSEAIQ---RGTSFG 88

Query: 79  WIEP-QVKLAKLLVENSCA-DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
            + P +V+LA+ +V +  A +   F NSG EA   AI+LAR    ++L      ++    
Sbjct: 89  LLSPYEVELARAIVASVPAIELVRFVNSGTEATMSAIRLARAVTGRNL------VVKFAG 142

Query: 137 SFHGRTLATVTATGQTKYQRGLDPLP---QGFA----YVPFNDLEALKNTIGPH---TCA 186
            +HG     + A G      GL   P   +G A     +P+ND EA+++    H     A
Sbjct: 143 CYHGHVDGLLVAAGSGVLTFGLPGTPGVTEGTARDTLVLPYNDQEAVEDAFAQHGERIAA 202

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EPV G  GV+P A  +L  +++L  + G LLIFDEV  G  R G     + +G+ PD
Sbjct: 203 VIVEPVAGNMGVVPPAAGFLSRLRELTRQAGALLIFDEVITGF-RLGLGGAQERFGILPD 261

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           +  L K +GGG P+GA   +  + +   P      A T  GNPL+  A LAT+E   + G
Sbjct: 262 LTCLGKVIGGGLPVGAYGGRRDLMEQVAPNGPVYQAGTLAGNPLSMVAGLATLELAREPG 321

Query: 304 VLENAWQMGEYFKAELTKLAAEVPLVKEVR 333
           V      +  + +  L +   E  L   V+
Sbjct: 322 VYGRLETLAAWLQRGLEETIQESGLPAHVQ 351


>GSA_SHEDO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  152 bits (384), Expect = 5e-39
 Identities = 103/303 (33%), Positives = 152/303 (50%), Gaps = 23/303 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG +Y+D+V       LGH HP++ +AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKADGAYIFDADGNKYIDYVGSWGPMILGHNHPKIRQAVLDAVENGLSFG 86

Query: 76  NIYWIEPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +VK+A K++      ++    +SG EA   AI+LAR Y       ++ +I+  
Sbjct: 87  AP--TELEVKMAEKVIAMVPSIEQVRMVSSGTEATMSAIRLARGYT------NRDKILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPHTCA- 186
              +HG     +   G    T  Q     +P+ FA       +NDL ++++    H  A 
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNDLASVRSLFELHPDAI 198

Query: 187 --VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             ++LEPV G    IP    +L+G++ LC+E G LLI DEV  G  R        HYGV 
Sbjct: 199 SCIILEPVAGNMNCIPPIPGFLQGLRGLCDEFGALLIIDEVMTGF-RVAMGGAQAHYGVV 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   K+ + Q   P      A T  GNP+A +A LA ME L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGKKAIMQYIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCE 317

Query: 302 KGV 304
            G+
Sbjct: 318 PGL 320


>GSA_THISH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  152 bits (383), Expect = 6e-39
 Identities = 100/296 (33%), Positives = 151/296 (51%), Gaps = 23/296 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + + +GA+++DADG++Y+D+V        GHAHPEV EAV +  +  L       IE
Sbjct: 33  PVFIQRAEGAYMYDADGKRYIDYVGSWGPMIAGHAHPEVVEAVREAARGGLSFGAPTEIE 92

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
             +++A+ + E     D     +SG EA   AI+LAR +     G DK  II     +HG
Sbjct: 93  --IRMAERVCELVPSMDMVRMVSSGTEATMSAIRLARGFT----GRDK--IIKFEGCYHG 144

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNT---IGPHTCAVMLE 190
              + +   G      G+   P       +    + +NDL+ ++ T   +G     +++E
Sbjct: 145 HGDSLLVKAGSGALTLGVPSSPGVPAALAEHTLTLTYNDLDEVRETLAHVGGQVACIIVE 204

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G    IP    +LEG+++LC+E G LLIFDEV  G  R        HYGV+PD+ TL
Sbjct: 205 PVAGNMNCIPPVPGFLEGLRELCDEYGALLIFDEVMTGF-RVALGGAQAHYGVKPDLTTL 263

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            K +GGG P+GA   + +V +   P      A T  GNP+A  A L T+E + + G
Sbjct: 264 GKIIGGGMPVGAFGGRREVMEQLAPLGPVYQAGTLSGNPVAMAAGLKTLEIISRPG 319


>GSA_METM6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  152 bits (383), Expect = 6e-39
 Identities = 101/316 (31%), Positives = 158/316 (50%), Gaps = 27/316 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++ L  G    + ++   P  +   +  +++D DG +++D+        LGHA+  +  
Sbjct: 17  SKKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILN 76

Query: 63  AVCKQVKTLLHCSNIYWI--EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKY 119
           AV    K+ +     Y +  E ++ LAK ++    CA+   F NSG EA  GAI+LAR  
Sbjct: 77  AV----KSQMDLGTAYGVPSEKEILLAKEVINRIPCAEMVRFVNSGTEATMGAIRLARGV 132

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFND 172
                G DK  II    +FHG     +  TG      G    P       +    +PFND
Sbjct: 133 T----GKDK--IIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTLLIPFND 186

Query: 173 LEALKNTIGPHT---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL 229
            +A++  I  +      ++LEPV G  G I     YL+ ++++ EE G+LLIFDEV  G 
Sbjct: 187 EDAVRKVISENKNEIACIILEPVMGNVGCILPQDGYLQFLREITEENGILLIFDEVITGF 246

Query: 230 GRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
            R  K    ++YG++ D+ T+ K LGGGFPIGA+  K++  + F P      A TF GNP
Sbjct: 247 -RLSKGGAQEYYGIKSDLATVGKILGGGFPIGAITGKKEYMEQFSPNGQIYQAGTFNGNP 305

Query: 287 LAATASLATMETLLQK 302
           ++ TA + T++ L  K
Sbjct: 306 VSVTAGIETLKNLEDK 321


>AT2L1_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase
           2-like 1;         EC=2.6.1.-;
          Length = 499

 Score =  152 bits (383), Expect = 6e-39
 Identities = 115/445 (25%), Positives = 221/445 (49%), Gaps = 63/445 (14%)

Query: 2   NNQEILAMGQQYVMNT----YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAH 57
           + Q+ LA+ ++++  +    +   P+ +++ QG +++D  G +YLD ++ +A   +GH H
Sbjct: 6   SKQDTLALRERHIGPSCKIFFAADPIKIMRAQGQYMFDEKGERYLDCINNVAH--VGHCH 63

Query: 58  PEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKA--FFCNSGAEANEGAIKL 115
           PEV +A  KQ++ LL+ ++ +  +  ++ AK L      + +  +F NSG+EAN+ A++L
Sbjct: 64  PEVVKAAAKQME-LLNTNSRFLHDNIIEFAKRLTATLPQELSVCYFTNSGSEANDLALRL 122

Query: 116 ARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL-- 173
           AR++          ++IT  +++HG  L+++      K+Q+G D   +     P  D   
Sbjct: 123 ARQFRGHQ------DVITLDHAYHGH-LSSLIEISPYKFQKGKDVKRETVHVAPAPDTYR 175

Query: 174 ---------------EALKNTI------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQL 212
                          + +K  I      G    A + E +Q  GG I     Y + V + 
Sbjct: 176 GKYREDHEDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEH 235

Query: 213 CEEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQV 269
             + G + I DEVQ G GR G+ F  +Q YG +  PDI+T+ K +G G PI  ++  +++
Sbjct: 236 IHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMGNGHPISCVVTTKEI 295

Query: 270 AQAFQPG--DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVP 327
           A+AF     ++ +T+GGNP++    LA ++ + ++ +  NA ++G Y    L++  A+ P
Sbjct: 296 AEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVGTYLMELLSEQKAKHP 355

Query: 328 LVKEVR----------XXXXXXXXXXXXXXKDIVAHCLEQGLLINC--TNGNVLRFLPPL 375
           L+ ++R                        + I+     +G+L++    + NVL+  PP+
Sbjct: 356 LIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLLSADGPHRNVLKIKPPM 415

Query: 376 IITKDE-------IDQAVQILKRAM 393
             T+D+       +D  + +L+ AM
Sbjct: 416 CFTEDDAKFLVDHLDGILTVLEEAM 440


>ECTB_WOLSU RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 427

 Score =  151 bits (382), Expect = 8e-39
 Identities = 112/399 (28%), Positives = 196/399 (49%), Gaps = 35/399 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P+   + +GA+++D  G+ Y+DF +G      GH HP++ EA+   ++   +LH  +   
Sbjct: 19  PVIFERSKGAYLYDEQGKAYIDFFAGAGTLNYGHNHPKIIEAMIAYLQNDGILHGLDKAT 78

Query: 80  IEPQV---KLAKLLVENSCADKA--FFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
              +     L++ ++E    D    F   +G  A E A+KLAR      +   +  +I  
Sbjct: 79  SAKKAFLQTLSETILEPRHMDYKVQFTGPTGTNAIESALKLAR------MVKGRSNVIAF 132

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL--EALKNTIGPHT-------- 184
           TN+FHG T+ ++  TG   Y+          +++PF+    E +  ++            
Sbjct: 133 TNAFHGLTMGSMAVTGNAFYRDEAFVNRANVSFMPFDGYFGEEVDTSLYLRRFLEDGSSG 192

Query: 185 ----CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A++LE +Q EGGV  A   +L  V+++C +  +LLI DE+Q G GRTG+F  ++ 
Sbjct: 193 VDLPAAIILETIQAEGGVNVARDEWLRSVEKVCRDFDILLIVDEIQVGNGRTGRFFSFEE 252

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATME--- 297
            G+ PDIITL+K++                Q ++PG+H  TF GN LA  A+   +E   
Sbjct: 253 SGIRPDIITLSKSIXXXXXXXXXXXXXXXDQ-WKPGEHTGTFRGNNLAFVAAKEALEYWS 311

Query: 298 -TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLE 356
            ++L + V  N+  + E  +A L +   E+ +    R              K++ A+C +
Sbjct: 312 DSVLGEWVKHNSAILKEGLEA-LVQAFPELGMSARGRGLIYGLEIPLSGMAKEVSANCFQ 370

Query: 357 QGLLINCTNGN--VLRFLPPLIITKDEIDQAVQILKRAM 393
           +GL+I     +  VL+FLPPLII ++ + + + I+K A+
Sbjct: 371 KGLVIELAGASDTVLKFLPPLIIEEETLREGLGIIKEAI 409


>GSA_SHEFN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  151 bits (381), Expect = 1e-38
 Identities = 106/324 (32%), Positives = 161/324 (49%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG++Y+D+V       LGH HP++ +AV   V   L   
Sbjct: 27  NGVGGSPLFIEKADGAYIFDADGKKYIDYVGSWGPMILGHNHPKIRQAVLDAVDNGLSFG 86

Query: 76  NIYWIEPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +VK+A K++      ++    +SG EA   AI+LAR +       ++  I+  
Sbjct: 87  AP--TELEVKMAEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDNILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTI--GPHTC 185
              +HG     +   G    T  Q     +P+ FA       +NDL++++      P + 
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTATYNDLDSVRAIFEQNPESI 198

Query: 186 A-VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
           A ++LEPV G    IP  + +L+G++ +C+E G LLI DEV  G  R        HYGV 
Sbjct: 199 ACIILEPVAGNMNCIPPVEGFLQGLRTICDEFGALLIIDEVMTGF-RVSMSGAQGHYGVT 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA M+ L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMDALCE 317

Query: 302 KGVLE----NAWQMGEYFKAELTK 321
            G+ E       ++ E FKA   K
Sbjct: 318 PGLYEALADKTKRVAEGFKAAADK 341


>GSA_NITMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 424

 Score =  151 bits (381), Expect = 1e-38
 Identities = 101/345 (29%), Positives = 173/345 (50%), Gaps = 26/345 (7%)

Query: 4   QEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           ++++  G    +  +   P    K  GA++WD D R+ +DF +G     LGH   E+  +
Sbjct: 11  KKVIPSGVNSPVRYFEPYPFFTKKANGAYIWDVDNRKLIDFCNGYGALLLGHRRKEIINS 70

Query: 64  VCKQV-KTLLHCSNIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAK 121
           V KQ+ K  L+C+     E + +LAKL++ N    DK    N+G EA   AI+LAR + K
Sbjct: 71  VSKQLTKGTLYCTP---TEGETELAKLIIGNFPSIDKVRLMNTGGEATMTAIRLARGFTK 127

Query: 122 QHLGPDKYEIITATNSFHGRTLATVTATGQTKYQR-------GLDPLPQGFAYVPFNDLE 174
                 K +II     +HG   + +   G             GLD + +    V +N++E
Sbjct: 128 ------KKKIIKFEGCYHGAHDSVLVKAGSGSAHNGISVSDGGLDEVSKNTLVVQYNNIE 181

Query: 175 ALKNTI--GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
            L+ TI        V++EP+    G+I   + +L  ++++ +E  + LIFDEV  G  R 
Sbjct: 182 DLQKTIQKNKDIAGVIVEPILANMGLILPEKNFLSDLRKITKENNIPLIFDEVVTGF-RV 240

Query: 233 GKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAA 289
                 +H+G++PDI T+AKAL  GF I A+  K+++     PG     ASTF GNP++ 
Sbjct: 241 APGGAQEHFGIKPDITTMAKALSNGFAISAVGGKKEIMDLLSPGGKVYQASTFAGNPISV 300

Query: 290 TASLATMETL--LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEV 332
           +A++A+++T+  L+  +     +    F   L  +A ++ +  ++
Sbjct: 301 SAAIASIKTINKLKNKLYSKLERFNLLFSTALDDMATDMGIPHQI 345


>BIOA_BACSH RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
           aminotransferase;         EC=2.6.1.62;AltName:
           Full=7,8-diamino-pelargonic acid aminotransferase;
          Length = 455

 Score =  151 bits (381), Expect = 1e-38
 Identities = 118/416 (28%), Positives = 189/416 (45%), Gaps = 50/416 (12%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHC--SNIYW 79
           P+ + KG+G W++D   ++YLD VS   VN  GHA+P +++A+ +Q  TL H   +N + 
Sbjct: 31  PIVIKKGEGVWLYDEQNQRYLDAVSSWWVNLFGHANPRISQALSEQAFTLEHTIFAN-FS 89

Query: 80  IEPQVKLAKLLV--ENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            EP +KLA+ LV        K FF ++G+ A E A+K++ +Y  Q     K   +  T++
Sbjct: 90  HEPAIKLAQKLVALTPQSLQKVFFADNGSSAIEVALKMSFQYHMQTGKTQKKRFLALTDA 149

Query: 138 FHGRTLATVTATGQTKYQRGLDPL---------PQGFAYVPFND---------LEALKNT 179
           +HG TL  ++  G   Y     PL         P  F   PF           +  +++ 
Sbjct: 150 YHGETLGALSVGGVDLYNEVYQPLLLDTVRAQGPDCFR-CPFKHHPDSCHAQCISFVEDQ 208

Query: 180 IGPH---TCAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKF 235
           +  H     AV++EP +Q   G+      YL  +++LC +  + LI DE+  G GRTG  
Sbjct: 209 LRMHHKEITAVIIEPLIQAAAGMKMYPAIYLRRLRELCTQYDVHLIADEIAVGFGRTGTL 268

Query: 236 LGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGD-------HASTFGGNPL 287
              +   + PD + L+K L GG+ P+  ++    V QAF           H+ ++ GN L
Sbjct: 269 FACEQANISPDFMCLSKGLTGGYLPLSVVMTTNDVYQAFYDDYATMKAFLHSHSYTGNTL 328

Query: 288 AATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXX 347
           A   +L  +    ++  ++     GE  +    +  +++P V E R              
Sbjct: 329 ACRVALEVLAIFEEEQYIDVVQDKGERMRKLALEAFSDLPFVGEYRQVGFVGAIELVANR 388

Query: 348 K-------------DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILK 390
                          I    L +GLLI    GNVL F+PP IIT DE+   +Q  K
Sbjct: 389 DTKEPLPSEERIGYQIYKRALAKGLLIR-PLGNVLYFMPPYIITDDEMQFMIQTTK 443


>GSA_METM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  150 bits (379), Expect = 2e-38
 Identities = 100/316 (31%), Positives = 158/316 (50%), Gaps = 27/316 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++ L  G    + ++   P  +   +  +++D DG +++D+        LGHA+  +  
Sbjct: 17  SKKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLGHANENILN 76

Query: 63  AVCKQVKTLLHCSNIYWI--EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKY 119
           AV    K+ +     Y +  E ++ LAK ++    CA+   F NSG EA  GAI+LAR  
Sbjct: 77  AV----KSQMDLGTAYGVPSEKEITLAKEVINRIPCAEMVRFVNSGTEATMGAIRLARGV 132

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFND 172
                G DK  II    +FHG     +  TG      G    P       +    +PFND
Sbjct: 133 T----GRDK--IIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTLLIPFND 186

Query: 173 LEALKNTIGPHT---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL 229
            +A++  I  +      ++LEPV G  G I     YL+ ++++ EE G+LLIFDEV  G 
Sbjct: 187 EDAVRKVISENKDEIACIILEPVMGNVGCILPQDGYLQFLREITEENGILLIFDEVITGF 246

Query: 230 GRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
            R  K    +++G++ D+ T+ K LGGGFPIGA+  K++  + F P      A TF GNP
Sbjct: 247 -RLSKGGAQEYFGIKSDLATIGKILGGGFPIGAITGKKEYMEQFSPSGQIYQAGTFNGNP 305

Query: 287 LAATASLATMETLLQK 302
           ++ TA + T++ L  K
Sbjct: 306 VSVTAGIETLKNLDDK 321


>GSA_DESAP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  150 bits (378), Expect = 2e-38
 Identities = 101/302 (33%), Positives = 151/302 (50%), Gaps = 29/302 (9%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV--CKQVKTLLHCSNIYW 79
           P+  ++G+GA ++D DG +Y+D+V+      LGHAHP V  AV  C +  T     N   
Sbjct: 37  PIFFLRGEGALLFDVDGNRYIDYVASWGPLILGHAHPLVVRAVKECAEFGTSFGAPN--- 93

Query: 80  IEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E +++LA+LLVE     +     NSG EA   A++LAR Y K+       +I+     +
Sbjct: 94  -ELEIELARLLVEALPSVEMVRLVNSGTEATMSALRLARAYTKRE------KIVKFEGCY 146

Query: 139 HGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKN---TIGPHTCAVM 188
           HG   A +   G      G+   P       +      FNDLE LK     +G    AV+
Sbjct: 147 HGHADALLVKAGSGALTLGVPTSPGVPEDTARNTVVAGFNDLEGLKELFARLGEEIAAVI 206

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH-YGVEPDI 247
           +EPV    G++     +L+G++ L    G LL+FDEV  G   +  + G Q+ YGV+PD+
Sbjct: 207 VEPVPANMGLVLPRPGFLKGLRDLTAAYGALLVFDEVITGFRLS--YGGAQNLYGVQPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  + +   P      A T  GNPLA  A ++T++ L + GV
Sbjct: 265 TCLGKIIGGGLPVGAYGGRRDIMEQVAPSGPVYQAGTLSGNPLAMAAGISTIKALAEPGV 324

Query: 305 LE 306
            E
Sbjct: 325 YE 326


>ECTB_OCEIH RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 426

 Score =  150 bits (378), Expect = 2e-38
 Identities = 110/400 (27%), Positives = 194/400 (48%), Gaps = 37/400 (9%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P+   K +G  +WD +G +Y+DF +G      GH   E+ + +   ++   ++H  ++  
Sbjct: 30  PVVFEKAKGYKLWDKNGNEYIDFFAGAGALNYGHNPSEMQKVMIDYIQNDGVIHSLDMA- 88

Query: 80  IEPQVKLAK-----LLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
             P+ K  +     +L   +   K  F   +G    E A+K+ARK      G D   +I 
Sbjct: 89  TAPRKKFLESFNEIILKPRNMDYKVMFPGPTGTNTVESALKIARKVT----GRDT--VIG 142

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLD-PLPQGFAYVPFNDLEALKNTIG----------- 181
            TN+FHG T+ +++ TG +  + G   PL    + +PF+     +++I            
Sbjct: 143 FTNAFHGMTIGSLSVTGNSFKRNGAGIPLNHAIS-MPFDQYVDEQDSIAYIERFLEDSGS 201

Query: 182 --PHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                 A +LE VQGEGG+  A   +++ ++++C +  +LLI D+VQ G GRTG F  ++
Sbjct: 202 GVALPAAFILETVQGEGGINAARLEWVKKIEEICRKWDILLIIDDVQAGCGRTGTFFSFE 261

Query: 240 HYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
             G+ PDI+ L+K++GG G P+   L K +  Q + PG+H  TF GN LA  A+   +  
Sbjct: 262 EAGINPDIVCLSKSIGGVGLPMAITLIKPEFDQ-WGPGEHNGTFRGNNLAFLAATEALNN 320

Query: 299 LLQKGVLENAWQMGEYFKAELTKLAAEVPLVK---EVRXXXXXXXXXXXXXXKDIVAHCL 355
                  +N  +M   F+  + ++  + P +      R               +I A   
Sbjct: 321 WKTDAFSQNIKKMSSLFQERMKRIVEKFPELNADLRGRGLMLGIGVHVDGLAGEICAEAF 380

Query: 356 EQGLLINCTNG--NVLRFLPPLIITKDEIDQAVQILKRAM 393
            +GL++  +     V++FLPPLII +D I++ + IL+ ++
Sbjct: 381 SRGLILETSGAKDEVVKFLPPLIIDEDGIEKGMDILEESI 420


>GSA_PELPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  149 bits (377), Expect = 3e-38
 Identities = 103/298 (34%), Positives = 153/298 (51%), Gaps = 22/298 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG GA++ D DG  YLD+V       LG  HP +  A+   +K +   S   
Sbjct: 33  GGTPVYMAKGSGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAALEYTLKNI-GTSFGT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++++A+LL +     +     NSG EA   A++LAR Y     G DK  II     
Sbjct: 92  PIEMEIEIAELLCKIVPSLEMVRMVNSGTEATMSAVRLARGYT----GRDK--IIKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALKNTIGPHT---CAV 187
           +HG   + +   G      G    P   +G A       +ND++++K  +  +     A+
Sbjct: 146 YHGHGDSFLIKAGSGALTLGAPDSPGVTKGTAMDTLNATYNDIDSVKLLVNENKGQIAAI 205

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GVIPA   +L  +++LC E+G++LIFDEV CG  R         YGV PD+
Sbjct: 206 IIEPVAGNTGVIPAKPGFLAALRELCTEEGIVLIFDEVMCGF-RVALGGAQSLYGVTPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETLLQK 302
            T+ K +GGG P+GA   K ++ +   P GD   A T  GNPLA TA L T++ L+ +
Sbjct: 265 TTMGKIIGGGLPVGAFGGKREIMERVAPLGDVYQAGTLSGNPLALTAGLETLKILIDE 322


>GSA_PSEA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  149 bits (376), Expect = 4e-38
 Identities = 110/334 (32%), Positives = 164/334 (49%), Gaps = 39/334 (11%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV +Q+   L      
Sbjct: 30  GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVENSCA-----DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            +E  V++A L+    CA     +     +SG EA   AI+LAR Y     G D   II 
Sbjct: 90  ALE--VEMADLV----CAMVPSMEMVRMVSSGTEATMSAIRLARGYT----GRDS--IIK 137

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPH 183
               +HG + + +   G      G+     +P  FA     +PFND+EA++ T   +G  
Sbjct: 138 FEGCYHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRETLAEVGTD 197

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
              +++EPV G    +P A  +LEG+++ C+E G++LIFDEV  G  R        +YGV
Sbjct: 198 VACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGV 256

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLL 300
            PD+ T  K +GGG P+GA   K ++ Q   P      A T  GNPLA  A L T+  + 
Sbjct: 257 TPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLIS 316

Query: 301 QKGVLENAWQMGEYFKAELTKL-----AAEVPLV 329
           + G  +   ++G Y    L  L     AA +P V
Sbjct: 317 RPGFHD---ELGAYTTRMLEGLQQRADAAGIPFV 347


>GSA_METVS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  149 bits (376), Expect = 4e-38
 Identities = 98/313 (31%), Positives = 159/313 (50%), Gaps = 27/313 (8%)

Query: 3   NQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAE 62
           +++ L  G    + ++   P  +   +  +++D DG +++D+        LGHA+ ++  
Sbjct: 17  SKKYLVGGVNSPVRSFKPFPFFVKSAKSCFLYDEDGNEFIDYCLAYGPMVLGHANEKILN 76

Query: 63  AVCKQVKTLLHCSNIYWI--EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKY 119
           AV +Q    +     Y +  E ++ LAK ++    CA+   F NSG EA  GAI+LAR  
Sbjct: 77  AVKEQ----MDFGTAYGVPSEKEIILAKEVINRIPCAEMVRFVNSGTEATMGAIRLARGV 132

Query: 120 AKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFND 172
            K++      +II    +FHG     +  +G      G    P       +    +PFND
Sbjct: 133 TKRN------KIIKFEGAFHGAHDYVLVKSGSGALTHGAPNSPGIPEDTTKNTLLIPFND 186

Query: 173 LEALKNTIGPHT---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL 229
             A++  I  +      ++LEP+ G  G I     YL+ ++++ EE G++LIFDEV  G 
Sbjct: 187 EGAVRKVISENKGEIACIILEPMMGNVGCILPKDGYLKFLREITEENGIILIFDEVITGF 246

Query: 230 GRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNP 286
            R  K    ++YGV+ DI TL K LGGGFPIGA+  K+++ + F P      A TF GNP
Sbjct: 247 -RLSKGGAQEYYGVKADIATLGKILGGGFPIGAIAGKKELMEQFSPKGQVYQAGTFNGNP 305

Query: 287 LAATASLATMETL 299
           ++ TA + T++ L
Sbjct: 306 ISVTAGIETLKNL 318


>ECTB_VIRPA RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 416

 Score =  149 bits (375), Expect = 5e-38
 Identities = 117/399 (29%), Positives = 189/399 (47%), Gaps = 34/399 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P    K +G  +WD DG  Y+DF +G      GH H  + E +   ++   ++H  ++  
Sbjct: 19  PTIFEKAKGYKLWDIDGNMYIDFFAGAGALNYGHNHDTMQEKLIAYIQDDHIIHSLDMGT 78

Query: 80  IEPQVKLAK----LLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
              +  L      +L   +   K  F   +G    E A+K+ARK      G D   +I+ 
Sbjct: 79  TPRKTFLETFHNTILKPRNLDYKIMFPGPTGTNTVESALKIARKVT----GRDT--VISF 132

Query: 135 TNSFHGRTLATVTATGQTKYQRGLD-PLPQGFA-----YVPFND----LEALKNTIGPHT 184
           TN+FHG T+ +++ TG +  + G   PL    +     YV   D    LE      G   
Sbjct: 133 TNAFHGMTIGSLSVTGNSFKRHGAGVPLHHSVSMPYDKYVNDQDSIAYLERFLEDSGSGV 192

Query: 185 C---AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY 241
               A++LE VQGEGG+  A+  +L+ +  +CE   +LLI D+VQ G GRTG F  ++  
Sbjct: 193 ALPAAIILETVQGEGGINAASIEWLQKIASICERWDILLIIDDVQAGCGRTGTFFSFEPA 252

Query: 242 GVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
           G+ PDI+ L+K++GG G P+   L K +  Q + PG+H  TF GN LA  A+   +    
Sbjct: 253 GIAPDIVCLSKSIGGIGLPMAITLIKPEYDQ-WGPGEHNGTFRGNNLAFIAATEALTAFW 311

Query: 301 QKGVL-ENAWQMGEYFKAELTKLAAEVPLVK---EVRXXXXXXXXXXXXXXKDIVAHCLE 356
           Q     ++  Q  +  +  + ++  + P ++     R               +I     +
Sbjct: 312 QDNTFSKSIIQKSKLVRQRIDRIIDKFPSLQGEARGRGLMQGIVIPEPNCASEICKAAFD 371

Query: 357 QGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
            GL++  +  N  V++FLPPLII K+ I+Q   IL+ +M
Sbjct: 372 IGLIVETSGPNDEVVKFLPPLIIDKEGINQGFDILEVSM 410


>GSA_PSEAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  148 bits (374), Expect = 7e-38
 Identities = 100/299 (33%), Positives = 150/299 (50%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV +Q+   L      
Sbjct: 30  GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  V++A L+       +     +SG EA   AI+LAR Y     G D   II     
Sbjct: 90  ALE--VEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G      G+     +P  FA     +PFND+EA++ T   +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  +LEG+++ C+E G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            T  K +GGG P+GA   K ++ Q   P      A T  GNPLA  A L T+  + + G
Sbjct: 261 STFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG 319


>GSA_PSEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  148 bits (374), Expect = 7e-38
 Identities = 100/299 (33%), Positives = 150/299 (50%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV +Q+   L      
Sbjct: 30  GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  V++A L+       +     +SG EA   AI+LAR Y     G D   II     
Sbjct: 90  ALE--VEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G      G+     +P  FA     +PFND+EA++ T   +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  +LEG+++ C+E G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            T  K +GGG P+GA   K ++ Q   P      A T  GNPLA  A L T+  + + G
Sbjct: 261 STFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG 319


>GSA_PSEA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  148 bits (374), Expect = 7e-38
 Identities = 100/299 (33%), Positives = 150/299 (50%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV +Q+   L      
Sbjct: 30  GGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  V++A L+       +     +SG EA   AI+LAR Y     G D   II     
Sbjct: 90  ALE--VEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G      G+     +P  FA     +PFND+EA++ T   +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  +LEG+++ C+E G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            T  K +GGG P+GA   K ++ Q   P      A T  GNPLA  A L T+  + + G
Sbjct: 261 STFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG 319


>GSA_METJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  148 bits (374), Expect = 7e-38
 Identities = 102/303 (33%), Positives = 154/303 (50%), Gaps = 27/303 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI- 80
           P  + K +  +++D DG  Y+D+        LGHA+    +AV K VK  L   + Y   
Sbjct: 34  PFFVEKAKDCYLFDVDGNCYIDYCLAYGPMVLGHAN----DAVIKAVKEQLELGSAYGCP 89

Query: 81  -EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E ++ LAK +V+   CA+   F NSG EA   AI+LAR          + +II    ++
Sbjct: 90  TEKEIILAKEVVKRVPCAEMVRFVNSGTEATMSAIRLARGVT------GRKKIIKFDGAY 143

Query: 139 HGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHT---CAVM 188
           HG     +  +G      G    P       +    +PFND +A+K  I  +      ++
Sbjct: 144 HGAHDYVLVKSGSGALTHGHPNSPGIPEETTKNTILIPFNDEDAVKKAINENKDEIACII 203

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EP+ G  G I   + YLE ++++ EE  +LLIFDEV  G  R  K    +++GV PDI 
Sbjct: 204 VEPIMGNVGCILPKEGYLEFLREITEENDILLIFDEVITGF-RLAKGGAQEYFGVVPDIA 262

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVL 305
           TL K LGGGFPIGA++ + ++ + F P      A TF GNP++ TA +AT++ L  +   
Sbjct: 263 TLGKILGGGFPIGAIVGRRELMEQFSPLGAIYQAGTFNGNPISITAGIATLKQLDDRFYK 322

Query: 306 ENA 308
           E A
Sbjct: 323 ETA 325


>GSA_DESRM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  148 bits (374), Expect = 7e-38
 Identities = 98/304 (32%), Positives = 148/304 (48%), Gaps = 27/304 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV--CKQVKTLLHCSN 76
           G  P  + +  G+ +WD DG +Y+D++       LGH HP V  A+  C +  T      
Sbjct: 34  GMNPPFIARANGSRMWDVDGNEYIDYICSWGPQILGHRHPAVIHALQDCLEKGTTYGAPT 93

Query: 77  IYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               + +V LA++L E     +     NSG EA   A++LAR Y       ++ +II   
Sbjct: 94  ----DLEVTLAQMLTEALPSVEMVRMVNSGTEATMSALRLARAYT------NRSKIIKFE 143

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTC 185
             +HG   + +   G      G+     +P+  A       +NDLE L+     +G    
Sbjct: 144 GCYHGHHDSLLIKAGSGALTHGVPTSPGVPENIASNTINARYNDLELLEKIFTEVGSDIA 203

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           A+++EP+ G  GV+P A+ +L+G++ LC +   LLIFDEV  G  R        +Y V P
Sbjct: 204 AIIVEPLAGNMGVVPPAEGFLQGLRDLCNKHSALLIFDEVITGF-RLSYGGAQAYYNVMP 262

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   + ++ Q   P      A T  GNPLA TA +AT++ L Q 
Sbjct: 263 DLTCLGKIIGGGLPVGAYGGRREIMQMVSPAGPVYQAGTLSGNPLAMTAGIATLKQLQQP 322

Query: 303 GVLE 306
           GV E
Sbjct: 323 GVYE 326


>GABT_MYCTU RecName: Full=4-aminobutyrate aminotransferase;       
           EC=2.6.1.19;AltName: Full=Gamma-amino-N-butyrate
           transaminase;         Short=GABA transaminase;
          Length = 449

 Score =  148 bits (373), Expect = 9e-38
 Identities = 117/411 (28%), Positives = 178/411 (43%), Gaps = 48/411 (11%)

Query: 21  LPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH-CSNIYW 79
           LP+ + +  G  V D DG + +D  SGIAV  +G++ P V +AV  QV    H C  +  
Sbjct: 38  LPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTP 97

Query: 80  IEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
            E  V +A+ L      S   ++   NSGAEA E A+K+AR Y        K  ++   +
Sbjct: 98  YEGYVAVAEQLNRITPGSGPKRSVLFNSGAEAVENAVKIARSYT------GKPAVVAFDH 151

Query: 137 SFHGRTLATVTATGQTK-YQRGLDPL-------PQGFAY--------VPFNDLEALKNTI 180
           ++HGRT  T+  T ++  Y+ G  P        P  + Y        +  N   A    I
Sbjct: 152 AYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLDKQLATNGELAAARAI 211

Query: 181 GP--------HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
           G         +  A+++EP+QGEGG I  A+ +L  +   C +  ++ I DEVQ G  RT
Sbjct: 212 GVIDKQVGANNLAALVIEPIQGEGGFIVPAEGFLPALLDWCRKNHVVFIADEVQTGFART 271

Query: 233 GKFLGYQHY---GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAA 289
           G     +H    G+EPD+I  AK +  G P+ A+  + ++  A   G    TFGGNP+  
Sbjct: 272 GAMFACEHEGPDGLEPDLICTAKGIADGLPLSAVTGRAEIMNAPHVGGLGGTFGGNPVXX 331

Query: 290 TASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD 349
                        G++E A Q+       LT L A    + +VR                
Sbjct: 332 XXXXXXXXXXESDGLIERARQIERLVTDRLTTLQAVDDRIGDVRGRGAMIAVELVKSGTT 391

Query: 350 -----------IVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQIL 389
                        AH     +L     GN++R LPPL I  + + + + I+
Sbjct: 392 EPDAGLTERLATAAHAAGVIILTCGMFGNIIRLLPPLTIGDELLSEGLDIV 442


>GABT_MYCBO RecName: Full=4-aminobutyrate aminotransferase;       
           EC=2.6.1.19;AltName: Full=Gamma-amino-N-butyrate
           transaminase;         Short=GABA transaminase;
          Length = 449

 Score =  148 bits (373), Expect = 9e-38
 Identities = 117/411 (28%), Positives = 178/411 (43%), Gaps = 48/411 (11%)

Query: 21  LPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH-CSNIYW 79
           LP+ + +  G  V D DG + +D  SGIAV  +G++ P V +AV  QV    H C  +  
Sbjct: 38  LPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTP 97

Query: 80  IEPQVKLAKLL---VENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
            E  V +A+ L      S   ++   NSGAEA E A+K+AR Y        K  ++   +
Sbjct: 98  YEGYVAVAEQLNRITPGSGPKRSVLFNSGAEAVENAVKIARSYT------GKPAVVAFDH 151

Query: 137 SFHGRTLATVTATGQTK-YQRGLDPL-------PQGFAY--------VPFNDLEALKNTI 180
           ++HGRT  T+  T ++  Y+ G  P        P  + Y        +  N   A    I
Sbjct: 152 AYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLDKQLATNGELAAARAI 211

Query: 181 GP--------HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRT 232
           G         +  A+++EP+QGEGG I  A+ +L  +   C +  ++ I DEVQ G  RT
Sbjct: 212 GVIDKQVGANNLAALVIEPIQGEGGFIVPAEGFLPALLDWCRKNHVVFIADEVQTGFART 271

Query: 233 GKFLGYQHY---GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAA 289
           G     +H    G+EPD+I  AK +  G P+ A+  + ++  A   G    TFGGNP+  
Sbjct: 272 GAMFACEHEGPDGLEPDLICTAKGIADGLPLSAVTGRAEIMNAPHVGGLGGTFGGNPVXX 331

Query: 290 TASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD 349
                        G++E A Q+       LT L A    + +VR                
Sbjct: 332 XXXXXXXXXXESDGLIERARQIERLVTDRLTTLQAVDDRIGDVRGRGAMIAVELVKSGTT 391

Query: 350 -----------IVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQIL 389
                        AH     +L     GN++R LPPL I  + + + + I+
Sbjct: 392 EPDAGLTERLATAAHAAGVIILTCGMFGNIIRLLPPLTIGDELLSEGLDIV 442


>GSA_SYNJB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 436

 Score =  147 bits (372), Expect = 1e-37
 Identities = 101/319 (31%), Positives = 152/319 (47%), Gaps = 25/319 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+   +  GA+ WD DG QY+D++       +GHAHPEV EA+ + ++          +E
Sbjct: 44  PVVFDRVSGAYAWDVDGNQYIDYIGSWGPAIVGHAHPEVIEALRRALEKGTSFGAPCVLE 103

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +  LA+ ++E     +   F NSG EA    ++L R Y        + ++I     +HG
Sbjct: 104 NE--LAERVIEAVPSVEMVRFVNSGTEACMAVLRLMRAYT------GREKVIKFEGCYHG 155

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPH---TCAVMLE 190
                +   G      GL   P             P+NDLEA+K     H      V+LE
Sbjct: 156 HADMFLVKAGSGVATLGLPDSPGVPKAATSATLTAPYNDLEAVKALFEQHPDSIAGVILE 215

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ-HYGVEPDIIT 249
           PV G  G IP    +LEG++ L ++ G LL+FDEV  G   +  + G Q  +GV PD+ T
Sbjct: 216 PVVGNAGFIPPQPGFLEGLRDLTQKYGALLVFDEVMTGFRIS--YGGVQAKFGVIPDLTT 273

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLE 306
           L K +GGG P+GA   + ++ +   P      A T  GNPLA TA + T++ L + G  E
Sbjct: 274 LGKVIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIQTLDILRRPGTYE 333

Query: 307 NAWQMGEYFKAELTKLAAE 325
              ++ E     L ++A E
Sbjct: 334 YLERITEKLATGLLQIARE 352


>GSA_GRAFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  147 bits (372), Expect = 1e-37
 Identities = 104/322 (32%), Positives = 161/322 (50%), Gaps = 24/322 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K +GA+++D DG + +D+++      LGHAH  V +AV ++ K         
Sbjct: 32  GGEPIFIEKAEGAYIYDEDGNKLIDYINSWGPLILGHAHKPVIDAVIEKAKKGTSFGTPT 91

Query: 79  WIEPQV-KLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++ +LA  +V N   DK    NSG EA   A++LAR +        K +II     
Sbjct: 92  EIETKIAELAVKMVPN--IDKIRMVNSGTEACMSAVRLARGFT------GKEKIIKFAGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP---QGFA----YVPFNDLEALKNTIGPHT---CAV 187
           +HG + + +   G      G    P   QG A       +NDL+ ++  I  +      +
Sbjct: 144 YHGHSDSFLIQAGSGAVTFGTPNSPGVTQGTAKNTLLADYNDLDNVRKVIEANKEEIACI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G IP A+ +LEG+++LC+E G+LLIFDEV  G  R       +  GV+ DI
Sbjct: 204 ILEPVAGNMGCIPPAEGFLEGLRKLCDETGILLIFDEVMTGF-RLAAGGVQERAGVKADI 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL-LQKG 303
           +   K +GGG P+GA  A+ ++     P      A T  GNPLA  A LA +  L  ++G
Sbjct: 263 VCFGKVIGGGLPVGAFAARNEIMDYLAPVGPVYQAGTLSGNPLAMAAGLAMLTELDSKRG 322

Query: 304 VLENAWQMGEYFKAELTKLAAE 325
           + E+  +  +Y    + K+  E
Sbjct: 323 IFESLEKKTKYLHEGMEKVLTE 344


>GSA1_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 429

 Score =  147 bits (372), Expect = 1e-37
 Identities = 102/298 (34%), Positives = 146/298 (48%), Gaps = 23/298 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N+    P+ +  G+GA++ D DG +Y+D+V       LGHA+P V +A+ K         
Sbjct: 30  NSVDATPVFMDHGKGAYITDIDGNEYIDYVLSWGPLILGHANPSVVDAITKAAMKGTSFG 89

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
               IE +  LAKL++E     +     +SG EA   AI+LAR Y K+       +I+  
Sbjct: 90  TPTEIETE--LAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKRE------KILKF 141

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALK---NTIGPHT 184
             S+HG   + +   G      GL   P   +G A     VP+ND+E  K      G   
Sbjct: 142 EGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDVEGAKLAFEKYGEEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV++EPV G  GV+P  + +LEG++ L  + G LLIFDEV  G  R   +    +Y V 
Sbjct: 202 AAVIVEPVAGNMGVVPPIEGFLEGLRDLTTKYGALLIFDEVMTGF-RVDYYSAQGYYVVT 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           PDI  L K +GGG P+GA   K+++ +   P      A T  GNPLA  A   T+  L
Sbjct: 261 PDITCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQL 318


>GSA_SYNJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 436

 Score =  147 bits (371), Expect = 2e-37
 Identities = 101/319 (31%), Positives = 154/319 (48%), Gaps = 25/319 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+   +  GA+ WD DG QY+D++       +GHAHPEV EA+ + ++          +E
Sbjct: 44  PVVFDRVAGAYAWDVDGNQYIDYIGSWGPAIVGHAHPEVIEALRRALEKGTSFGAPCVLE 103

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +  LA+ ++E     +   F NSG EA   A++L R Y        + ++I     +HG
Sbjct: 104 NE--LAERVIEAVPSVEMVRFVNSGTEACMAALRLMRAYT------GREKVIKFEGCYHG 155

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPH---TCAVMLE 190
                +   G      GL   P             P+NDLEA+K     +      V+LE
Sbjct: 156 HADMFLVKAGSGVATLGLPDSPGVPKAATSATLTAPYNDLEAVKALFEQYPDSIAGVILE 215

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ-HYGVEPDIIT 249
           PV G  G IP    +LEG+++L ++ G LL+FDEV  G   +  + G Q  +GV PD+ T
Sbjct: 216 PVVGNAGFIPPQPGFLEGLRELTQKYGALLVFDEVMTGFRIS--YGGVQAKFGVIPDLTT 273

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLE 306
           L K +GGG P+GA   + ++ +   P      A T  GNPLA TA + T++ L + G  E
Sbjct: 274 LGKVIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLDILRRPGTYE 333

Query: 307 NAWQMGEYFKAELTKLAAE 325
              ++ E     L ++A E
Sbjct: 334 YLERITEQLATGLLQIAQE 352


>GSA_SHESW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  147 bits (371), Expect = 2e-37
 Identities = 100/323 (30%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++  AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTEIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G LLI DEV  G  R  +     +YGV P
Sbjct: 200 CIIIEPVAGNMNCIPPVPGFLQGLRDMCDEFGALLIIDEVMTGF-RVSQSGAQGYYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA M+ L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMDALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEALSAKTKRIAEGFKAAADK 341


>GSA_SHEPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  147 bits (371), Expect = 2e-37
 Identities = 100/323 (30%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++  AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTEIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G LLI DEV  G  R  +     +YGV P
Sbjct: 200 CIIIEPVAGNMNCIPPVPGFLQGLRDMCDEFGALLIIDEVMTGF-RVSQSGAQGYYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA M+ L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMDALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEALSAKTKRIAEGFKAAADK 341


>GSA_SHEB9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  147 bits (371), Expect = 2e-37
 Identities = 100/323 (30%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++  AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTEIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G L+I DEV  G  R  +     +YGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGF-RVSQSGAQGYYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEELSAKTKRIAEGFKAAADK 341


>GSA_SHEB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  147 bits (371), Expect = 2e-37
 Identities = 100/323 (30%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++  AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTDIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G L+I DEV  G  R  +     +YGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGF-RVSQSGAQGYYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEELSAKTKRIAEGFKAAADK 341


>GSA_SHEB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  147 bits (371), Expect = 2e-37
 Identities = 100/323 (30%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++  AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTDIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G L+I DEV  G  R  +     +YGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGF-RVSQSGAQGYYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEKLSAKTKRIAEGFKAAADK 341


>GSA_SHEB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  147 bits (371), Expect = 2e-37
 Identities = 100/323 (30%), Positives = 158/323 (48%), Gaps = 25/323 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + K  GA+++DADG+ Y+D+V       LGH HP++  AV   V+  L   
Sbjct: 27  NGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILGHNHPKIRAAVLAAVENGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +E Q+   K++      ++    +SG EA   AI+LAR +       ++ +I+   
Sbjct: 87  APTELEVQM-AEKVISMVPSIEQVRMVSSGTEATMSAIRLARGFT------NRDKILKFE 139

Query: 136 NSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TC 185
             +HG     +   G    T  Q     +P+ FA       +NDL++++     +     
Sbjct: 140 GCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAVYNDLDSVRTLFEQYPTDIS 199

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G    IP    +L+G++ +C+E G L+I DEV  G  R  +     +YGV P
Sbjct: 200 CIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGF-RVSQSGAQGYYGVTP 258

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   ++ V Q   P      A T  GNP+A +A LA ME L ++
Sbjct: 259 DLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSGNPIAMSAGLAQMEALCEE 318

Query: 303 GVLE----NAWQMGEYFKAELTK 321
           G+ E       ++ E FKA   K
Sbjct: 319 GLYEELSAKTKRIAEGFKAAADK 341


>GSA_METST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 423

 Score =  147 bits (371), Expect = 2e-37
 Identities = 103/318 (32%), Positives = 155/318 (48%), Gaps = 30/318 (9%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHC 74
           +  Y   P      +G+ ++D DG +Y+D+  G      GHA+  + E   +Q+K     
Sbjct: 25  VRAYKPYPFFAKSAKGSKIYDVDGNEYIDYCLGYGPLLFGHANEHIIEKSIEQLKL---- 80

Query: 75  SNIYWI--EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
              Y +  E +V+LAK +++   CA    F NSG EA   AI+LAR   K+       +I
Sbjct: 81  GTDYGVPSEKEVQLAKEVIKRVPCAQMVRFTNSGTEATMSAIRLARGITKRD------KI 134

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHT 184
           I    ++HG   A +  +G      GL   P       +    V FND EALK  I  + 
Sbjct: 135 IKFEGAYHGAHDAVLVKSGSGA--AGLPDSPGIPTDTTKNTMLVEFNDEEALKKLINENK 192

Query: 185 ---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY 241
                +++EPV G  G +P  + YL+ ++++  E G+LLI DEV  G  R  K    ++Y
Sbjct: 193 DEIACIIVEPVMGNIGCVPPKEGYLDFLREITLENGILLIIDEVITGF-RISKGGAQEYY 251

Query: 242 GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMET 298
            V PD+ T  K +GGGFPIGA+  K++  + F P      A TF GNP++    LA  E 
Sbjct: 252 NVIPDLATFGKIVGGGFPIGAIAGKKEYMEQFTPSGKIYQAGTFSGNPMSINGGLAAFE- 310

Query: 299 LLQKGVLENAWQMGEYFK 316
           +L     +   + GEYF+
Sbjct: 311 VLDDNSYKQLHKSGEYFR 328


>YAV5_SCHPO RecName: Full=Uncharacterized aminotransferase
           C27F1.05c;         EC=2.6.1.-;
          Length = 484

 Score =  147 bits (370), Expect = 2e-37
 Identities = 96/319 (30%), Positives = 153/319 (47%), Gaps = 25/319 (7%)

Query: 98  KAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRG 157
           + +    GAEANEG IKL R   +    P+K + ++  NSFHG+T   V   G+ K+Q+ 
Sbjct: 152 RTWTATGGAEANEGVIKLIRLATRYK--PNKKKFLSTLNSFHGKTTGAVFLGGKEKWQKY 209

Query: 158 LDPLPQGFAYVPFNDLEALKNTIGPHTC-AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEK 216
             P P    YVP+ D EAL+  +      + ++EP+QGEGGVI     YL   ++LC + 
Sbjct: 210 QSPAPFDVDYVPYGDAEALQVALSSGMYRSFIVEPIQGEGGVIVPPPGYLAKARELCTKY 269

Query: 217 GLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGG-FPIGAMLAKEQVAQAFQP 275
              L+ DE+Q G GRTGKF   ++  + PD I  AK   GG  P    +A E++  A   
Sbjct: 270 DTYLVLDEIQTGCGRTGKFWACEYENIIPDCIAFAKGFSGGLIPFAGYIATEELWNAAYN 329

Query: 276 G-----DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVP-LV 329
                  H +T+  N L   A +AT++ ++Q  +L    ++G      L KL  + P ++
Sbjct: 330 SLETAFLHTATYQENTLGLAAGVATIDYIVQNDLLSRCRKLGGIMFDRLNKLQTKFPHVM 389

Query: 330 KEVRXXXXXXXXXXXXXXKDI---------------VAHCLEQGLLINCTNGNVLRFLPP 374
           K+VR              + +               +A      +  +  N +V RFLPP
Sbjct: 390 KDVRGRGMIVGIEFYPIPESVQEEFGEYYATPIVNDLADTYHVQVYCSLNNPSVFRFLPP 449

Query: 375 LIITKDEIDQAVQILKRAM 393
           L I + ++D+ +  ++ A+
Sbjct: 450 LTIPEADLDEGLSAVESAV 468


>BIOA_AQUAE RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
           aminotransferase;         EC=2.6.1.62;AltName:
           Full=7,8-diamino-pelargonic acid aminotransferase;
          Length = 453

 Score =  147 bits (370), Expect = 2e-37
 Identities = 119/417 (28%), Positives = 186/417 (44%), Gaps = 57/417 (13%)

Query: 27  KGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----KTLLHCSNIYWIE 81
           +G+G ++WD  GR+Y+D +S +  N  GH HP++  AV KQ+      T L  SN+    
Sbjct: 37  RGEGVYLWDIYGRKYIDAISSLWCNVHGHNHPKLNNAVMKQLCKVAHTTTLGSSNV---- 92

Query: 82  PQVKLAKLLVENS--CADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
           P + LAK LVE S    +K F+   GAEA E AIK+A  Y K      K   IT + ++H
Sbjct: 93  PAILLAKKLVEISPEGLNKVFYSEDGAEAVEIAIKMAYHYWKNKGVKGKNVFITLSEAYH 152

Query: 140 GRTLATVTATGQTKYQRGLD-------PLPQGFAYVP--------------FNDLEALKN 178
           G T+  V+  G   +             LP  + Y                   LE +  
Sbjct: 153 GDTVGAVSVGGIELFHGTYKDLLFKTIKLPSPYLYCKEKYGELCPECTADLLKQLEDILK 212

Query: 179 TIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
           +       +M   +Q   G++P    +L+GV++L ++   L+I DEV  G GRTG     
Sbjct: 213 SREDIVAVIMEAGIQAAAGMLPFPPGFLKGVRELTKKYDTLMIVDEVATGFGRTGTMFYC 272

Query: 239 QHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAF--QPGD-----HASTFGGNPLAAT 290
           +  GV PD + L K + GG+ P+ A L  ++V  AF  + G+     H  T+ GN LA +
Sbjct: 273 EQEGVSPDFMCLGKGITGGYLPLAATLTTDEVFNAFLGEFGEAKHFYHGHTYTGNNLACS 332

Query: 291 ASLATMETL--------------LQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXX 336
            +LA +E                L K  L+  W++            A + LVK+     
Sbjct: 333 VALANLEVFEEERTLEKLQPKIKLLKERLQEFWELKHVGDVRQLGFMAGIELVKDKEKGE 392

Query: 337 XXXXXXXXXXXKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
                        +   C E+G+ +    G+V+  + PL+I +DE++  +  LK A+
Sbjct: 393 PFPYGERTGF--KVAYKCREKGVFLR-PLGDVMVLMMPLVIEEDEMNYVIDTLKWAI 446


>GSA_THICR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  146 bits (369), Expect = 3e-37
 Identities = 104/315 (33%), Positives = 151/315 (47%), Gaps = 30/315 (9%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+     +GA++ DADG+QY+D+V+      LGH HP+V +AV  Q +  L       IE
Sbjct: 33  PVFFESAKGAYLTDADGKQYIDYVASWGPAILGHTHPDVIKAVQTQAEKGLSFGAPTEIE 92

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
               +A ++ +     D     +SG EA   AI+LAR Y     G DK  I+     +HG
Sbjct: 93  --TTMADMVCDLIPSMDMVRMVSSGTEATMTAIRLARGYT----GRDK--IVKFEGCYHG 144

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNT---IGPHTCAVMLE 190
            + + +   G      G+   P       Q    +  ND E +K     IG     +++E
Sbjct: 145 HSDSLLVKAGSGALTLGVPSSPGVPACLAQETLTLTHNDSEEVKKVFSEIGDQIACIIVE 204

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G    IP    +LE ++++C+E G +LIFDEV CG  R G       Y + PD+ T 
Sbjct: 205 PVAGNMNCIPPEDGFLETLREVCDESGAVLIFDEVMCGF-RVGLTGAQGRYNITPDLTTF 263

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA   K++V Q   P      A T  GNP+A TA L T+E + + G  E 
Sbjct: 264 GKVIGGGMPVGAFGGKKEVMQHIAPLGPVYQAGTLSGNPIAMTAGLKTLELISKPGFFEE 323

Query: 308 AWQMGEYFKAELTKL 322
                   +A+ TKL
Sbjct: 324 -------LEAKTTKL 331


>GSA_HELMI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 436

 Score =  146 bits (369), Expect = 3e-37
 Identities = 104/302 (34%), Positives = 148/302 (49%), Gaps = 29/302 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           GR P+ + + +GA+++D DG +Y+D+V       +GHAHPEV+EA    +K  +     Y
Sbjct: 34  GRNPVFIERAEGAYLYDVDGNKYVDYVGSWGPMIVGHAHPEVSEA----LKAAIDRGTSY 89

Query: 79  W--IEPQVKLAKLLVENSCA-DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               E + +LAKL++E   A D     NSG EA   A++LAR Y        + +I+   
Sbjct: 90  GAPTELESRLAKLILEAFPAMDMVRMVNSGTEATMSALRLARGYT------GRSKIVKFE 143

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYV-------PFNDLEALK---NTIGPHTC 185
             +HG   + +   G      G+   P   A +       P+NDLE LK           
Sbjct: 144 GCYHGHADSLLIKAGSGALTLGVPTSPGVPANIANNTITAPYNDLETLKAIFQXXXXXXX 203

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH-YGVE 244
                 V G  GV+P A  YL+GV++L  + G L+I DEV  G      F G Q  YGVE
Sbjct: 204 XXXXXXVPGNMGVVPPAPGYLQGVRELTRQYGALMIVDEVMSGF--RVDFGGAQTLYGVE 261

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+GA   K ++ +   P      A T  GNPLA TA + T+E L +
Sbjct: 262 PDLTCLGKIIGGGLPVGAYGGKAEIMEKVSPAGPIYQAGTLSGNPLAMTAGIITLEILKR 321

Query: 302 KG 303
            G
Sbjct: 322 PG 323


>GSA1_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 429

 Score =  146 bits (369), Expect = 3e-37
 Identities = 102/298 (34%), Positives = 143/298 (47%), Gaps = 23/298 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N+    P+ +  G+GA++ D DG +Y+D+V       LGHA P V  A+           
Sbjct: 30  NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHADPSVVNAITNSAMKGTSFG 89

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
               IE +  LAKL++E     +     +SG EA   AI+LAR Y K+       +I+  
Sbjct: 90  TPTEIETE--LAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKRE------KILKF 141

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALK---NTIGPHT 184
             S+HG   + +   G      GL   P   +G A     VP+ND+E  K      G   
Sbjct: 142 EGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDVEGAKLAFEKFGEEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV++EPV G  GV+P    +LEG+++L  E G LLIFDEV  G  R   +    +Y V 
Sbjct: 202 AAVIVEPVAGNMGVVPPIDGFLEGLRELTTEYGALLIFDEVMTGF-RVDYYSAQGYYVVT 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           PDI  L K +GGG P+GA   K+++ +   P      A T  GNPLA  A   T+  L
Sbjct: 261 PDITCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQL 318


>AT2L1_XENLA RecName: Full=Alanine--glyoxylate aminotransferase
           2-like 1;         EC=2.6.1.-;
          Length = 509

 Score =  146 bits (368), Expect = 3e-37
 Identities = 113/421 (26%), Positives = 201/421 (47%), Gaps = 58/421 (13%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ +V  +G +++D  G +YLD ++ +A   +GH+HPEV +A  KQ++ LL+ ++ +  +
Sbjct: 30  PIKIVHAKGQYMFDEKGERYLDCINNVAH--VGHSHPEVTKAALKQME-LLNTNSRFLHD 86

Query: 82  PQVKLAKLLVEN--SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
             V+ A+ L+          +F NSG+EAN+ A++LAR+Y          ++IT  +++H
Sbjct: 87  NLVRYAECLISTLPEKLSVCYFVNSGSEANDLALRLARQYTGHQ------DVITLDHAYH 140

Query: 140 GRTLATVTATGQTKYQRGLD---------PLPQGF-------------AYVP-FNDLEAL 176
           G   + +  +    +Q G D         P P  +             AY     D+   
Sbjct: 141 GHVTSLIDISPYKFHQLGKDAQKEYIHVAPSPDTYRGKYREDHPDPASAYAKDVEDIIQK 200

Query: 177 KNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK-F 235
            +       A + E +Q  GG I     Y + V +   + G + I DEVQ G GR GK F
Sbjct: 201 AHQNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHF 260

Query: 236 LGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPG--DHASTFGGNPLAATA 291
             +Q  G +  PDI+T+ K +G G P+  ++  +++A+AF     ++ +TFGGNP++   
Sbjct: 261 WSFQLQGEDFLPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAI 320

Query: 292 SLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR----------XXXXXXXX 341
            LA ++ + ++ +  NA  +G Y    L +   + PL+ ++R                  
Sbjct: 321 GLAVLDIIEKEDLRGNATTVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLFRT 380

Query: 342 XXXXXXKDIVAHCLEQGLLINCTN--GNVLRFLPPLIITK-------DEIDQAVQILKRA 392
                 + I+    E+ +L++      NVL+F PP+   K       DEIDQ +  L++A
Sbjct: 381 PATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFNKEDAKLVVDEIDQCLTALEKA 440

Query: 393 M 393
           +
Sbjct: 441 I 441


>AGT2L_DROME RecName: Full=Alanine--glyoxylate aminotransferase
           2-like;         EC=2.6.1.-;
          Length = 494

 Score =  145 bits (367), Expect = 5e-37
 Identities = 107/407 (26%), Positives = 182/407 (44%), Gaps = 53/407 (13%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ +V+GQG +++D +G +YLD ++ +A   +GH HPEV  A   Q+ T +  +N +  +
Sbjct: 41  PLKIVRGQGQYMFDEEGTRYLDCINNVA--HVGHCHPEVVRAGALQMAT-ISTNNRFLHD 97

Query: 82  PQVKLAKLLVEN--SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
             V+ A+ L           FF NSG+EAN+ A++LAR + K      + ++IT  +++H
Sbjct: 98  ELVQCARTLTSKMPEPLSVCFFVNSGSEANDLALRLARNFTK------RQDVITLDHAYH 151

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNT-------------------- 179
           G   + +  +     Q G +  P      P  D+   K T                    
Sbjct: 152 GHLQSVMEVSPYKFNQPGGEAKPDYVHVAPCPDVYGGKFTDKMYPDADMGALYAQPIEEI 211

Query: 180 ------IGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
                  G    A + E +Q  GG I     Y + V       G + I DEVQ G GR G
Sbjct: 212 CQKQLAKGQGVAAFIAESLQSCGGQILPPAGYFQAVYDAVRSAGGVCIADEVQVGFGRVG 271

Query: 234 K-FLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHA--STFGGNPLAAT 290
             +  ++   V PDI+ +AK +G G P+GA++   ++AQAF     A  +T+GGNP++  
Sbjct: 272 SHYWAFETQNVIPDIVCVAKPMGNGHPVGAVVTTPEIAQAFHATGVAYFNTYGGNPVSCA 331

Query: 291 ASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI 350
            + A M  + ++G+ + A  +G+Y   E  +L  E   + +VR              K+ 
Sbjct: 332 IANAVMRVIEEEGLQQKALVLGDYLLEECNRLKQEFECIGDVRGAGLFVGIELVQDRKER 391

Query: 351 VAHCLEQGLLIN-------------CTNGNVLRFLPPLIITKDEIDQ 384
           +        ++N               N NV++  PP+   ++  D+
Sbjct: 392 IPDKKAAHWVVNRMKQLHRVLVSSDGPNDNVIKLKPPMCFNRENADE 438


>Y4QG_RHISN RecName: Full=Uncharacterized aminotransferase y4qG;    
               EC=2.6.1.-;
          Length = 448

 Score =  145 bits (366), Expect = 6e-37
 Identities = 104/399 (26%), Positives = 173/399 (43%), Gaps = 33/399 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+   K  GA + D  GR+++DF+SG  V   GH  P   +   + +++      +    
Sbjct: 52  PVVFEKAAGAILHDESGREFIDFLSGSGVLNYGHNDPYFLDEATQYLRSNGIIHGLDMAT 111

Query: 82  PQVKL------AKLLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
           P  +       A +L       K  FC  +GA A E A+KLARK   +H       I++ 
Sbjct: 112 PAKREFMECFDAIILRPRGLTYKFQFCGPTGANAVEAALKLARKATGRH------SIVSF 165

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHT---------- 184
           TN FHG +L  +  TG   Y+      P G A++P++      N    +           
Sbjct: 166 TNGFHGMSLGALAVTGNRYYRDAAGFPPAGVAFMPYDGYWGADNDTSEYLDKVLADASSG 225

Query: 185 ----CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A++LE VQGEGG+  A + +L+ ++++C   G+LLI D++Q G GR G F  ++ 
Sbjct: 226 VDVPAAIILETVQGEGGINAARKEWLQSIQRICRSHGILLIVDDIQAGCGRAGNFFSFEF 285

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL 300
            G+ PD++ L+K++ G                ++PG+H  TF GN LA     A +    
Sbjct: 286 AGLSPDVVVLSKSISGCGXXXXXXXXXXXXDVWRPGEHNGTFRGNNLAFVTGAAALRKYW 345

Query: 301 QKGVLENAWQMGEYFKAELTKLAAEVPLVKEV----RXXXXXXXXXXXXXXKDIVAHCLE 356
               L           AE  +  A+    + +    R              + IV    E
Sbjct: 346 TNDALSARVMETGRIIAERLRQVAQTNRARSLSVRGRGMMLGLNCGTGKLAERIVRKAFE 405

Query: 357 QGLLI-NC-TNGNVLRFLPPLIITKDEIDQAVQILKRAM 393
           +GL++  C     V++ LPPL   +  + + + IL +++
Sbjct: 406 EGLVVERCGAEDQVIKLLPPLTTDEQTLRRGLDILHKSV 444


>GSA_RUBXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 439

 Score =  145 bits (366), Expect = 6e-37
 Identities = 99/327 (30%), Positives = 154/327 (47%), Gaps = 43/327 (13%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT----------- 70
           P+ + +G+G  ++DADG  Y+D+V       LGHA PEV  AV +  +            
Sbjct: 45  PLFMERGEGPRIFDADGNAYIDYVMSYGPLLLGHAPPEVVGAVERAARRGTTFGAPTRXX 104

Query: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130
                      P V++ +++            NSG EA   A++LAR Y  +       +
Sbjct: 105 XXXXXXXXXXXPSVEVVRMV------------NSGTEATMSAVRLARGYTGRE------K 146

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTI--- 180
           I+    ++HG   A + + G      GL   P       +  A +P+NDLEA++      
Sbjct: 147 ILKFDGNYHGHGDALLVSAGSGVATLGLPDSPGVTPGAARDTAVLPYNDLEAVRELFEER 206

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
           G    AV+LEPV G  G IP  + +LEG++++    G LLIFDEV  G  R  +    + 
Sbjct: 207 GEEFAAVILEPVAGNMGCIPPEEGFLEGLREITAACGALLIFDEVMTGF-RVSRGGAQER 265

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATME 297
           YGV PD+  L K +GGG P+GA   + ++ +   P      A T  GNPLA +A LAT+ 
Sbjct: 266 YGVVPDLTCLGKVIGGGLPVGAYGGRREIMERVAPAGPVYQAGTLSGNPLAMSAGLATLR 325

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAA 324
              + G  E   ++G  ++  + + A+
Sbjct: 326 RTGEPGFYERLEELGARWERGMREAAS 352


>GSA_CLOTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  145 bits (366), Expect = 6e-37
 Identities = 102/320 (31%), Positives = 161/320 (50%), Gaps = 26/320 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + K +GA ++DADG +Y+D+V       LGH+HP V EAV K +   L      
Sbjct: 32  GGYPPFIKKAKGARIYDADGNEYIDYVGSWGPMILGHSHPRVLEAVSKTMVDGLSFGAA- 90

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +V++A+L+ E     +     NSG EA   AI++AR Y K+       +II     
Sbjct: 91  -TELEVQMAELITELVPSVEMVRMVNSGTEAVMSAIRVARGYTKRE------KIIKFAGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGFA--------YVPFNDLEALKNTIGP---HTCA 186
           +HG   + +   G      G+ P   G             +ND++++K        +  A
Sbjct: 144 YHGHADSMLVKVGSGAMTNGI-PNSGGVTAGAAKDTLIARYNDIDSVKLLFEQNKGNIAA 202

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EPV    GV+P    +LE +++LC+++  LLIFDEV  G  R       Q++GV  D
Sbjct: 203 VIVEPVAANMGVVPPKDNFLEELRKLCDKEEALLIFDEVITGF-RLAIGGAQQYFGVNAD 261

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETLLQK- 302
           ++T  K +GGG P+GA   + ++ +   P GD   A T  GNP+A +A +AT+  L +  
Sbjct: 262 LVTYGKIIGGGMPVGAYGGRREIMECVAPVGDVYQAGTLSGNPIAMSAGIATLRELYENP 321

Query: 303 GVLENAWQMGEYFKAELTKL 322
           G+ EN  ++G+     L K+
Sbjct: 322 GIFENINRLGQRLSEGLGKI 341


>GSA_DESAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  145 bits (365), Expect = 8e-37
 Identities = 96/303 (31%), Positives = 150/303 (49%), Gaps = 23/303 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K +G+ + DADG  Y+D+V       LGH HP+V +A+ + + +        
Sbjct: 32  GGSPLFIQKAEGSKIIDADGNVYIDYVGSWGPMILGHRHPDVVKALIEALASGTSFGAPT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E   +L++L+VE     +K    NSG EA   A++LAR Y  + +      II     
Sbjct: 92  ALE--TRLSQLVVEAVPSVEKVRMVNSGTEATMSAVRLARGYTGRDI------IIKFDGG 143

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTI---GPHTCAV 187
           +HG     + A G    T    G   +P+  +     + +ND EA+K  +   G    A+
Sbjct: 144 YHGHADTLLVAAGSGVATLNIPGSPGIPESVSAHTLSITYNDGEAVKRVMAEKGDRVAAI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G++P  + + E ++ LC + G LLIFDEV  G  R  K  G   +G+ PD+
Sbjct: 204 IVEPVAGNMGMVPPVKGFHETLRTLCTKHGALLIFDEVMTGF-RVAKGSGQGLFGITPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
               K +GGG P+GA   + ++     P      A T  GNPLA  A +AT+E L + G 
Sbjct: 263 TCFGKIIGGGLPVGAYGGRREIMDQIAPAGPVYQAGTLSGNPLAMAAGIATLEALKKTGF 322

Query: 305 LEN 307
            E+
Sbjct: 323 YES 325


>GSA_CHLTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  145 bits (365), Expect = 8e-37
 Identities = 103/325 (31%), Positives = 152/325 (46%), Gaps = 32/325 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV---CKQVKTLLHCS 75
           G  P+ + KGQGA++ D DG  YLD+V       LG  HP V  A+    + + T     
Sbjct: 33  GGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRVTAAIEYTLRNIGTSFGTP 92

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                       K++      +     NSG EA   A++LAR Y     G DK  II   
Sbjct: 93  XXXXXXXXXXXCKIVPS---LEMVRMVNSGTEATMSAVRLARGYT----GKDK--IIKFE 143

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAY--------VPFNDLEALKNTIGPH---T 184
             +HG   + +   G      G DP   G             +ND+E++K  +  +    
Sbjct: 144 GCYHGHGDSFLIKAGSGVLTLG-DPDSPGVTKGTANDTLNATYNDIESVKAIVNENKGQV 202

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            A+++EPV G  GVIPA + +L  +++LC+ +G++LIFDEV CG  R       + YGV 
Sbjct: 203 AAIIIEPVAGNTGVIPAKKEFLVALRELCDAEGIVLIFDEVMCGF-RVALGGAQELYGVT 261

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ T+ K +GGG P+GA   K  + +   P      A T  GNPLA TA L T++ L++
Sbjct: 262 PDLTTMGKIIGGGLPVGAFGGKRHIMENIAPLGSVYQAGTLSGNPLALTAGLETLKILME 321

Query: 302 KGVLENAWQMGEY----FKAELTKL 322
           +       +   +    FKA + KL
Sbjct: 322 ENPYPELERKAAFLEAGFKANMEKL 346


>GSA_CALS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  145 bits (365), Expect = 8e-37
 Identities = 94/288 (32%), Positives = 149/288 (51%), Gaps = 19/288 (6%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P  + KG+G  ++D DG +Y+DFV       LGH  P+V  ++ + V+  +       IE
Sbjct: 35  PPVISKGKGCRIFDIDGNEYIDFVLSWGAMILGHCDPDVVNSIKEVVEDQIAFGAPTEIE 94

Query: 82  PQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGR 141
              K+AKL+ E +  D   F NSG EA   AI+LA+ Y        K +I+     +HG 
Sbjct: 95  --YKMAKLVCETAQVDMVRFVNSGTEATMTAIRLAKGYT------GKKKIVKFAGCYHGH 146

Query: 142 TLATVTATGQTKYQ---RGLDP-LPQGFAYVPFNDLEALKNTIGPHT---CAVMLEPVQG 194
               +   G    +   +G+D  + Q    V +N+L++++     +     AV++EPV G
Sbjct: 147 HDIFLKEAGSAVAELRLKGIDEDIVQNTIVVEYNNLDSIEKAFKENKDEISAVIIEPVAG 206

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GV+PA + +L+ ++++C+  G LLIFDEV  G  R         Y VEPD++T  K +
Sbjct: 207 NMGVVPAKKEFLQALREICDLHGSLLIFDEVITGF-RLSLKGARALYNVEPDLVTFGKII 265

Query: 255 GGGFPIGAMLAKEQVAQAFQPGDH---ASTFGGNPLAATASLATMETL 299
           GGG P GA+  K+++ Q   P  +   A T  GNP+  +A  AT++ L
Sbjct: 266 GGGLPCGAVGGKKEIMQCLAPQGNVFQAGTMSGNPIVMSAGYATIKKL 313


>GSA2_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  145 bits (365), Expect = 8e-37
 Identities = 100/298 (33%), Positives = 145/298 (48%), Gaps = 23/298 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N+    P+ +  G+GA++ D DG +Y+D+V       LGHA+P V +A+           
Sbjct: 30  NSVDASPVFMDHGKGAYITDIDGNEYIDYVLSWGPLILGHANPSVVQAITNAAMKGTSFG 89

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
               IE +  LAKL++E     +     +SG EA   AI+LAR Y K+       +I+  
Sbjct: 90  TPTEIETE--LAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKRE------KILKF 141

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALK---NTIGPHT 184
             S+HG   + +   G      GL   P   +G A     VP+ND+E  K      G   
Sbjct: 142 EGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDIEGAKLAFEKYGEEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV++EPV G  GV+P  + +LEG+++L    G LLIFDEV  G  R   +    +Y V 
Sbjct: 202 AAVIVEPVAGNMGVVPPIEGFLEGLRELTTNYGSLLIFDEVMTGF-RVDYYSAQGYYVVT 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           PD+  L K +GGG P+GA   K+++ +   P      A T  GNPLA  A   T+  L
Sbjct: 261 PDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQL 318


>AT2L1_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase
           2-like 1;         EC=2.6.1.-;
          Length = 499

 Score =  145 bits (365), Expect = 8e-37
 Identities = 113/421 (26%), Positives = 203/421 (48%), Gaps = 59/421 (14%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ +V+ Q  +++D +G QYLD ++ +A   +GH HP V +A  KQ++ LL+ ++ +  +
Sbjct: 30  PIKIVRAQRQYMFDENGEQYLDCINNVAH--VGHCHPGVVKAALKQME-LLNTNSRFLHD 86

Query: 82  PQVKLAKLLVEN--SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFH 139
             V+ AK L           +F NSG+EAN+ A++LAR++          ++IT  +++H
Sbjct: 87  NIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQ------DVITLDHAYH 140

Query: 140 GRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL-----------------EALKNTI-- 180
           G  L+++      K+Q+G D   +     P  D                  + +K  I  
Sbjct: 141 GH-LSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYREDHADSASAYADEVKKIIED 199

Query: 181 ----GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK-F 235
               G    A + E +Q  GG I     Y + V +     G + I DEVQ G GR GK F
Sbjct: 200 AHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHF 259

Query: 236 LGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPG--DHASTFGGNPLAATA 291
             +Q YG +  PDI+T+ K +G G P+  ++  +++A+AF     ++ +T+GGNP++   
Sbjct: 260 WSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAV 319

Query: 292 SLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR----------XXXXXXXX 341
            LA ++ +  + +  NA ++G Y    L K  A+  L+ ++R                  
Sbjct: 320 GLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRT 379

Query: 342 XXXXXXKDIVAHCLEQGLLINC--TNGNVLRFLPPLIITK-------DEIDQAVQILKRA 392
                 + I+    E+ +L++    + NVL+  PP+  T+       D++D+ + +L+ A
Sbjct: 380 PATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEA 439

Query: 393 M 393
           M
Sbjct: 440 M 440


>GSA_PSEFS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  144 bits (364), Expect = 1e-36
 Identities = 101/315 (32%), Positives = 153/315 (48%), Gaps = 32/315 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV KQ++  L      
Sbjct: 30  GGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRKQLEHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            +E ++      +  S  +     +SG EA   AI+LAR +     G D   II     +
Sbjct: 90  AMETEMADLVCAIVPSM-EMVRMVSSGTEATMSAIRLARGFT----GRDS--IIKFEGCY 142

Query: 139 HGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVM 188
           HG + + +   G     +G+     +P  FA     +PFND+ A++   N +G     ++
Sbjct: 143 HGHSDSLLVKAGSGLLTQGVPSSAGVPAAFAKHTLTLPFNDIAAVEQMLNEVGQDVACII 202

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EPV G    +P A  +LEG+++ C++ G++LIFDEV  G  R        HYGV PD+ 
Sbjct: 203 VEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGF-RVALGGAQAHYGVTPDLS 261

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVL 305
           T  K +GGG P+G    K ++ Q   P      A T  GNPLA  A L T+  + + G  
Sbjct: 262 TFGKIIGGGMPVGCFGGKREIMQHIAPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG-- 319

Query: 306 ENAWQMGEYFKAELT 320
                    F AELT
Sbjct: 320 ---------FHAELT 325


>GSA_CHLL2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  144 bits (364), Expect = 1e-36
 Identities = 100/300 (33%), Positives = 155/300 (51%), Gaps = 26/300 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG+GA++ D DG  YLD+V       LG   P V  A+     TL +  + +
Sbjct: 33  GGTPIYMAKGEGAYMTDVDGNTYLDYVGSWGPFILGSMQPRVTAAI---EYTLRNIGSSF 89

Query: 79  W--IEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
              IE ++++A+LL       +     NSG EA   A++LAR Y     G DK  II   
Sbjct: 90  GTPIEMEIEIAELLSRIVPSIEMVRMVNSGTEATMSAVRLARGYT----GRDK--IIKFE 143

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALKNTIGPHT---C 185
             +HG   + +   G      G    P   +G A       +ND+E+++  +  +     
Sbjct: 144 GCYHGHGDSFLIKAGSGVLTLGSPDSPGVTKGTAADTLNATYNDIESVRLLVNENRGDIA 203

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           A+++EPV G  GVIPA + +L  +++LC+++G++LIFDEV CG  R       + YGV P
Sbjct: 204 AIIIEPVAGNTGVIPAKKEFLVALRELCDQEGIVLIFDEVMCGF-RVALGGAQELYGVTP 262

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ T+ K +GGG P+GA   K ++ +   P      A T  GNPLA TA L T++ L+++
Sbjct: 263 DLTTMGKIIGGGLPVGAFGGKRKIMENVAPLGSVYQAGTLSGNPLALTAGLETLKILMEE 322


>GSA1_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 429

 Score =  144 bits (364), Expect = 1e-36
 Identities = 102/314 (32%), Positives = 160/314 (50%), Gaps = 28/314 (8%)

Query: 28  GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSNIYWIEPQVK 85
           G+G+ ++D DG +Y+D+V       LGH +P+V E + K V   T    S +     ++K
Sbjct: 41  GKGSKIYDIDGNEYIDYVLSWGPLILGHENPQVIENLHKAVDKGTSFGASTL----EEIK 96

Query: 86  LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLA 144
           LA+L+++     +K    +SG EA +  I+LAR Y     G DK  I+     +HG + +
Sbjct: 97  LAELVIDRVPSIEKVRMVSSGTEATQDTIRLARGYT----GRDK--IVKFEGCYHGHSDS 150

Query: 145 TVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNTI---GPHTCAVMLEPVQG 194
            +   G      GL     +P+G A     VP+NDL+A++      G     V++EPV G
Sbjct: 151 LLIKAGSGVATLGLPDSPGVPEGTAKSTITVPYNDLDAIRKAFELYGDDIAGVIVEPVAG 210

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GV+P  + +L+G++ +  E G LLIFDEV  G  R G      ++ V PD+  L K +
Sbjct: 211 NMGVVPPVEGFLQGLRDITNEYGSLLIFDEVMTGF-RVGYNCAQGYFDVIPDLTCLGKVI 269

Query: 255 GGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLENAWQM 311
           GGG P+GA   K+++     P      A T  GNPLA T+   T+  L  +   E   ++
Sbjct: 270 GGGLPVGAFGGKKEIMDEIAPVGTIYQAGTLSGNPLAMTSGYETLSQLTPES-YEYFNEL 328

Query: 312 GEYFKAELTKLAAE 325
           G+  +  L K+AA+
Sbjct: 329 GDMLEDGLKKVAAK 342


>GSA1_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 429

 Score =  144 bits (364), Expect = 1e-36
 Identities = 101/298 (33%), Positives = 146/298 (48%), Gaps = 23/298 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N+    P+ +  G+GA++ D DG +Y+D+V       LGH  P V  A+ K    L   S
Sbjct: 30  NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHTDPAVVNAITKAA--LKGTS 87

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E + +LAKL++E     +     +SG EA   AI+LAR Y K+       +I+  
Sbjct: 88  FGTPTEIETELAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKRE------KILKF 141

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALK---NTIGPHT 184
             S+HG   + +   G      GL   P   +G A     VP+ND+E  K      G   
Sbjct: 142 EGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDIEGAKLAFEKYGEEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV++EPV G  GV+P  + +LEG+++L  + G LLIFDEV  G  R   +    +Y V 
Sbjct: 202 AAVIVEPVAGNMGVVPPIEGFLEGLRELTTKFGSLLIFDEVMTGF-RVDYYSAQGYYVVT 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           PD+  L K +GGG P+GA   K+++ +   P      A T  GNPLA  A   T+  L
Sbjct: 261 PDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQL 318


>BIOA_METJA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
           aminotransferase;         EC=2.6.1.62;AltName:
           Full=7,8-diamino-pelargonic acid aminotransferase;
          Length = 461

 Score =  144 bits (364), Expect = 1e-36
 Identities = 129/455 (28%), Positives = 204/455 (44%), Gaps = 77/455 (16%)

Query: 11  QQYVMNTYGRLP-------MALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEA 63
           ++Y+ + Y ++        + + +G+G ++ D  G +YLD VS I  N  GH+  E+ EA
Sbjct: 13  KEYIWHPYTQMKEYRESKNLIIERGEGNYLIDIYGNKYLDAVSSIWCNLFGHSRKEIIEA 72

Query: 64  VCKQV-----KTLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLA 116
           +  Q       TLL C N+    P + LAK LV+ +     K F+   GAEA E AIK+A
Sbjct: 73  IKNQADKICHSTLLGCGNV----PSILLAKKLVDITPKHLTKVFYSEDGAEAVEIAIKMA 128

Query: 117 RKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-QGF---------- 165
            +Y        + + I+    +HG T+  ++  G   +     PL  +G+          
Sbjct: 129 YQYYVLRGDKGRTKFISVKEGYHGDTVGAMSVGGSELFHGVFKPLLFKGYHANPPYCYRC 188

Query: 166 AYVPFND-------------LEALKNTIGPHT----CAVMLEPVQGEGGVIPAAQAYLEG 208
            Y  F D             L  + + I  H     C ++   + G  G+IP    Y+EG
Sbjct: 189 KYHNFKDTDERNEKGCEMECLNEMISLIEKHAEEVFCVILEGGIMGSAGMIPYPDGYIEG 248

Query: 209 VKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV----EPDIITLAKALGGGF-PIGAM 263
           V + C+E  ++ I DEV  G GRTGK     +  +    +PDI+ L K L GG+ P+ A 
Sbjct: 249 VAKACKENDVIFILDEVATGFGRTGKMFFCDNEELKKLEKPDILCLGKGLTGGYLPLAAT 308

Query: 264 LAKEQVAQAF--QPGD-----HASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFK 316
           L  +++   F  + G+     H  T+ GN L  +A+LAT+E   ++ V+EN     + F 
Sbjct: 309 LTTDEIYNQFLGEFGESKQLYHGHTYTGNQLLCSAALATLEIFEKENVIENIQPKIKLFH 368

Query: 317 AELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKD-------------IVAHCLEQGLLINC 363
            EL KL  E+  V +VR              +              +    LE+G+ +  
Sbjct: 369 KELRKL-KELEHVGDVRGRGFMVGIELVKDKETKEPYPYGYKAGYRVAEKLLEKGIYMR- 426

Query: 364 TNGNVLRFLPPLIITKDEI----DQAVQILKRAML 394
             GNV+  +PPL IT+ EI    D   + +K A L
Sbjct: 427 PIGNVIILVPPLSITEKEIIYLCDALYEAIKEADL 461


>GSA_PROMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  144 bits (363), Expect = 1e-36
 Identities = 98/302 (32%), Positives = 144/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 36  GGQPIVFDRVKGPYAWDIDGNRYIDYIGSWGPAICGHAHPEVITALQEAIEKGTSFGAPC 95

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E   KLA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 96  VLEN--KLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFDGC 147

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 148 YHGHADMFLVKAGSGVATLGLPDSPGVPRTTTANTLTAPYNDLEAVKKLFSENPDAISGV 207

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L  E G LL+FDEV  G  R       + +GV PD+
Sbjct: 208 ILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGF-RISYGGAQEKFGVTPDL 266

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++     P      A T  GNPLA TA + T+E L Q+G 
Sbjct: 267 TTLGKVIGGGLPVGAYGGKKEIMSMVAPSGPVYQAGTLSGNPLAMTAGIKTLELLKQEGT 326

Query: 305 LE 306
            E
Sbjct: 327 YE 328


>GSA_PROMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  144 bits (363), Expect = 1e-36
 Identities = 102/308 (33%), Positives = 146/308 (47%), Gaps = 41/308 (13%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA----EAVCKQVKTLLHCSNI 77
           P+   + +GA+ WD DG +++D+V        GH+HPEV     EA+ K       C   
Sbjct: 39  PIVFDRVKGAYAWDLDGNRFIDYVGSWGPAICGHSHPEVIASLQEALEKGTSFGAPC--- 95

Query: 78  YWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
              E + KLA++++E     +   F NSG EA    ++L R +     G DK  +I    
Sbjct: 96  ---ELENKLAEMVIEAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--LIKFEG 146

Query: 137 SFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA--- 186
            +HG     +   G      GL   P             P+NDLEA+KN    +  A   
Sbjct: 147 CYHGHADMFLVKAGSGVATLGLPDSPGVPRSTTSNTLTAPYNDLEAVKNLFAENPDAIAG 206

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGL-----GRTGKFLGYQHY 241
           V+LEP+ G  G I     +LEG+++L +E G LL+FDEV  G      G  G+F      
Sbjct: 207 VILEPIVGNAGFIQPEPGFLEGLRELTKENGSLLVFDEVMTGFRISYGGAQGRF------ 260

Query: 242 GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMET 298
           GV PD+ T+ K +GGG P+GA   ++ +     P      A T  GNPLA TA + T+E 
Sbjct: 261 GVTPDLTTMGKVIGGGLPVGAYGGRKDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTLEI 320

Query: 299 LLQKGVLE 306
           L Q+G  E
Sbjct: 321 LQQEGTYE 328


>GSA_PROM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 434

 Score =  144 bits (363), Expect = 1e-36
 Identities = 98/302 (32%), Positives = 144/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 36  GGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVTTALQEAIEKGTSFGAPC 95

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E   KLA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 96  VLEN--KLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFDGC 147

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 148 YHGHADMFLVKAGSGVATLGLPDSPGVPRTTTANTLTAPYNDLEAVKKLFSENPDAISGV 207

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L  E G LL+FDEV  G  R       + +GV PD+
Sbjct: 208 ILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGF-RISYGGAQEKFGVTPDL 266

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++     P      A T  GNPLA TA + T+E L Q+G 
Sbjct: 267 TTLGKVIGGGLPVGAYGGKKEIMSMVAPSGPVYQAGTLSGNPLAMTAGIKTLELLKQEGT 326

Query: 305 LE 306
            E
Sbjct: 327 YE 328


>GSA_PELLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  144 bits (363), Expect = 1e-36
 Identities = 97/313 (30%), Positives = 156/313 (49%), Gaps = 22/313 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KGQGA++ D DG  YLD+V       LG  HP +  A+ +   T +  S   
Sbjct: 33  GGNPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAL-EHTLTKIGTSFGT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++++A+LL +     +     NSG EA   A++LAR       G DK  II     
Sbjct: 92  PIEMEIEIAELLTKIVPSIEMVRMVNSGTEATMSAVRLARGCT----GRDK--IIKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHT---CAV 187
           +HG   + +   G      G    P       +      +ND+++++  +  +     A+
Sbjct: 146 YHGHGDSFLIKAGSGALTLGAPDSPGVTKGTAEDTLNAKYNDIKSVELLVAENKGNIAAI 205

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GVIPA + +L+ ++ LC+ +G++LIFDEV CG  R       + YG+ PD+
Sbjct: 206 IIEPVAGNTGVIPAKKEFLQALRDLCDREGIVLIFDEVMCGF-RVALGGAQELYGITPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   K  + +   P      A T  GNPLA TA + T++ L+++  
Sbjct: 265 TTMGKIIGGGLPVGAFGGKRSLMENVAPLGGVYQAGTLSGNPLALTAGIETLKILMEENP 324

Query: 305 LENAWQMGEYFKA 317
                + G + +A
Sbjct: 325 YPELDRKGAFLEA 337


>GSA_PELCD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  144 bits (363), Expect = 1e-36
 Identities = 100/316 (31%), Positives = 150/316 (47%), Gaps = 35/316 (11%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSN 76
           GR P+ + + +G  + DADG +Y+D+V       +GH+HP+V EA+C      T      
Sbjct: 32  GRQPLFIERAEGCTLVDADGNRYIDYVGSWGPMIVGHSHPKVVEAICDAAARGTSFGAPT 91

Query: 77  IYWIEPQVKLAKLLVENSCA-----DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
              IE        L E  CA     +     +SG EA   AI+LAR       G DK  I
Sbjct: 92  ALEIE--------LAEQVCAAFPNMESVRMVSSGTEATMSAIRLARGVT----GRDK--I 137

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGLDP---LPQGFA----YVPFNDLEALKNTIGPH- 183
           +     +HG   + +   G      G+     +P  FA      P+NDL  ++  +  H 
Sbjct: 138 LKFEGCYHGHADSLLVDAGSGVATFGIPASPGVPADFARHTLTAPYNDLGRVRALVEEHK 197

Query: 184 --TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY 241
               A++LEP+ G  G +P    +LEG++ LC++  +LLI DEV  G  R       Q Y
Sbjct: 198 ADLAAIILEPIAGNMGCVPPQPGFLEGLRALCDQHEILLIIDEVMTGF-RVSYGGAQQLY 256

Query: 242 GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMET 298
           GV  D++ L K +GGG P+GA   ++ + +   P      A T  GNPLA +A +AT++ 
Sbjct: 257 GVRGDLVCLGKVIGGGLPVGAFGGRQDIMRHLAPDGGVYQAGTLSGNPLAMSAGIATLKL 316

Query: 299 LLQKGVLENAWQMGEY 314
           + ++GV E   Q   Y
Sbjct: 317 IREEGVYEQLEQRSAY 332


>GSA_SYNPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  144 bits (362), Expect = 2e-36
 Identities = 100/324 (30%), Positives = 149/324 (45%), Gaps = 23/324 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 37  GGQPLVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEKGTSFGAPC 96

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 97  ALENT--LAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFEGC 148

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 149 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLEAVKQLFAENPDAISGV 208

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L +E G LL+FDEV  G  R        H+GV PD+
Sbjct: 209 ILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDEVMTGF-RISYGGAQAHFGVTPDL 267

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   +  + +   P      A T  GNPLA TA + T+E L Q G 
Sbjct: 268 TTMGKVIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGT 327

Query: 305 LENAWQMGEYFKAELTKLAAEVPL 328
            E      E   A + + A+   L
Sbjct: 328 YEKLTATTEKLIAGIKEAASAAGL 351


>GSA1_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 429

 Score =  144 bits (362), Expect = 2e-36
 Identities = 101/298 (33%), Positives = 146/298 (48%), Gaps = 23/298 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N+    P+ +  G+GA++ D DG +Y+D+V       LGHA P V  A+ K    L   S
Sbjct: 30  NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHADPAVVNAITKAA--LKGTS 87

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E + +LAKL++E     +     +SG EA   AI+LAR Y K+       +I+  
Sbjct: 88  FGTPTEIETELAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKRE------KILKF 141

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALK---NTIGPHT 184
             S+HG   + +   G      GL   P   +G A     VP+ND+E  +      G   
Sbjct: 142 EGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDIEGAELAFQKYGEEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV++EPV G  GV+P    +LEG+++L  + G LLIFDEV  G  R   +    +Y V 
Sbjct: 202 AAVIVEPVAGNMGVVPPIDGFLEGLRELTTKFGSLLIFDEVMTGF-RVDYYSAQGYYVVT 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           PD+  L K +GGG P+GA   K+++ +   P      A T  GNPLA  A   T+  L
Sbjct: 261 PDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQL 318


>GSA1_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 429

 Score =  144 bits (362), Expect = 2e-36
 Identities = 101/298 (33%), Positives = 146/298 (48%), Gaps = 23/298 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N+    P+ +  G+GA++ D DG +Y+D+V       LGHA P V  A+ K    L   S
Sbjct: 30  NSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILGHADPAVVNAITKAA--LKGTS 87

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E + +LAKL++E     +     +SG EA   AI+LAR Y K+       +I+  
Sbjct: 88  FGTPTEIETELAKLVIERVPSIEIVRMVSSGTEATMSAIRLARGYTKRE------KILKF 141

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALK---NTIGPHT 184
             S+HG   + +   G      GL   P   +G A     VP+ND+E  +      G   
Sbjct: 142 EGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTITVPYNDIEGAELAFQKYGEEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            AV++EPV G  GV+P    +LEG+++L  + G LLIFDEV  G  R   +    +Y V 
Sbjct: 202 AAVIVEPVAGNMGVVPPIDGFLEGLRELTTKFGSLLIFDEVMTGF-RVDYYSAQGYYVVT 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           PD+  L K +GGG P+GA   K+++ +   P      A T  GNPLA  A   T+  L
Sbjct: 261 PDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGTLSGNPLAMNAGFETVRQL 318


>GSA1_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 428

 Score =  144 bits (362), Expect = 2e-36
 Identities = 104/321 (32%), Positives = 158/321 (49%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K++      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KSVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQIAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA_SYNS9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  143 bits (361), Expect = 2e-36
 Identities = 97/302 (32%), Positives = 142/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 32  GGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEKGTSFGAPC 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 92  ALENT--LAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 144 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLEAVKALFAENPDAISGV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L +E G LL+FDEV  G  R        H+GV PD+
Sbjct: 204 ILEPIVGNAGFIQPEPGFLEGLRELTKENGALLVFDEVMTGF-RISYGGAQAHFGVTPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   +  + Q   P      A T  GNPLA TA + T+E L Q G 
Sbjct: 263 TTMGKVIGGGLPVGAYGGRADIMQMVSPAGPMYQAGTLSGNPLAMTAGIKTLELLKQPGT 322

Query: 305 LE 306
            E
Sbjct: 323 YE 324


>GSA_PERMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  143 bits (361), Expect = 2e-36
 Identities = 100/319 (31%), Positives = 162/319 (50%), Gaps = 23/319 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG+G+ VWD DG +Y+D+V       LGHA+ ++  A+ KQV      S   
Sbjct: 32  GMEPLFIQKGKGSRVWDVDGNEYIDYVLSWGPLILGHANDQIVNAI-KQVAN-YGTSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++++AK +V+     +   F NSG EA   AI+LAR Y        K +I+     
Sbjct: 90  PTELEIEMAKAVVDAVPSIEMVRFVNSGTEATMSAIRLARGYT------GKKKIVKFEGC 143

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG   + + + G    T    G   +P+ FA     +P+N+++A++ T   H      V
Sbjct: 144 YHGHVDSLLVSAGSGVATLSIPGTPGIPEEFANLTIVLPYNNIDAVEETFKKHGDDIACV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GV+  ++ Y + ++++ +E G LLI+DEV  G  R       + YG+EPD+
Sbjct: 204 IIEPVAGNMGVVAPSKEYHQRLREITKEYGALLIWDEVMTGF-RLAYGGAQELYGIEPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K ++ +   P      A T  GNPLA    L  ++ L +K  
Sbjct: 263 TTLGKVIGGGLPVGAYGGKREIMEYVAPVGPVYQAGTLSGNPLAMAGGLRQLQILKEKNP 322

Query: 305 LENAWQMGEYFKAELTKLA 323
             +  + G+  +  L  L+
Sbjct: 323 YPDLDRKGKKLEEGLRYLS 341


>GSA_GEOSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  143 bits (361), Expect = 2e-36
 Identities = 98/319 (30%), Positives = 151/319 (47%), Gaps = 23/319 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  G  + DAD   Y+D+V       LGH HP+V EAV + V++    S   
Sbjct: 32  GADPLFIKKAFGCTITDADNNSYIDYVGSWGPMILGHCHPQVVEAVKRAVES--GSSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA+++++     +     +SG EA   AI+LAR Y     G DK  II  +  
Sbjct: 90  PTELEITLARMVIDAVPSIEMVRMVSSGTEATMSAIRLARGYT----GRDK--IIKFSGC 143

Query: 138 FHGRTLATVTATGQ-------TKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHT---CAV 187
           +HG   A +   G                   +      FNDL+++   I  +      +
Sbjct: 144 YHGHADALLVKAGSGAATFXXXXXXXXXXXXAKNTLTAQFNDLDSVSKLIDENKNEIACI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EP+ G  G +P  + +LEG++ +C+ +G++LIFDEV  G  R       + YGV PD+
Sbjct: 204 IVEPIAGNMGTVPPGEGFLEGLRSICDSEGIVLIFDEVMTGF-RVAYGGAQELYGVTPDM 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+ + +   P      A T  GNPLA TA + T++ L   G 
Sbjct: 263 TTLGKIIGGGLPVGAFGGKKDIMKLLSPSGGVYQAGTLSGNPLAMTAGIETLKLLQADGF 322

Query: 305 LENAWQMGEYFKAELTKLA 323
            E   Q        +T+ A
Sbjct: 323 YEQLEQTSRRLAEGITEAA 341


>GSA2_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (361), Expect = 2e-36
 Identities = 104/321 (32%), Positives = 158/321 (49%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K++      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KSVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (361), Expect = 2e-36
 Identities = 104/321 (32%), Positives = 158/321 (49%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K++      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KSVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>ECTB_STRAW RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 423

 Score =  143 bits (361), Expect = 2e-36
 Identities = 119/402 (29%), Positives = 189/402 (47%), Gaps = 38/402 (9%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P    + QG+ ++D DG  YLDF +G      GH +P +  A+   ++   + H  ++  
Sbjct: 26  PTVFDRAQGSRMYDEDGHAYLDFFAGAGSLNYGHNNPVLKRALIDYLERDGVTHGLDMST 85

Query: 80  IEPQVKLAK----LLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
              +  L      +L       K  F   +G  A E A+KLARK   +        I++ 
Sbjct: 86  AAKRAFLESFQNLILRPRDLPYKVMFPGPTGTNAVESALKLARKVKGREA------IVSF 139

Query: 135 TNSFHGRTLATVTATGQTKYQRGLD-PLPQGFAYVPFND-----------LEALKNTIGP 182
           TN+FHG +L ++  TG    + G   PL  G   +PF++            E L    G 
Sbjct: 140 TNAFHGMSLGSLAVTGNAFKRAGAGIPLVHGTP-MPFDNYFDGKVPDFLWFERLLEDQGS 198

Query: 183 ---HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                 AV++E VQGEGG+  A   +L  + +LC+ + +LLI D++Q G GRTG F  ++
Sbjct: 199 GLNKPAAVIVETVQGEGGINVARPEWLRALAELCKRQDMLLIVDDIQMGCGRTGAFFSFE 258

Query: 240 HYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
             GV PDI+T++K++ G G P+   L K ++   ++PG+H  TF GN  A   + A ++T
Sbjct: 259 EAGVTPDIVTVSKSISGYGLPMSLCLFKPEL-DIWEPGEHNGTFRGNNPAFVTAAAALQT 317

Query: 299 LLQKG--VLENAWQMGEYFKAELTKLAAE-VPLVKEVRXXXXXXXXXXXXXXK--DIVAH 353
               G  + +     GE  +  L  +  E +  VKE R              +   I   
Sbjct: 318 YWADGSAMEKQTLARGEQVEQALISITEENLADVKEYRGRGLVWGIEFKDKDRAGRIAQR 377

Query: 354 CLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
             E GLLI  +     V++ LP L IT +E+D+ ++ L RA+
Sbjct: 378 AFELGLLIETSGPESEVVKLLPALTITPEELDEGLRTLARAV 419


>GSA_THEEB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 437

 Score =  143 bits (360), Expect = 3e-36
 Identities = 105/339 (30%), Positives = 152/339 (44%), Gaps = 53/339 (15%)

Query: 3   NQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNC 52
           +QEI A  Q+ +            + G  P+     +GA +WD DG QY+D+V       
Sbjct: 16  SQEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAI 75

Query: 53  LGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKL-AKLLVENSCADKAF----------F 101
           +GHAHPEV +A        LH +    +E      A  L+EN  A+             F
Sbjct: 76  VGHAHPEVIDA--------LHAA----LEKGTSFGAPCLLENILAEMVIAAVPSVEMVRF 123

Query: 102 CNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPL 161
            NSG EA    ++L R Y ++       ++I     +HG     +   G      GL   
Sbjct: 124 VNSGTEACMAVLRLMRAYTQRE------KVIKFEGCYHGHADMFLVKAGSGVATLGLPDS 177

Query: 162 P-------QGFAYVPFNDLEALKNTIGPH---TCAVMLEPVQGEGGVIPAAQAYLEGVKQ 211
           P             P+NDLEA+      +      V+LEPV G  G IP    +LEG+++
Sbjct: 178 PGVPKXXXXXXXXXPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLRE 237

Query: 212 LCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQ 271
           L ++ G LL+FDEV  G  R       + +GV PD+ TL K +GGG P+GA   + ++ +
Sbjct: 238 LTKQYGALLVFDEVMTGF-RIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMK 296

Query: 272 AFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
              P      A T  GNPLA TA + T+E L + G  E+
Sbjct: 297 MVAPAGPVYQAGTLSGNPLAMTAGIKTLEILSRPGSYEH 335


>GSA_SYNS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 438

 Score =  143 bits (360), Expect = 3e-36
 Identities = 97/302 (32%), Positives = 144/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 42  GGQPIVFDRVKGPYAWDVDGNKYVDYIGSWGPAICGHAHPEVISALQEAIEKGTSFGAPC 101

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA++++E     +   F NSG EA    ++L R +     G DK  II     
Sbjct: 102 ALENT--LAEMVIEAVPSVEMVRFVNSGTEACMSMLRLIRAFT----GRDK--IIKFEGC 153

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLE++K     +  A   V
Sbjct: 154 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLESVKQLFAENPDAIAGV 213

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L +E G LL+FDEV  G  R        H+GV PD+
Sbjct: 214 ILEPIVGNAGFIQPEPGFLEGLRELTKENGALLVFDEVMTGF-RISYGGAQAHFGVTPDL 272

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   ++++ +   P      A T  GNPLA TA + T+E L Q G 
Sbjct: 273 TTMGKVIGGGLPVGAYGGRKEIMEMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKQPGS 332

Query: 305 LE 306
            E
Sbjct: 333 YE 334


>GSA_PSEF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  143 bits (360), Expect = 3e-36
 Identities = 95/298 (31%), Positives = 148/298 (49%), Gaps = 21/298 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV KQ++  L      
Sbjct: 30  GGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRKQLEHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            +E ++      +  S  +     +SG EA   AI+LAR +     G D   II     +
Sbjct: 90  AMETEMADLVCSIVPSM-EMVRMVSSGTEATMSAIRLARGFT----GRDS--IIKFEGCY 142

Query: 139 HGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAVM 188
           HG + + +   G     +G+     +P  FA     +PFND+ A++     +G     ++
Sbjct: 143 HGHSDSLLVKAGSGALTQGVPSSAGVPAAFAKHTLTLPFNDIAAVEKMLAEVGQEVACII 202

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EPV G    +P A  +LEG+++LC++ G++LIFDEV  G  R        HYGV PD+ 
Sbjct: 203 VEPVAGNMNCVPPAPGFLEGLRRLCDQHGVVLIFDEVMTGF-RVALGGAQAHYGVTPDLS 261

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           T  K +GGG P+G    K ++ +   P      A T  GNPLA  A L T+  + + G
Sbjct: 262 TFGKIIGGGMPVGCFGGKRKIMEHIAPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG 319


>GSA_PROMT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  143 bits (360), Expect = 3e-36
 Identities = 96/299 (32%), Positives = 144/299 (48%), Gaps = 23/299 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+   + +G + WD DG +Y+D+V        GHAHPEV  A+ + ++          +E
Sbjct: 39  PIVFDRVKGPYAWDVDGNRYIDYVGSWGPAICGHAHPEVIAALQETLEKGTSFGAPCVLE 98

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            Q  LA+++++     +   F NSG EA    ++L R +     G DK  +I     +HG
Sbjct: 99  NQ--LAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFEGCYHG 150

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---VMLE 190
                +   G      GL   P             P+NDLEA+K     +  A   V+LE
Sbjct: 151 HADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLEAVKELFAENPDAISGVILE 210

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  G I     +LEG++++ +E G LL+FDEV  G  R       + +GV PD+ T+
Sbjct: 211 PVVGNAGFITPEPGFLEGLREVTQENGALLVFDEVMTGF-RISYGGAQERFGVTPDLTTM 269

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLE 306
            K +GGG P+GA   ++++     P      A T  GNPLA TA + T+E L Q+G  E
Sbjct: 270 GKVIGGGLPVGAYGGRKEIMSMVSPSGPMYQAGTLSGNPLAMTAGIKTLELLKQEGTYE 328


>GSA_PROM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  143 bits (360), Expect = 3e-36
 Identities = 96/299 (32%), Positives = 144/299 (48%), Gaps = 23/299 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+   + +G + WD DG +Y+D+V        GHAHPEV  A+ + ++          +E
Sbjct: 35  PIVFDRVKGPYAWDVDGNRYIDYVGSWGPAICGHAHPEVIAALQETLEKGTSFGAPCVLE 94

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            Q  LA+++++     +   F NSG EA    ++L R +     G DK  +I     +HG
Sbjct: 95  NQ--LAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFEGCYHG 146

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---VMLE 190
                +   G      GL   P             P+NDLEA+K     +  A   V+LE
Sbjct: 147 HADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLEAVKELFAENPDAISGVILE 206

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  G I     +LEG++++ +E G LL+FDEV  G  R       + +GV PD+ T+
Sbjct: 207 PVVGNAGFITPEPGFLEGLREVTQENGALLVFDEVMTGF-RISYGGAQERFGVTPDLTTM 265

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLE 306
            K +GGG P+GA   ++++     P      A T  GNPLA TA + T+E L Q+G  E
Sbjct: 266 GKVIGGGLPVGAYGGRKEIMSMVSPSGPMYQAGTLSGNPLAMTAGIKTLELLKQEGTYE 324


>GSA_METS5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 417

 Score =  143 bits (360), Expect = 3e-36
 Identities = 99/301 (32%), Positives = 154/301 (51%), Gaps = 33/301 (10%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI- 80
           P      +GA++   D R+ +DFV G     LGHAHP+V EAV  Q++         W+ 
Sbjct: 29  PFYTRSAKGAYLVTEDSRRLIDFVLGYGPLILGHAHPKVIEAVKDQLER-------GWLY 81

Query: 81  ----EPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                 +V+LA ++ ++   A K  F NSG EA   A++L+R +        + +I+   
Sbjct: 82  GTPSRAEVELASMITKHVPSAQKVRFVNSGTEATMTALRLSRGFT------GRSKILKFD 135

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFA--------YVPFNDLEALKNTIGPHTCA- 186
            ++HG     +   G    + G+ P  QG            P+NDL  ++  +     A 
Sbjct: 136 GNYHGAHDYVLIDAGSAASEFGV-PFSQGIPTEVSSTVLVCPYNDLTCVETVLKREEIAG 194

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EPV G  GVIP  + +L G+++L  E G +LIFDEV  G  R G      ++GV PD
Sbjct: 195 VIVEPVMGNMGVIPPEKDFLPGLRKLTREYGSVLIFDEVITGF-RLGLGGAQSYFGVTPD 253

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           + TL K +GGGFPIGA+  ++++     P     +A TF  NP++ TA +AT++ L +K 
Sbjct: 254 LTTLGKIIGGGFPIGAVCGRKEIMDQLTPSGRVFNAGTFNANPISMTAGIATIQELEKKE 313

Query: 304 V 304
           V
Sbjct: 314 V 314


>GSA_CHLT3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  143 bits (360), Expect = 3e-36
 Identities = 100/327 (30%), Positives = 162/327 (49%), Gaps = 30/327 (9%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK---TLL 72
           N+ G  P+ + KG+GA + D DG  Y+D+V       LGH+HP V EA+ + +K   T  
Sbjct: 30  NSVGGTPVFVTKGEGARMIDVDGNSYIDYVGSWGPFILGHSHPRVIEAIERTMKAHGTSF 89

Query: 73  HCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEII 132
                          K++      +     NSG EA   AI+LAR Y K+       +II
Sbjct: 90  GAPTXXXXXXXXXXXKVV---PSVEMVRMVNSGTEATMSAIRLARGYTKRE------KII 140

Query: 133 TATNSFHGRTLATVTATGQTKYQRGLDPLP---QGFA----YVPFNDLEALKNTIGP--- 182
                +HG   + +   G      G    P   +G A       +ND+E+++  +     
Sbjct: 141 KFEGCYHGHGDSFLIKAGSGALTLGAPSSPGVTEGTAKDTLNATYNDIESVRALVDSNKG 200

Query: 183 HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYG 242
           +  A+++E V G  GV+P+ + +L  +++LC+++G++LIFDEV  G  R       + YG
Sbjct: 201 NVAAIIIEAVGGNMGVVPSKKEFLVALRELCDKEGIVLIFDEVMTGF-RVALGGAQEVYG 259

Query: 243 VEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           + PD+ T+ K +GGG P+GA   K+++ +   P      A T  GNPLA +A LAT++ L
Sbjct: 260 ITPDLTTMGKIIGGGLPVGAYGGKKEIMEHVSPVGTVYQAGTLSGNPLAMSAGLATIKIL 319

Query: 300 LQKG----VLENAWQMGEYFKAELTKL 322
            ++     + + A  + E FK+ L KL
Sbjct: 320 AEENPYPELEKKAVIIEEGFKSNLEKL 346


>GSA2_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 103/321 (32%), Positives = 158/321 (49%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAEKGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLA+L++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAQLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            +++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CIIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA TA   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMTAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA2_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  143 bits (360), Expect = 3e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEAL----KAVAERGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>GSA_PROMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  142 bits (359), Expect = 4e-36
 Identities = 101/328 (30%), Positives = 152/328 (46%), Gaps = 33/328 (10%)

Query: 3   NQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNC 52
           ++EI +  QQ +            + G  P+   + +G + WD DG +Y+D++       
Sbjct: 10  SEEIFSAAQQLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAI 69

Query: 53  LGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEG 111
            GHAHPEV  A+ + ++          +E   KLA+++++     +   F NSG EA   
Sbjct: 70  CGHAHPEVTTALQEAIEKGTSFGAPCVLEN--KLAEMVIDAVPSVEMVRFVNSGTEACMA 127

Query: 112 AIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QG 164
            ++L R +     G DK  +I     +HG     +   G      GL   P         
Sbjct: 128 VLRLMRAFT----GRDK--VIKFDGCYHGHADMFLVKAGSGVATLGLPDSPGVPRTTTAN 181

Query: 165 FAYVPFNDLEALKNTIGPHTCA---VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLI 221
               P+NDLEA+K     +  A   V+LEP+ G  G I     +LEG+++L  E G LL+
Sbjct: 182 TLTAPYNDLEAVKKLFSENPDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLV 241

Query: 222 FDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---H 278
           FDEV  G  R       + +GV PD+ TL K +GGG P+GA   K+++     P      
Sbjct: 242 FDEVMTGF-RISYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGKKEIMSMVAPSGPVYQ 300

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLE 306
           A T  GNPLA TA + T+E L Q G  +
Sbjct: 301 AGTLSGNPLAMTAGIKTLELLKQDGTYD 328


>GSA_PROMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  142 bits (359), Expect = 4e-36
 Identities = 103/326 (31%), Positives = 152/326 (46%), Gaps = 25/326 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +GA+ WD DG +++D++        GHAHPEV  A+   ++         
Sbjct: 32  GGQPIVFDRVKGAYAWDVDGNRFIDYIGSWGPAICGHAHPEVIVALQDALEKGTSFGAPC 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E Q  LA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 92  ELENQ--LAEMVIDAVPSVEMVRFVNSGTEACMSVLRLMRAFT----GRDK--LIKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 144 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTSNTLTAPYNDLEAVKELFAENPDAISGV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G I     +LEG+++L  E G LL+FDEV  G  R         +GV PD+
Sbjct: 204 ILEPVVGNAGFITPEPGFLEGLRELTREHGALLVFDEVMSGF-RISYGGAQARFGVTPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   + ++ +   P      A T  GNPLA TA + T+E L Q+G 
Sbjct: 263 TTMGKVIGGGLPVGAYGGRAEIMEMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKQEGT 322

Query: 305 LENAWQMGEYFKAELTKL--AAEVPL 328
            E      E     + +   AAEVP+
Sbjct: 323 YERLESTTERLIKGILEAAKAAEVPI 348


>GSA_PROM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  142 bits (359), Expect = 4e-36
 Identities = 99/303 (32%), Positives = 144/303 (47%), Gaps = 31/303 (10%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVA----EAVCKQVKTLLHCSNI 77
           P+   + +G + WD DG +++D+V        GH+HPEV     EA+ K       C   
Sbjct: 39  PIVFDRVKGPYAWDLDGNRFIDYVGSWGPAICGHSHPEVIAALQEALEKGTSFGAPC--- 95

Query: 78  YWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
              E + KLA +++E     +   F NSG EA    ++L R +     G DK  +I    
Sbjct: 96  ---ELENKLAGMVIEAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--LIKFEG 146

Query: 137 SFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA--- 186
            +HG     +   G      GL   P             P+NDLEA+K     +  A   
Sbjct: 147 CYHGHADMFLVKAGSGVATLGLPDSPGVPRSTTSNTLTAPYNDLEAVKALFAENPDAISG 206

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V+LEP+ G  G IP    +LEG+++L +E G LL+FDEV  G  R       + +GV PD
Sbjct: 207 VILEPIVGNAGFIPPEPGFLEGLRELTKENGSLLVFDEVMTGF-RISYGGAQERFGVTPD 265

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           + T+ K +GGG P+GA   ++++     P      A T  GNPLA TA + T+E L Q+G
Sbjct: 266 LTTMGKVIGGGLPVGAYGGRKEIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKQEG 325

Query: 304 VLE 306
             E
Sbjct: 326 TYE 328


>GSA_PROM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  142 bits (359), Expect = 4e-36
 Identities = 103/326 (31%), Positives = 152/326 (46%), Gaps = 25/326 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +GA+ WD DG +++D++        GHAHPEV  A+   ++         
Sbjct: 32  GGQPIVFDRVKGAYAWDVDGNRFIDYIGSWGPAICGHAHPEVIAALQDALEKGTSFGAPC 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E Q  LA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 92  ELENQ--LAEMVIDAVPSVEMVRFVNSGTEACMSVLRLMRAFT----GRDK--LIKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 144 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTSNTLTAPYNDLEAVKELFAENPDAISGV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G I     +LEG+++L  E G LL+FDEV  G  R         +GV PD+
Sbjct: 204 ILEPVVGNAGFITPEPGFLEGLRELTREHGALLVFDEVMSGF-RISYGGAQARFGVTPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   + ++ +   P      A T  GNPLA TA + T+E L Q+G 
Sbjct: 263 TTMGKVIGGGLPVGAYGGRAEIMEMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKQEGT 322

Query: 305 LENAWQMGEYFKAELTKL--AAEVPL 328
            E      E     + +   AAEVP+
Sbjct: 323 YERLESTTERLINGILEAAKAAEVPI 348


>GSA_PROM2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  142 bits (359), Expect = 4e-36
 Identities = 101/328 (30%), Positives = 152/328 (46%), Gaps = 33/328 (10%)

Query: 3   NQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNC 52
           ++EI +  QQ +            + G  P+   + +G + WD DG +Y+D++       
Sbjct: 10  SEEIFSAAQQLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAI 69

Query: 53  LGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEG 111
            GHAHPEV  A+ + ++          +E   KLA+++++     +   F NSG EA   
Sbjct: 70  CGHAHPEVTTALQEAIEKGTSFGAPCVLEN--KLAEMVIDAVPSVEMVRFVNSGTEACMA 127

Query: 112 AIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QG 164
            ++L R +     G DK  +I     +HG     +   G      GL   P         
Sbjct: 128 VLRLMRAFT----GRDK--VIKFDGCYHGHADMFLVKAGSGVATLGLPDSPGVPRTTTAN 181

Query: 165 FAYVPFNDLEALKNTIGPHTCA---VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLI 221
               P+NDLEA+K     +  A   V+LEP+ G  G I     +LEG+++L  E G LL+
Sbjct: 182 TLTAPYNDLEAVKKLFSENPDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLV 241

Query: 222 FDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---H 278
           FDEV  G  R       + +GV PD+ TL K +GGG P+GA   K+++     P      
Sbjct: 242 FDEVMTGF-RISYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGKKEIMSMVAPSGPVYQ 300

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLE 306
           A T  GNPLA TA + T+E L Q G  +
Sbjct: 301 AGTLSGNPLAMTAGIKTLELLKQDGTYD 328


>GSA_PROM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  142 bits (359), Expect = 4e-36
 Identities = 97/302 (32%), Positives = 144/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 36  GGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICGHAHPEVITALHEAIEKGTSFGAPC 95

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E   KLA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 96  VLEN--KLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFDGC 147

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 148 YHGHADMFLVKAGSGVATLGLPDSPGVPRTTTANTLTAPYNDLEAVKKLFSENPDAISGV 207

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L  E G LL+FDEV  G  R       + +GV PD+
Sbjct: 208 ILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGF-RISYGGAQEKFGVTPDL 266

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++     P      A T  GNPLA TA + T+E L Q+G 
Sbjct: 267 TTLGKVIGGGLPVGAYGGKKEIMSMVAPAGPVYQAGTLSGNPLAMTAGIKTLELLKQEGT 326

Query: 305 LE 306
            +
Sbjct: 327 YD 328


>GSA_MARMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  142 bits (359), Expect = 4e-36
 Identities = 95/302 (31%), Positives = 150/302 (49%), Gaps = 23/302 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+   +G+GA+V+D D ++Y+D+V       LGH+HP+V +AV +Q+   L   
Sbjct: 27  NGVGGTPIFFQRGEGAYVYDEDKKRYIDYVGSWGPMILGHSHPDVLDAVRQQLDFGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++ +A+ + E     D     NSG EA   AI+LAR Y     G DK  I+  
Sbjct: 87  AP--TEVEITMAEKVCELVPSMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IVKF 138

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHT 184
              +HG + + +   G      G+   P       Q    + +ND+E +K   + IG   
Sbjct: 139 EGCYHGHSDSLLVKAGSGALTLGVPNSPGVPADLAQHTITLQYNDIEEVKRCFSEIGDQI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    I   + +LE ++++C+E G +LIFDEV  G  R        H+G+ 
Sbjct: 199 ACIIVEPVAGNMNCILPVEGFLETLRKVCDESGAVLIFDEVMTGF-RVALGGAQAHFGIV 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +G G P+GA   K ++ +   P      A T  GNP+A  A LA +  + +
Sbjct: 258 PDLTTLGKVIGAGMPVGAFGGKREIMEHISPLGPVYQAGTLSGNPVAMVAGLAVLNKISE 317

Query: 302 KG 303
           +G
Sbjct: 318 EG 319


>GSA_CHLP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  142 bits (359), Expect = 4e-36
 Identities = 97/301 (32%), Positives = 146/301 (48%), Gaps = 28/301 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV---CKQVKTLLHCS 75
           G  P+ + KGQGA++ D DG  YLD+V       LG  HP +  A+    + + T     
Sbjct: 33  GGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRLTAAIEYTLRNIGTSFGTP 92

Query: 76  NIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
                     L +++      +     NSG EA   A++LAR Y     G DK  II   
Sbjct: 93  XXXXXXXXXLLCQIVPS---LEMVRMVNSGTEATMSAVRLARGYT----GKDK--IIKFE 143

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAY--------VPFNDLEALKNTIGPH---T 184
             +HG   + +   G      G DP   G             +ND+E++K  +  +    
Sbjct: 144 GCYHGHGDSFLIKAGSGVLTLG-DPDSPGVTKGTANDTLNATYNDIESVKAIVNENKGQV 202

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            A+++EPV G  GVIPA + +L  +++LC+ +G++LIFDEV CG  R       + YGV 
Sbjct: 203 AAIIIEPVAGNTGVIPAKKEFLVALRELCDAEGIVLIFDEVMCGF-RVALGGAQELYGVT 261

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ T+ K +GGG P+GA   K ++ +   P      A T  GNPLA TA L T++ L++
Sbjct: 262 PDLTTMGKIIGGGLPVGAFGGKRKIMENIAPLGSVYQAGTLSGNPLALTAGLETLKILME 321

Query: 302 K 302
           +
Sbjct: 322 E 322


>GSA2_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 430

 Score =  142 bits (359), Expect = 4e-36
 Identities = 107/321 (33%), Positives = 154/321 (47%), Gaps = 24/321 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+GA + D DG +Y+D+V       LGHA+  V E + K   T L  S   
Sbjct: 33  GMNPVYMKEGKGAKIKDIDGNEYIDYVLSWGPLILGHANDVVVEELKKA--TELGTSFGA 90

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E + +LAKL++E     D     NSG EA   A++LAR Y  ++      +I+     
Sbjct: 91  PHEYETRLAKLVIERVPSIDVVRMVNSGTEATMSALRLARGYTGRN------KILKFVGC 144

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAV 187
           +HG   + +   G      GL   P       Q    V +ND+E+++    T G    AV
Sbjct: 145 YHGHGDSLLIKAGSGVATLGLPDSPGVPESVAQNTLTVHYNDVESVRYVFETFGDDLAAV 204

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GV+P    +LE ++   EE G LLIFDEV  G  R G       +GV PD+
Sbjct: 205 IVEPVAGNMGVVPPEPGFLETLRTWTEENGTLLIFDEVMTGF-RVGYTCAQGEFGVTPDL 263

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   K ++ +   P      A T  GNPLA TA   T+  L +   
Sbjct: 264 TCLGKVIGGGLPVGAFGGKREIMEQIAPSGPIYQAGTLSGNPLAMTAGYYTLSQLTKADY 323

Query: 305 LENAWQMGEYFKAELTKLAAE 325
            E A +  E  +A L+  A +
Sbjct: 324 SEFA-RKAERLEAGLSAAAKQ 343


>GSA2_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  142 bits (359), Expect = 4e-36
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 28/321 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V EA+    K +      +
Sbjct: 33  GMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANNRVVEAL----KAVAEKGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLAKL++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ E+ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L  +
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPE 321

Query: 303 GVLENAWQMGEYFKAELTKLA 323
             +E   +  E  +A L K A
Sbjct: 322 SYVEFE-RKAEMLEAGLRKAA 341


>ECTB_BACSK RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 426

 Score =  142 bits (359), Expect = 4e-36
 Identities = 111/402 (27%), Positives = 187/402 (46%), Gaps = 34/402 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P    K +G  +WD DG +Y+DF +G      GH   ++  A+   +    + H  ++  
Sbjct: 23  PAVFTKAKGWKMWDEDGTEYIDFFAGAGALNYGHNDEKMKRALIDYIADDGITHSLDMAT 82

Query: 80  IEPQVKLAKL----LVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                 L KL    L       K  F   +G    E A+KLARK         + EII+ 
Sbjct: 83  KPKAAFLKKLNEVILKPRKLNYKVMFPGPTGTNTVESALKLARKVT------GRTEIISF 136

Query: 135 TNSFHGRTLATVTATGQTKYQRGLD-PLPQ--GFAYVPFND--------LEALKNTIGPH 183
           TN FHG T+ +++ TG    ++G   PL       Y  F D        LE   +  G  
Sbjct: 137 TNGFHGMTIGSLSVTGNASKRKGAGIPLTNVVTMPYDKFGDEEVDTLRYLEQFLHDNGSG 196

Query: 184 T---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                AV+LE VQGEGG+  A   +L+ ++++C++  +L+I D+VQ G+GRTG F  ++ 
Sbjct: 197 VDIPAAVILETVQGEGGINAARMEWLQQLERICKKYDILMIIDDVQAGIGRTGTFFSFEE 256

Query: 241 YGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNP---LAATASLATM 296
            G+ PDI+ L+K++GG G P+   L K ++   + PG+H  TF GN    + ATA+L+  
Sbjct: 257 AGITPDIVCLSKSIGGYGLPLALTLFKPEL-DIWAPGEHNGTFRGNNHAFITATAALSYW 315

Query: 297 ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIVAHCLE 356
           E    +  +++  +    F  +L     E+    + R                + A   +
Sbjct: 316 EDPSFEQAIKDKSKKIHAFLTKLVDSYPEMDGCVKGRGFMAGIGSKVDGLAGKVAAEAFK 375

Query: 357 QGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAMLVV 396
           +GL++        V +  PPL I+ +++++   I++ ++  V
Sbjct: 376 RGLIMETAGPEDEVFKLFPPLTISDEDLEKGFAIIEESVRAV 417


>BIOB_BACTN RecName: Full=Biotin synthase;       
           EC=2.8.1.6;AltName: Full=Biotin synthetase;
          Length = 741

 Score =  142 bits (359), Expect = 4e-36
 Identities = 121/398 (30%), Positives = 191/398 (47%), Gaps = 32/398 (8%)

Query: 16  NTYGRLPMALVK-GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHC 74
           +T   LP+  VK   GA +   DGR  ++ +S       G+ HP + +A   Q+  + H 
Sbjct: 335 STTDPLPVYKVKRADGATITLEDGRTLIEGMSSWWCAVHGYNHPVLNQAAKDQLDKMSHV 394

Query: 75  S-NIYWIEPQVKLAKLLVE--NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
                  +P ++L KLL+        K F+ +SG+ A E A+K+A +Y      PDK   
Sbjct: 395 MFGGLTHDPAIELGKLLLPLVPPSMQKIFYADSGSVAVEVALKMAVQYWYAAGKPDKNNF 454

Query: 132 ITATNSFHGRTLATVTATGQTKYQRGL--DPLPQGFAYVPF-----------NDLEALKN 178
           +T  + +HG T   ++          L    LP  + +VP            +++  L+ 
Sbjct: 455 VTIRSGYHGDTWNAMSVCDPVTGMHSLFGSSLPVRY-FVPAPSSRFDGEWNPDEIIPLRE 513

Query: 179 TIGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK 234
           TI  H+    A++LEP VQG GG+      YL   ++LC+E  +LLIFDE+  G GRTGK
Sbjct: 514 TIEKHSKELAALILEPIVQGAGGMWFYHPQYLREAEKLCKEHDILLIFDEIATGFGRTGK 573

Query: 235 FLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVA-----QAFQPGDHASTFGGNPLA 288
              ++H GVEPDI+ + KAL GG+  + A+LA  Q+A      A +   H  TF GNPLA
Sbjct: 574 LFAWEHAGVEPDIMCIGKALTGGYMTLSAVLASNQIADTISNHAPKAFMHGPTFMGNPLA 633

Query: 289 ATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK 348
              + A++  LL  G  EN  ++    K EL   A + P V +VR               
Sbjct: 634 CAVACASVRLLLDSGWAENVKRIEAQLKEELAP-ARKFPQVADVRILGAIGVIQTERSVS 692

Query: 349 --DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQ 384
              +    +E+G+ +    G ++  +PP II+ +++ +
Sbjct: 693 MAYMQRRFVEEGIWVR-PFGKLVYLMPPFIISPEQLSK 729


>GSA_SULAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  142 bits (358), Expect = 5e-36
 Identities = 98/321 (30%), Positives = 158/321 (49%), Gaps = 23/321 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ +WD DG +Y+D+V       LGHAH +V  A+ KQV      S   
Sbjct: 32  GTDPIFIQRGKGSRIWDVDGNEYIDYVLSWGPLILGHAHDQVVNAI-KQVAN-YGTSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++++AK +V+     +   F NSG EA   AI+LAR Y K      + +I+     
Sbjct: 90  PTELEIEMAKAVVDAVKSVEMVRFVNSGTEATMSAIRLARGYTK------RKKIVKFDGC 143

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTI---GPHTCAV 187
           +HG   + + + G    T    G   +P+  A     +P+ND+EA++      G     V
Sbjct: 144 YHGHGDSLLVSAGSGVATLGIPGTPGIPEELANLTIVLPYNDIEAVEEAFKRYGEDIACV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GV+  ++ Y + ++ +  + G LLIFDEV  G  R       + YG++PD+
Sbjct: 204 IIEPVAGNMGVVAPSKEYHQRLRDITRKYGALLIFDEVMTGF-RLAYGGAQELYGIDPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T  K +GGG P+GA   K ++ +   P      A T  GNPLA  A L  ++ L +   
Sbjct: 263 TTFGKVIGGGLPVGAYGGKREIMEYVAPVGPVYQAGTLSGNPLAMAAGLRQLQLLKELNP 322

Query: 305 LENAWQMGEYFKAELTKLAAE 325
                + G + +    ++A E
Sbjct: 323 YRELDEKGRFLEEGFKQIAQE 343


>GSA_SOLUE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 417

 Score =  142 bits (358), Expect = 5e-36
 Identities = 94/295 (31%), Positives = 146/295 (49%), Gaps = 23/295 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +GQG+ ++D DG +Y+D+V       LGH HPE+  A+ + ++  +  S   
Sbjct: 32  GGQPVFIARGQGSHLFDVDGNEYIDYVGSWGPLILGHRHPEILAALERALE--IGTSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA  +++     +     NSG EA   AI++AR +  + L      ++     
Sbjct: 90  PTEQEIDLADAIIDAVPSVEMVRLVNSGTEATMSAIRVARGFTGRDL------VVKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGL---DPLPQGFAY----VPFNDLEALKNTIGPH---TCAV 187
           +HG   + +   G      G+     +P+ FA     +P+N L+AL+     H     AV
Sbjct: 144 YHGHVDSLLVKAGSGMATLGIADTQGVPKAFADTTIPLPYNSLDALEEAFRAHGDRIAAV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G +P    YLEG++ + E  G LLIFDEV  G  R       Q YG++PD+
Sbjct: 204 IVEPVVGNMGCVPPLPGYLEGMRAITERYGALLIFDEVMTGF-RVAFGGAQQLYGIKPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
            TL K +GGG P+GA   ++ +     P      A T  GNPLA  A LA +  L
Sbjct: 263 TTLGKVIGGGLPVGAYGGRKDIMSKVAPAGPIYQAGTLSGNPLAVAAGLAMLRHL 317


>GSA_PROM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  142 bits (358), Expect = 5e-36
 Identities = 98/305 (32%), Positives = 145/305 (47%), Gaps = 29/305 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 36  GGQPIVFDRVKGPFAWDVDGNRYIDYIGSWGPAICGHAHPEVITALQEAIE-----KGTS 90

Query: 79  WIEPQV---KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
           +  P V   KLA+++++     +   F NSG EA    ++L R +     G DK  +I  
Sbjct: 91  FGAPCVQENKLAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKF 144

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA- 186
              +HG     +   G      GL   P             P+NDLEA+K     +  A 
Sbjct: 145 DGCYHGHADMFLVKAGSGVATLGLPDSPGVPRTTTANTLTAPYNDLEAVKKLFSENPDAI 204

Query: 187 --VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             V+LEP+ G  G I     +LEG+++L  E G LL+FDEV  G  R       + +GV 
Sbjct: 205 SGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGF-RISYGGAQEKFGVT 263

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++++     P      A T  GNPLA TA + T+E L Q
Sbjct: 264 PDLTTLGKVIGGGLPVGAYGGRKEIMSMVAPSGPVYQAGTLSGNPLAMTAGIKTLELLKQ 323

Query: 302 KGVLE 306
           +G  E
Sbjct: 324 EGTYE 328


>GSA_PELPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  142 bits (358), Expect = 5e-36
 Identities = 97/319 (30%), Positives = 154/319 (48%), Gaps = 23/319 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ +    G  + D DG  ++D+V       +GH HP+V EAV +   +    S   
Sbjct: 32  GSDPLFIQSASGCTITDVDGNTFIDYVGSWGPMIVGHCHPQVVEAVRQAAGS--GASFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA ++++     +     +SG EA   AI+LAR Y     G D   II  +  
Sbjct: 90  PTEREITLANMVIDAVPSIEMVRMVSSGTEATMSAIRLARGYT----GRDN--IIKFSGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNTIG--PHTCA-V 187
           +HG   + +   G      G+     +P  FA       FN L++++  +   P + A +
Sbjct: 144 YHGHADSLLVRAGSGAATFGIPDSPGVPADFAKHTLTAEFNSLDSVRQLVADNPESIACI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G +P    +LEG++Q+C  +G++LIFDEV  G  R       + YGV PD+
Sbjct: 204 IVEPVAGNMGTVPPRDGFLEGLRQICSNEGIVLIFDEVMTGF-RVAYGGAQERYGVTPDM 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   + ++ +   P      A T  GNPLA +A +AT+  L Q G 
Sbjct: 263 TTLGKIIGGGLPVGAFGGRREIMEMLSPSGSVYQAGTLSGNPLAMSAGIATLSLLKQPGF 322

Query: 305 LENAWQMGEYFKAELTKLA 323
            E+  +   +    +T  A
Sbjct: 323 YESLEEKSRHLAEGITDAA 341


>GSA_HAES1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  142 bits (358), Expect = 5e-36
 Identities = 96/299 (32%), Positives = 149/299 (49%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D +G+QY+D+V       LGH HP +  AV K  +  L      
Sbjct: 30  GGTPVFIEKANGAYIFDTEGKQYIDYVGSWGPMILGHNHPSILSAVLKTAENGLSFGTPT 89

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  ++LA+L+ +     +     NSG EA   AI+LAR Y K+       +I+     
Sbjct: 90  PLE--IELAELICQLVPSIEMVRMVNSGTEATMSAIRLARGYTKRD------KILKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG + + +   G    T  Q     +P+ FA       +N+L+++KN    +      V
Sbjct: 142 YHGHSDSLLVKAGSGSLTLGQPSSPGVPEDFAKHTITCEYNNLQSVKNAFEQYPDQIACV 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    I   Q +L+G++QLC E G L I DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCILPKQDFLQGLRQLCNEYGSLFIIDEVMTGF-RVALGGAQSYYEVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            TL K +GGG P+GA   K+++ Q   P      A T  GNP+A +A +A +  L ++G
Sbjct: 261 TTLGKVIGGGMPVGAFGGKKEIMQYIAPTGPVYQAGTLSGNPIAMSAGIACLNELKKEG 319


>GSA2_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 431

 Score =  142 bits (358), Expect = 5e-36
 Identities = 94/292 (32%), Positives = 147/292 (50%), Gaps = 23/292 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + +G+G+ ++D DG +Y+D+V       LGHA+ +V EA+ +  +T         IE
Sbjct: 36  PIFMARGKGSKIYDIDGNEYIDYVLSWGPLILGHANDQVVEALKRVAETGTSFGAPTLIE 95

Query: 82  PQVKLAKLLVENSCADKAF-FCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +  LAKL++E   + +     +SG EA   A++LAR Y  ++      +I+     +HG
Sbjct: 96  NE--LAKLVMERMPSIEIIRMVSSGTEATMSALRLARGYTGRN------KIVKFEGCYHG 147

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAVMLE 190
              + +   G      GL   P       Q    VP+NDL++++      G    AV++E
Sbjct: 148 HGDSLLIKAGSGVATLGLPDSPGVPETVAQHTITVPYNDLQSVRYAFEKFGEDIAAVIVE 207

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  GV+P    +L+G++ +  E G LLIFDEV  G  R   + G  +YGV PD+  L
Sbjct: 208 PVAGNMGVVPPEPGFLQGLRDVTNEYGALLIFDEVMTGF-RVDYYSGQGYYGVTPDLTCL 266

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
            K +GGG P+GA   +  + +   P      A T  GNP+A TA   T+  L
Sbjct: 267 GKVIGGGLPVGAYGGRADIMEKIAPSGPIYQAGTLSGNPMAMTAGYETLRQL 318


>YGD3_SCHPO RecName: Full=Uncharacterized aminotransferase
           C1771.03c;         EC=2.6.-.-;
          Length = 459

 Score =  142 bits (357), Expect = 7e-36
 Identities = 116/428 (27%), Positives = 194/428 (45%), Gaps = 60/428 (14%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI-YWI 80
           P  +V+ +G +++  DG + +D   G AV CLGH + EV +A+ KQ + + +  ++ +  
Sbjct: 28  PPTVVRAEGVYLYLEDGTRIMDATGGAAVACLGHGNKEVIDAMHKQSEKVCYIHSMGFSN 87

Query: 81  EPQVKLAKLLVEN--SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
           EP  KLA LLV        +A+F NSG+EA E  +KL  +Y +      +  II     +
Sbjct: 88  EPADKLANLLVSEHPDVFARAYFANSGSEAVETCLKLILQYWQLVGEKQRCHIIARKQGY 147

Query: 139 HGRTLATVTATG-----------------------QTKYQRGLDPLPQGFAYVPFNDLEA 175
           HG TL  ++  G                       + +Y+   +   +  A +   +LE 
Sbjct: 148 HGNTLFALSVGGMKPRKQPYEGVFSHTTSHVSPCFEYRYKENGETTEEYVARLA-KELED 206

Query: 176 LKNTIGPHTCAVML-EPVQGE-GGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTG 233
               +GP   A  + E V G   G       Y + ++++C++ G++   DEV  G+GRTG
Sbjct: 207 EILRVGPEKVAAFVAETVSGACTGCATPVPGYFKAMRKVCDKYGVIFYLDEVMSGIGRTG 266

Query: 234 KFLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQPGDHAS----TFGGNPLA 288
               ++  GV PDI ++AK LGGG+ PI   L   ++   F+  D A     T+  +P+A
Sbjct: 267 TMHAWEQEGVTPDIQSIAKCLGGGYQPISGALVGHRIMNVFEQKDAAMAGFFTYQAHPIA 326

Query: 289 ATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK 348
            +A+LA    L +  ++E A +MG+Y   +L +     P V  +R              K
Sbjct: 327 CSAALAVQTILRRDHLVERAAEMGKYLSEKLHETFDSHPNVGNIR---GRGLFWGLEIVK 383

Query: 349 D-IVAHCL---------------EQGLL-------INCTNGNVLRFLPPLIITKDEIDQA 385
           D     C                E G+        I+ T G+ +   PP IIT+++ID+ 
Sbjct: 384 DKATKECFPPEYKVGSLANKIGCEHGVFVYPGMGTIDGTRGDHVLLAPPYIITREQIDEL 443

Query: 386 VQILKRAM 393
           V+ L + +
Sbjct: 444 VEALSKTI 451


>GSA_PSEMY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  142 bits (357), Expect = 7e-36
 Identities = 95/299 (31%), Positives = 150/299 (50%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V ++V +Q++  L      
Sbjct: 30  GGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILGHSHPDVLDSVRRQLQHGLSYGAPT 89

Query: 79  WIEPQV-KLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E ++ +L   LV +   +     +SG EA   AI+LAR Y     G D   II     
Sbjct: 90  ALETEMAELVCSLVPSM--EMVRMVSSGTEATMSAIRLARGYT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G     +G+     +P  FA     +PFND++A+      +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTQGVPNSAGVPAAFAKHTLTLPFNDIDAVAECLAQVGKEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  +LEG+++ C++ G++LIFDEV  G  R        HYGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGF-RVALGGAQAHYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            T  K +GGG P+G    K  + +   P      A T  GNPLA  A L T++ + + G
Sbjct: 261 TTFGKIIGGGMPVGCFGGKRAIMECIAPLGPVYQAGTLSGNPLAMAAGLTTLKLISRPG 319


>GSA_ALTMD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  142 bits (357), Expect = 7e-36
 Identities = 91/309 (29%), Positives = 150/309 (48%), Gaps = 29/309 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + K  GA++WDADG+QY+D++       LGH +  + EAV +       CS + 
Sbjct: 30  GGTPRFITKADGAYMWDADGKQYIDYIQSWGPMILGHNNAPIREAVIEA-----SCSGLS 84

Query: 79  W---IEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
           +    E +V +A+L+ E     +     NSG EA   AI+LAR Y  ++      +I+  
Sbjct: 85  FGAPTEAEVIMAELVSEMVPSMEMVRMVNSGTEATMSAIRLARGYTSRN------KIVKF 138

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKN---TIGPHT 184
              +HG   + +   G      G+   P       +    V FN+L+++K    T G   
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGVPSSPGVPANVAEHTLTVEFNNLDSVKEIFETHGDDI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + +LEG++ +C++ G +LIFDEV  G  R  +    + + V+
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFLEGLRAICDQYGSVLIFDEVMTGF-RVSRGGAQERFNVK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+G    +  +     P      A T  GNP+A  A LA +  + Q
Sbjct: 258 PDLTCLGKVIGGGMPVGCFGGRRDIITHIAPTGPVYQAGTLSGNPVAMAAGLAALTQIKQ 317

Query: 302 KGVLENAWQ 310
            G+ ++ ++
Sbjct: 318 PGLYDSIFE 326


>AT2L1_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase
           2-like 1;         EC=2.6.1.-;
          Length = 497

 Score =  142 bits (357), Expect = 7e-36
 Identities = 114/435 (26%), Positives = 212/435 (48%), Gaps = 58/435 (13%)

Query: 2   NNQEILAMGQQYVMNT----YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAH 57
           + QE LA+ ++++  +    +   P+ +V+ Q  +++D  G QYLD ++ +A   +GH H
Sbjct: 6   SKQETLALRRKHIGPSCKVFFAADPIKIVRAQRQYMFDEKGDQYLDCINNVAH--VGHCH 63

Query: 58  PEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADK---AFFCNSGAEANEGAIK 114
           PEV +A  KQ++ LL+ ++ +  +  V+ AK L   +  D+    +F NSG+EAN+ A++
Sbjct: 64  PEVVKAAQKQME-LLNTNSRFLHDNIVEYAKRL-SATLPDRLSVCYFTNSGSEANDLALR 121

Query: 115 LARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDL- 173
           LAR++          ++IT  +++HG  L+++      K+Q+G D   +     P  D  
Sbjct: 122 LARQFRGHQ------DVITLDHAYHGH-LSSLIEISPYKFQKGKDVKKEFVHVAPAPDTY 174

Query: 174 ----------------EALKNTI------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQ 211
                           + +K  I      G    A + E +Q  GG I     Y + V +
Sbjct: 175 RGKYREDHVDPASAYADEVKKIIDEAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAE 234

Query: 212 LCEEKGLLLIFDEVQCGLGRTGK-FLGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQ 268
                G + I DEVQ G GR GK F  +Q +G +  PDI+T+ K +G G P+  ++  ++
Sbjct: 235 YVRGAGGVFIADEVQVGFGRVGKHFWSFQMFGEDFVPDIVTMGKPMGNGHPMACVVTTKE 294

Query: 269 VAQAFQPG--DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEV 326
           +A+AF     ++ +T+GGNP+++   LA ++ +  + +  NA ++G Y    L K   + 
Sbjct: 295 IAEAFSASGMEYFNTYGGNPVSSAVGLAVLDVIKNEDLQGNATRVGNYLTELLNKQKTKH 354

Query: 327 PLVKEVRXXXXXXXXXXXXXXKD----------IVAHCLEQGLLINC--TNGNVLRFLPP 374
            L+ ++R              +           I+    E+ +L++    + NVL+  PP
Sbjct: 355 TLIGDIRGVGLFIGIDLVKDHQQRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPP 414

Query: 375 LIITKDEIDQAVQIL 389
           +  T+++    V+ L
Sbjct: 415 MCFTEEDAKFMVEQL 429


>GSA_YERPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_YERP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/327 (32%), Positives = 153/327 (46%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P+ + +  GA+++D DG+ Y+D+V       LGH HP + +AV + V+  L      
Sbjct: 30  GGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ +     D     NSG EA   AI+LAR Y     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRQAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++ +     L   A E  +PLV
Sbjct: 321 YETLTELTDSLATGLRHAAKEENIPLV 347


>GSA_THEYD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  141 bits (356), Expect = 9e-36
 Identities = 99/321 (30%), Positives = 161/321 (50%), Gaps = 23/321 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K +G+ ++D DG +Y+D+V       LGHA+P V +A+ K ++     S   
Sbjct: 32  GGNPLFIAKAKGSKIYDVDGNEYIDYVLSWGPLILGHAYPSVVKALKKAIEK--GTSYGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++KLA L+ +     +K  F NSG EA   AI++AR + K++      ++I     
Sbjct: 90  PTELEIKLATLVKKAFPSIEKLRFVNSGTEATMSAIRVARGFTKRN------KVIKFEGC 143

Query: 138 FHGRT---LATVTATGQTKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     L +  + G T        +PQ +      +PFND+   KNT+  H      V
Sbjct: 144 YHGHVDGLLVSAGSGGATFSIPDSLGVPQSYTSETIVLPFNDINTFKNTLKEHWKDIACV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G I     +L+ ++   ++ G++LIFDEV  G  R       Q+YGV+PD+
Sbjct: 204 IVEPVVGNMGCILPKDEFLKVLRNETQKYGIVLIFDEVMTGF-RVSFGGAQQYYGVKPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   K+++     P      A T  GNP+A TA + T++ L +  V
Sbjct: 263 TCLGKVIGGGLPVGAYGGKKEIMALVAPDGGVYQAGTLSGNPIAMTAGIETLKVLSKASV 322

Query: 305 LENAWQMGEYFKAELTKLAAE 325
            +   +  +Y +  L   A +
Sbjct: 323 YKRLEKTMQYLEEGLKDSAKQ 343


>GSA_PSEU5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  141 bits (356), Expect = 9e-36
 Identities = 105/330 (31%), Positives = 163/330 (49%), Gaps = 31/330 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ L   +GA+V D D ++Y+D+V       LGH+HP+V +AV +Q++  L      
Sbjct: 30  GGTPLFLKHAEGAYVIDEDDKRYVDYVGSWGPMILGHSHPQVLDAVRRQLEHGLSYGAPT 89

Query: 79  WIEPQV-KLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E ++ +L   LV +   +     +SG EA   AI+LAR Y     G D   II     
Sbjct: 90  AMETEMAELVCRLVPSM--EMVRMVSSGTEATMSAIRLARGYT----GRDA--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNTI---GPHTCAV 187
           +HG + + +   G     +G+     +P  FA     + +NDL+ ++ T+   G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTQGVPSSAGVPADFAKHTLTLAYNDLDEVEATLKEKGEQVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  +LEG+++LC+  G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGFLEGLRRLCDAHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T  K +GGG P+G    K  + +   P      A T  GNPLA  A L T+E + + G 
Sbjct: 261 STFGKIIGGGMPVGCFGGKRAIMERIAPLGPVYQAGTLSGNPLAMAAGLTTLELISRPGF 320

Query: 305 LENAWQMGEYFKAELTKL-----AAEVPLV 329
            +   ++G Y    L  L     AA +P V
Sbjct: 321 HD---ELGAYTSRMLQGLQDRADAAGIPFV 347


>GSA_MOOTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 437

 Score =  141 bits (356), Expect = 9e-36
 Identities = 96/305 (31%), Positives = 147/305 (48%), Gaps = 28/305 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + +G+GA+++D DG +Y+D+VS      LGH HPEV +A+    KTL      +
Sbjct: 36  GLTPPFIQRGEGAYLYDIDGHKYIDYVSSWGPLILGHRHPEVVDAL---EKTLREMGTSF 92

Query: 79  WIEPQVK---LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +++     ++       +     NSG EA   A++LAR Y        + +++   
Sbjct: 93  GAPTELENELAREITTAMPAVEMVRLVNSGTEATMSALRLARGYT------GREKVVKFA 146

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLPQGFAYV-------PFNDLEALKNTI---GPHTC 185
             +HG     +   G      G+   P   A V       P+NDL A+++     G    
Sbjct: 147 GCYHGHADYFLIQAGSGALTFGIPNSPGVPATVAANTIVAPYNDLAAVEDIFQKAGEEIA 206

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH-YGVE 244
           AV++EPV G  G +P    +L G++ + +E G LLIFDEV  G      F G Q  YG+ 
Sbjct: 207 AVIVEPVAGNMGCVPPLTGFLAGLRTITKEYGSLLIFDEVMTGF--RVAFGGAQALYGIR 264

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+GA   + ++ +   P      A T  GNPLA +A LAT++ L +
Sbjct: 265 PDLTCLGKIIGGGLPVGAYGGRREIMERVAPSGPIYQAGTLSGNPLAVSAGLATLKVLKK 324

Query: 302 KGVLE 306
            G  E
Sbjct: 325 PGTYE 329


>GSA_KLEP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  141 bits (356), Expect = 9e-36
 Identities = 106/327 (32%), Positives = 150/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +  GA+++D DG+ Y+D+V       LGH HP +  AV +     L      
Sbjct: 30  GGTPLFIERADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAASRGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQDIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCIPPQPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQAYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMDALAPTGPVYQAGTLSGNPIAMAAGFACLSEVAQPGV 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++       L   A E  +PLV
Sbjct: 321 HETLTELTNQLADGLLNAARETGIPLV 347


>GSA_VIBVY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  141 bits (355), Expect = 1e-35
 Identities = 101/330 (30%), Positives = 162/330 (49%), Gaps = 25/330 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA+++DADG+ Y+D+V       LGH H  + EAV +  +  L   
Sbjct: 27  NGVGGSPIFVERADGAFIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIEAAQRGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++K+A+L+ E     ++    +SG EA   AI+LAR +     G DK  I+  
Sbjct: 87  AP--TEMEIKMAELVSELVPSMEQLRMVSSGTEATMSAIRLARGFT----GRDK--ILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG   + +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTATFNDLDSVRELFAANKGEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + + EG++++C+++G LLIFDEV  G  R        HY ++
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGF-RVALGGAQAHYNIK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   +++V Q   P      A T  GNP+A  A  A +  L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKEVMQYIAPTGPVYQAGTLSGNPVAMAAGYACLTLLRE 317

Query: 302 KGVLENAWQMGEYFKAELTKLAAE--VPLV 329
           +G  +      ++       LAA+  +PLV
Sbjct: 318 EGNEKRLASKTKHLADGFKSLAAQHGIPLV 347


>GSA_VIBVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  141 bits (355), Expect = 1e-35
 Identities = 101/330 (30%), Positives = 162/330 (49%), Gaps = 25/330 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA+++DADG+ Y+D+V       LGH H  + EAV +  +  L   
Sbjct: 27  NGVGGSPIFVERADGAFIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIEAAQRGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++K+A+L+ E     ++    +SG EA   AI+LAR +     G DK  I+  
Sbjct: 87  AP--TEMEIKMAELVSELVPSMEQLRMVSSGTEATMSAIRLARGFT----GRDK--ILKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG   + +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTATFNDLDSVRELFAANKGEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + + EG++++C+++G LLIFDEV  G  R        HY ++
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGF-RVALGGAQAHYNIK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   +++V Q   P      A T  GNP+A  A  A +  L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKEVMQYIAPTGPVYQAGTLSGNPVAMAAGYACLTLLRE 317

Query: 302 KGVLENAWQMGEYFKAELTKLAAE--VPLV 329
           +G  +      ++       LAA+  +PLV
Sbjct: 318 EGNEKRLASKTKHLADGFKSLAAQHGIPLV 347


>GSA_PSEU2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  141 bits (355), Expect = 1e-35
 Identities = 103/330 (31%), Positives = 161/330 (48%), Gaps = 31/330 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+      GA+V D D ++Y+D+V       LGH+HP+V +AV  Q++  L      
Sbjct: 30  GGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRSQLEHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E +  +A L+ E     +     +SG EA   AI+LAR +     G D   I+     
Sbjct: 90  AMETE--MADLVCELVPSMEMVRMVSSGTEATMSAIRLARGFT----GRDS--ILKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G      G+     +P  FA     VPFN+L+A+++    +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTLGVPSSPGVPAAFAKHTLTVPFNNLDAVRDLLAEVGQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  YL+G+++LC+E G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGYLQGLRELCDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T  K +GGG P+G    K ++     P      A T  GNPLA  A L T+  + + G 
Sbjct: 261 STFGKIIGGGMPVGCFGGKREIMSHIAPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPGF 320

Query: 305 LENAWQMGEYFKAELTKL-----AAEVPLV 329
            +   ++ +Y +  L  L     AA +P V
Sbjct: 321 HD---ELSDYTRRLLEGLQQRADAAGIPFV 347


>GSA_PSE14 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  141 bits (355), Expect = 1e-35
 Identities = 98/299 (32%), Positives = 147/299 (49%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+      GA+V D D ++Y+D+V       LGH+HPEV +AV  Q++  L      
Sbjct: 30  GGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILGHSHPEVLDAVRSQLEHGLSYGAPT 89

Query: 79  WIEPQVK-LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E ++  L   LV +   +     +SG EA   AI+LAR +     G D   II     
Sbjct: 90  AMETEMADLVCALVPSM--EMVRMVSSGTEATMSAIRLARGFT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G      G+     +P  FA     VPFN+L+A+++    +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTLGVPSSPGVPAAFAKHTLTVPFNNLDAVRDLLAEVGQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  YL+G++ LC+E G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGYLQGLRDLCDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            T  K +GGG P+G    K ++     P      A T  GNPLA  A L T+  + + G
Sbjct: 261 STFGKIIGGGMPVGCFGGKREIMSHIAPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG 319


>GSA_NITSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  141 bits (355), Expect = 1e-35
 Identities = 98/295 (33%), Positives = 152/295 (51%), Gaps = 24/295 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P  + +G+GA+++D DG +Y+D+V        GHA  E  EAVC+Q +  L      
Sbjct: 31  GGVPPFIDRGEGAFLYDIDGNRYIDYVQSWGPLIFGHADKETLEAVCEQAQKGLSFGTPT 90

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E +  LA+ +VE     DK  F +SG EA   AI+LAR Y     G D  +I+     
Sbjct: 91  LLETE--LAREIVELFDNIDKIRFVSSGTEAVMSAIRLARGYT----GRD--DIVKFEGC 142

Query: 138 FHGRT--LATVTATGQTKYQRGLDP-LPQGFA----YVPFNDLEALKNTI--GPHTCAVM 188
           +HG +  L     +G   +     P +P  F        +ND+E++K       +   V+
Sbjct: 143 YHGHSDSLLVSAGSGAATFGNPSSPGVPADFTKHTLLARYNDIESVKRCFQASDNIACVI 202

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHY-GVEPDI 247
           +EP+ G  G++PA + +L+ +++LC+E G LLIFDEV  G   + K  G Q +  V PD+
Sbjct: 203 IEPIAGNMGLVPAEEEFLQDLRKLCDEHGALLIFDEVMSGFRASLK--GAQGFTSVVPDM 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           +T  K +GGG P+GA  A+ ++     P      A T  GNP+A  A L+ +  L
Sbjct: 261 VTFGKVIGGGMPVGAFGARAEIMAHLSPEGPVYQAGTLSGNPVAMVAGLSVIRRL 315


>GSA_HAES2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  141 bits (355), Expect = 1e-35
 Identities = 96/299 (32%), Positives = 149/299 (49%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D +G+QY+D+V       LGH HP +  AV K  +  L      
Sbjct: 30  GGTPVFIEKANGAYIFDIEGKQYIDYVGSWGPMILGHNHPSILSAVLKIAENGLSFGTPT 89

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  ++LA+L+ +     +     NSG EA   AI+LAR Y K+       +I+     
Sbjct: 90  PLE--IELAELICQLVPSIEMVRMVNSGTEATMSAIRLARGYTKRD------KILKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG + + +   G    T  Q     +P+ FA       +N+L+++KN    +      V
Sbjct: 142 YHGHSDSLLVKAGSGSLTLGQPSSPGVPEDFAKHTITCEYNNLQSVKNAFEQYPDQIACV 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    I   Q +L+G++QLC E G L I DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCILPKQDFLQGLRQLCNEYGSLFIIDEVMTGF-RVALGGAQSYYEVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            TL K +GGG P+GA   K+++ Q   P      A T  GNP+A +A +A +  L ++G
Sbjct: 261 TTLGKVIGGGMPVGAFGGKKEIMQYIAPTGPVYQAGTLSGNPIAMSAGIACLNELKKEG 319


>GSA_FUSNN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 434

 Score =  141 bits (355), Expect = 1e-35
 Identities = 90/292 (30%), Positives = 151/292 (51%), Gaps = 25/292 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWI- 80
           P+ + KGQGA +WD D  +Y+D++       LGH HP+V E    +VK ++   + Y + 
Sbjct: 36  PIFIKKGQGAKIWDEDDNEYIDYICSWGPLILGHNHPKVIE----EVKKIIENGSSYGLP 91

Query: 81  -EPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            + +V LA+L+V+     +K     SG EA   A++LAR Y +++      +I+     +
Sbjct: 92  TKYEVDLAELIVDIVPSIEKVRLTTSGTEATMSAVRLARAYTQRN------KILKFEGCY 145

Query: 139 HGRTLATVTATGQTKYQRG-------LDPLPQGFAYVPFNDLEALKNTI-GPHTCAVMLE 190
           HG + A +  +G      G        D + +    +PF D+E +K  +       V++E
Sbjct: 146 HGHSDALLVKSGSGLLTEGYQDSNGITDGVLKDTLTLPFGDIEKVKEILKNKDVACVIVE 205

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P+    G+I   + +L+G+ ++ E+ G +LIFDEV  G  R       + +G+ PD+ TL
Sbjct: 206 PIPANMGLIETHKEFLQGLGKVTEKTGTILIFDEVISGF-RLALGGAQEFFGITPDLTTL 264

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
            K +GGG+P+GA   K+++     P     HA T  GNP+A+ A  AT+  L
Sbjct: 265 GKIIGGGYPVGAFGGKKEIMDLVAPVGRVYHAGTLSGNPIASKAGFATISYL 316


>GSA_DESAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 425

 Score =  141 bits (355), Expect = 1e-35
 Identities = 93/302 (30%), Positives = 150/302 (49%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + +GQG+ ++DADG+QY+D++       LGH HP V +A+  +      C+   
Sbjct: 30  GTDPCFIARGQGSAIFDADGKQYIDYIGSWGPLILGHRHPAVIKAI--EAALANGCTFGA 87

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA+ +V      +     NSG EA   AI+LAR       G D   I+     
Sbjct: 88  PTELEIDLAEAVVNIMPSVEMVRMVNSGTEATMSAIRLARGAT----GRDG--IVKFDGC 141

Query: 138 FHGRTLATVTATGQTKYQRGL-------DPLPQGFAYVPFNDLEALKNTI---GPHTCAV 187
           +HG   + + A G      G+       D + +  A + +N++EA+K      G  T A+
Sbjct: 142 YHGHGDSLLVAAGSGVATLGIPGSPGVPDKVAESTASLEYNNIEAVKEYCKKKGDRTAAI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  GV+     +++G++++C++ G++LI DEV  G  R         YGV PD+
Sbjct: 202 IVEPVAGNMGVVAPKPEFIQGLREVCDQYGIVLILDEVMTGF-RVALGGAQSLYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   K  + +   P      A T  GNP+A  A +AT++ +   G 
Sbjct: 261 TTMGKVIGGGLPVGAYGGKRSLMEKIAPSGPVYQAGTLSGNPMAMAAGIATLKEISAPGF 320

Query: 305 LE 306
            E
Sbjct: 321 YE 322


>GSA2_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 430

 Score =  141 bits (355), Expect = 1e-35
 Identities = 102/318 (32%), Positives = 152/318 (47%), Gaps = 24/318 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ +  G GA + D DG +Y+D+V       LGH HPEV +A+ +            + E
Sbjct: 37  PIFMESGHGAIIKDIDGNEYIDYVLSWGPLILGHTHPEVVKAIAETAAKGSSFGAPTYTE 96

Query: 82  PQVKLAKLLVENSCADKAF-FCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
              +LA+L+++     +   F +SG EA   A+++AR       G DK  I+    S+HG
Sbjct: 97  N--RLAQLVLDRLPGMEMIRFVSSGTEATMSALRVARGVT----GRDK--ILKFEGSYHG 148

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAVMLE 190
              + +   G      GL   P       +    V +NDLE  K      G    AV++E
Sbjct: 149 HGDSLLIKAGSGVATLGLPDSPGVPADVARNTLTVAYNDLEGAKAVFEKFGAELAAVIVE 208

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  GV+P    +LEG+++L    G LLIFDEV  G  R        ++GV PDI TL
Sbjct: 209 PVAGNMGVVPPQSGFLEGLRELTSTHGSLLIFDEVMTGF-RVDYGCAQGYFGVTPDITTL 267

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA    +++ +   P      A T  GNPLA TA   T+ + L +   E+
Sbjct: 268 GKVIGGGLPVGAFAGTKKIMEQVAPAGPIYQAGTLSGNPLAMTAGYETL-SRLDRSTYEH 326

Query: 308 AWQMGEYFKAELTKLAAE 325
             Q+G+  +A   + A +
Sbjct: 327 FKQLGDQLEAGFREAATK 344


>GSA2_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  141 bits (355), Expect = 1e-35
 Identities = 101/320 (31%), Positives = 155/320 (48%), Gaps = 28/320 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSNIYW 79
           P+ + +G+GA ++D DG +Y+D+V       LGHA  +V E + +  +  T     +   
Sbjct: 36  PVFMERGKGANIYDIDGNEYIDYVLSWGPLILGHADDQVVEKLKETTEKGTSFGAPS--- 92

Query: 80  IEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E + KLA+L++E     +     NSG EA   A++LAR Y  ++      +I+     +
Sbjct: 93  -ELETKLAELVIERVPSIEVVRMVNSGTEATMSALRLARGYTGRN------KILKFEGCY 145

Query: 139 HGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAVM 188
           HG   + +   G      GL   P       Q    VP+NDLE+++      G     V+
Sbjct: 146 HGHGDSLLIKAGSGVATLGLPDSPGVPETVAQNTLTVPYNDLESVRYAFEQFGDDLAGVI 205

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EPV G  GV+P    +LE +++L EE G LLIFDEV  G  R G       +G+ PD+ 
Sbjct: 206 VEPVAGNMGVVPPEPGFLEELRRLTEENGTLLIFDEVMTGF-RVGYHCAQGAFGITPDLT 264

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVL 305
            L K +GGG P+GA   K ++ +   P      A T  GNPLA TA   T+  L +    
Sbjct: 265 CLGKVIGGGLPVGAYGGKREIMEQIAPSGPIYQAGTLSGNPLAMTAGYETLVQLTEAN-Y 323

Query: 306 ENAWQMGEYFKAELTKLAAE 325
           E   ++G+     L+ +A E
Sbjct: 324 EYFDRLGDRLAEGLSAVAKE 343


>ECTB_MARHA RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 427

 Score =  141 bits (355), Expect = 1e-35
 Identities = 105/404 (25%), Positives = 185/404 (45%), Gaps = 44/404 (10%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P    + +G  +WD DG++Y+DF SG      GH      E + +++ T +    +    
Sbjct: 24  PTVFHQAKGYKLWDLDGKEYVDFFSGAGALNYGHND----ENMKQKLLTYIQEDGVTHSL 79

Query: 82  PQVKLAK----------LLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYE 130
                AK          +L   +   K  F   +GA + E A+KLARK         +  
Sbjct: 80  DMATKAKGEFIDAFQNIILKPRNMDYKIMFPGPTGANSVESALKLARKVT------GRTN 133

Query: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPF--------NDLEALKNTIG- 181
           +++ TN FHG T+  ++ TG    + G        + +P+        N +E ++N +  
Sbjct: 134 VVSFTNGFHGMTIGALSVTGNKFKRNGAGMPLSNTSTLPYDQFLKESNNSIEYIENFLDN 193

Query: 182 -----PHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFL 236
                    A ++E VQGEGG+  A+  +L  ++++C E+ + LI D+VQ G+GRTG F 
Sbjct: 194 GGSGLDKPAAFIVETVQGEGGLNAASSEWLRSIEKICRERDIKLILDDVQAGVGRTGTFF 253

Query: 237 GYQHYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLAT 295
            ++  G++PD + L+K++GG G P+   L   +    F PG+H  TF GN  A       
Sbjct: 254 SFEPAGIKPDFVCLSKSIGGNGSPLAITLVAPEY-DKFAPGEHNGTFRGNNFAFVTGTEA 312

Query: 296 M----ETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDIV 351
           +    +  L+K V E + ++   F  ++ K   E+  V++ R               +I 
Sbjct: 313 LNYWKDDRLEKNVQEKSERITS-FLDDMIKKHPEMKGVRKGRGFMQGIMSPIEDLADNIA 371

Query: 352 AHCLEQGLLINCTNG--NVLRFLPPLIITKDEIDQAVQILKRAM 393
             C E GL++        V +  PP+ I  + +++ + IL++A+
Sbjct: 372 GRCFEHGLIMETAGAEDEVFKLFPPITIDDEGLERGLSILQQAI 415


>GSA_SYNSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  140 bits (354), Expect = 1e-35
 Identities = 97/302 (32%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 32  GGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVIAALQEAIEKGTSFGAPC 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA+++++     +   F NSG EA    ++L R Y     G DK  +I     
Sbjct: 92  ALENT--LAEMVIDAVPSVEMVRFVNSGTEACMAVLRLIRAYT----GRDK--VIKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 144 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLEAVKALFAENPEAIAGV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L +E G LL+FDEV  G  R        H+GV PD+
Sbjct: 204 ILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDEVMTGF-RISYGGAQAHFGVTPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   +  +     P      A T  GNPLA TA + T+E L Q G 
Sbjct: 263 TTMGKVIGGGLPVGAYGGRADIMGMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKQPGT 322

Query: 305 LE 306
            E
Sbjct: 323 YE 324


>GSA_HERA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  140 bits (354), Expect = 1e-35
 Identities = 98/302 (32%), Positives = 143/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G +P  +  G GA+++D DG QY+D+V       LGHA+P V EA+C Q +     S   
Sbjct: 32  GGVPRFIDHGAGAYLYDIDGNQYIDYVLSWGPLILGHAYPAVVEAICAQAQR--GTSFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E + +LA+L++      +   F +SG EA   AI+LAR Y ++       +II     
Sbjct: 90  PTELESELAELVIAAVPSVEMVRFVSSGTEAAMSAIRLARAYTQRE------KIIKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAV 187
           +HG     +   G      GL   P             PFNDLEA++           A+
Sbjct: 144 YHGHADPFLVQAGSGVATLGLPDSPGVLKSATSNTLTAPFNDLEAVEALFKANAGQVAAL 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G +   + YL G++QLC++ G LLIFDEV  G  R        ++ V PD+
Sbjct: 204 VIEPVAGNMGFVLPREGYLAGLRQLCDQYGALLIFDEVMTGF-RVAYGGAQAYFNVMPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P  A   + ++ Q   P      A T  GNPLA  A + T+  + +  V
Sbjct: 263 TCLGKVVGGGLPAAAYGGRREIMQMVAPAGTMYQAGTLSGNPLAMVAGIVTLREIAKPEV 322

Query: 305 LE 306
            E
Sbjct: 323 FE 324


>GSA_CLOK5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 422

 Score =  140 bits (354), Expect = 1e-35
 Identities = 98/296 (33%), Positives = 146/296 (49%), Gaps = 31/296 (10%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P  + KG+GA+++D DG +Y+DFV       LGH   +V  A+    +  +       IE
Sbjct: 32  PPVIKKGRGAYIYDEDGNEYIDFVCSWGPMILGHCDEDVVNAIKYTSENAISFGATTKIE 91

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
             ++L+K +       +     NSG EA   A+KLAR Y +++      +II  +  +HG
Sbjct: 92  --LELSKYICTTMDNIEMIRMVNSGTEATMSAVKLARGYTRRN------KIIKFSGCYHG 143

Query: 141 RTLATVTATGQTKYQRGLDPLPQGFAYVP-----------FNDLEALKNTI---GPHTCA 186
                +   G      G+     G A VP           +N+LE +KN     G  T A
Sbjct: 144 HFDDFLVEAGSGVMTEGIP----GSAGVPKDSIKNTIIAEYNNLEDVKNIFNKYGSDTAA 199

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           +++EPV G  GVIP    +L+G+++LC+E G LLIFDEV  G  R         YG++PD
Sbjct: 200 IIVEPVAGNMGVIPGRIDFLKGLRKLCDEYGSLLIFDEVMSGF-RVAYKGAQSLYGIKPD 258

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           I T+AK +GGG P GA   ++ + +   P      A T  GNP+   A LAT++ L
Sbjct: 259 ITTMAKIMGGGLPCGAYGGRKDIMENLSPLGPVYQAGTMSGNPIVMAAGLATLKKL 314


>GSA_CLOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 422

 Score =  140 bits (354), Expect = 1e-35
 Identities = 98/296 (33%), Positives = 146/296 (49%), Gaps = 31/296 (10%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P  + KG+GA+++D DG +Y+DFV       LGH   +V  A+    +  +       IE
Sbjct: 32  PPVIKKGRGAYIYDEDGNEYIDFVCSWGPMILGHCDEDVVNAIKYTSENAISFGATTKIE 91

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
             ++L+K +       +     NSG EA   A+KLAR Y +++      +II  +  +HG
Sbjct: 92  --LELSKYICTTMDNIEMIRMVNSGTEATMSAVKLARGYTRRN------KIIKFSGCYHG 143

Query: 141 RTLATVTATGQTKYQRGLDPLPQGFAYVP-----------FNDLEALKNTI---GPHTCA 186
                +   G      G+     G A VP           +N+LE +KN     G  T A
Sbjct: 144 HFDDFLVEAGSGVMTEGIP----GSAGVPKDSIKNTIIAEYNNLEDVKNIFNKYGSDTAA 199

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           +++EPV G  GVIP    +L+G+++LC+E G LLIFDEV  G  R         YG++PD
Sbjct: 200 IIVEPVAGNMGVIPGRIDFLKGLRKLCDEYGSLLIFDEVMSGF-RVAYKGAQSLYGIKPD 258

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           I T+AK +GGG P GA   ++ + +   P      A T  GNP+   A LAT++ L
Sbjct: 259 ITTMAKIMGGGLPCGAYGGRKDIMENLSPLGPVYQAGTMSGNPIVMAAGLATLKKL 314


>ECTB_BACHD RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 427

 Score =  140 bits (354), Expect = 1e-35
 Identities = 108/403 (26%), Positives = 191/403 (47%), Gaps = 42/403 (10%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P    K +G  +WD  G++Y+DF SG      GH   ++ +A+   +    + H  ++  
Sbjct: 24  PTVFTKAKGYKMWDEAGKEYIDFFSGAGALNYGHNDEKMKKALVDYIMDDGITHSLDMAT 83

Query: 80  IEPQVKLAK----LLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                 L K    +L   +   K  F   +G    E A+KLARK         + +II+ 
Sbjct: 84  TPKGKFLQKFHDVILKPRNLDYKVMFPGPTGTNTVESALKLARKVT------GRTDIISF 137

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFND-----------LEALKNTIGPH 183
           TN FHG T+ +++ TG +  ++G          +P+++           LE      G  
Sbjct: 138 TNGFHGMTIGSLSVTGNSFKRKGAGIPLTNVVTMPYDNFVSESLDTLDYLERFLEDGGSG 197

Query: 184 T---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
                A++LE VQGEGG+  A   +L+ V+++C+  G+LLI D+VQ G+GRTG F  ++ 
Sbjct: 198 VEIPAAMILETVQGEGGINAARTEWLQRVEKICKRWGILLIIDDVQAGVGRTGTFFSFED 257

Query: 241 YGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNP---LAATASLATM 296
            G+ PDI+ L+K++GG G P+   L + ++   + PG+H  TF GN    + AT +L+  
Sbjct: 258 AGITPDIVCLSKSIGGFGLPLAITLFRPEL-DIWAPGEHNGTFRGNNHAFVTATEALSYW 316

Query: 297 E-TLLQKGVLENAWQMGEYFKAELTKLAAEVPLVK---EVRXXXXXXXXXXXXXXKDIVA 352
           E    +K + E +  + ++    L KL  E P +K   + +                +  
Sbjct: 317 EDDSFEKDIQEKSATISDF----LVKLVTEYPEIKGEVKGKGFMVGIASDVEGFASKVTE 372

Query: 353 HCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
               +GL++  +  N  V +  PPL I  + +++ + I++ ++
Sbjct: 373 EAFSRGLIMETSGPNDEVFKLFPPLTIDDEGLEKGLAIIEESI 415


>GSA_VIBCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  140 bits (353), Expect = 2e-35
 Identities = 97/302 (32%), Positives = 148/302 (49%), Gaps = 23/302 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA ++DADG+ Y+D+V       LGH H  + EAV +  +  L   
Sbjct: 27  NGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIQAAQRGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++ +A+L+ E     ++    NSG EA   AI+LAR Y     G DK  II  
Sbjct: 87  AP--TEMEITMAELVSELVPSMEQLRMVNSGTEATMSAIRLARGYT----GRDK--IIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG   + +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTARFNDLDSVRELFAANQGEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + + EG++++C+++G LLIFDEV  G  R        HY ++
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGF-RVALGGAQAHYNIK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   + +V Q   P      A T  GNP+A  A  A +  L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRREVMQYIAPTGPVYQAGTLSGNPIAMAAGYACLNLLRE 317

Query: 302 KG 303
           +G
Sbjct: 318 EG 319


>GSA_VIBCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  140 bits (353), Expect = 2e-35
 Identities = 97/302 (32%), Positives = 148/302 (49%), Gaps = 23/302 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA ++DADG+ Y+D+V       LGH H  + EAV +  +  L   
Sbjct: 27  NGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIQAAQRGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++ +A+L+ E     ++    NSG EA   AI+LAR Y     G DK  II  
Sbjct: 87  AP--TEMEITMAELVSELVPSMEQLRMVNSGTEATMSAIRLARGYT----GRDK--IIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG   + +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTARFNDLDSVRELFAANQGEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + + EG++++C+++G LLIFDEV  G  R        HY ++
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGF-RVALGGAQAHYNIK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   + +V Q   P      A T  GNP+A  A  A +  L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRREVMQYIAPTGPVYQAGTLSGNPIAMAAGYACLNLLRE 317

Query: 302 KG 303
           +G
Sbjct: 318 EG 319


>GSA_VIBC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  140 bits (353), Expect = 2e-35
 Identities = 97/302 (32%), Positives = 148/302 (49%), Gaps = 23/302 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA ++DADG+ Y+D+V       LGH H  + EAV +  +  L   
Sbjct: 27  NGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILGHNHAVIREAVIQAAQRGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++ +A+L+ E     ++    NSG EA   AI+LAR Y     G DK  II  
Sbjct: 87  AP--TEMEITMAELVSELVPSMEQLRMVNSGTEATMSAIRLARGYT----GRDK--IIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG   + +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTARFNDLDSVRELFAANQGEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + + EG++++C+++G LLIFDEV  G  R        HY ++
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGF-RVALGGAQAHYNIK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   + +V Q   P      A T  GNP+A  A  A +  L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRREVMQYIAPTGPVYQAGTLSGNPIAMAAGYACLNLLRE 317

Query: 302 KG 303
           +G
Sbjct: 318 EG 319


>GSA_SULSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  140 bits (353), Expect = 2e-35
 Identities = 100/324 (30%), Positives = 160/324 (49%), Gaps = 25/324 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + KG+G  +WD D  +Y+D+V       LGHAH +V  A+ KQ+      S     E
Sbjct: 35  PIFIKKGKGCRIWDVDDNEYIDYVLSWGPLILGHAHDQVINAI-KQISN-YGTSFGAPTE 92

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +V++AK +++     +   F NSG EA   AI+LAR Y K      + +II     +HG
Sbjct: 93  LEVEMAKAVIDAVKSVEMVRFVNSGTEATMSAIRLARGYTK------RKKIIKFDGCYHG 146

Query: 141 RTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTI---GPHTCAVMLE 190
              + + + G    T    G   +P+  A     +P+N++EA++      G     V++E
Sbjct: 147 HGDSLLVSAGSGVATLGIPGTPGIPEELASLTIVLPYNNIEAVEEAFEKYGDDIACVIIE 206

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  GV+  ++ Y + ++++  + G LLIFDEV  G  R       + Y +EPD+ T 
Sbjct: 207 PVAGNMGVVAPSKEYHQKLREITRKYGALLIFDEVMTGF-RLSYGGAQELYDIEPDLTTF 265

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA   K ++ +   P      A T  GNPLA  A L  ++ L Q    + 
Sbjct: 266 GKVIGGGLPVGAYGGKGEIMEYVAPVGPVYQAGTLSGNPLAMAAGLTQLQLLKQLNPYQE 325

Query: 308 AWQMGEYFKAELTKLAAE--VPLV 329
             + G + +    K++ E  VP+V
Sbjct: 326 LNEKGRFLEEGFKKISQETGVPVV 349


>GSA_DESPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  140 bits (353), Expect = 2e-35
 Identities = 95/321 (29%), Positives = 156/321 (48%), Gaps = 23/321 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + + +G++++DADG++YLDFV+      +GHAHP++ +A+  Q   +   S      
Sbjct: 35  PLFIERAEGSYIYDADGQKYLDFVNSWGPMIMGHAHPDIIKAI--QDAAVYGTSYGAPTS 92

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +V LA ++VE     +K  F +SG EA   A++LAR Y  +++      I+     +HG
Sbjct: 93  SEVDLASMVVEAVPSIEKVRFVSSGTEATMSAVRLARGYTGKNV------IVKFDGCYHG 146

Query: 141 RTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGP---HTCAVMLE 190
              + +   G      G+   P       +    +P+N +EAL+ T+     +   V++E
Sbjct: 147 HADSFLVKAGSGVLTLGIPGSPGVPEDIVKNTISIPYNSVEALETTLRDADLNIACVIVE 206

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  G +P A  +L+ ++++  E+G++LIFDEV  G  R       Q+YGV PD+  L
Sbjct: 207 PVAGNMGCVPPAPGFLQKLREITAEEGIVLIFDEVITGF-RLSYGGAQQYYGVTPDLTCL 265

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA   K  +  +  P      A T  GNP              Q G  E+
Sbjct: 266 GKIIGGGLPVGAYGGKADIMNSVAPDGPVYQAGTLSGNPXXXXXXXXXXXXXQQDGFYED 325

Query: 308 AWQMGEYFKAELTKLAAEVPL 328
             Q    +   L ++A  V L
Sbjct: 326 LNQKSAAYADGLLEVAGRVGL 346


>GSA_CHLPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  140 bits (353), Expect = 2e-35
 Identities = 101/298 (33%), Positives = 147/298 (49%), Gaps = 22/298 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG+GA++ D DG  YLD+V       LG  HP +  A+   +K +   S   
Sbjct: 33  GGTPIYMAKGRGAYLTDVDGNSYLDYVGSWGPFILGSMHPRITAALEYTLKNI-GTSFGT 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE ++++A+LL +     +     NSG EA   A++LAR Y     G DK  II     
Sbjct: 92  PIEMEIEIAELLCKIVPSLEMVRMVNSGTEATMSAVRLARGYT----GRDK--IIKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP---QGFAY----VPFNDLEALKNTIGPHTCAVMLE 190
           +HG   + +   G      G    P   +G A       +ND+E++K  +          
Sbjct: 146 YHGHGDSFLIKAGSGALTLGAPDSPGVTKGTALDTLNATYNDIESVKLLVXXXXXXXXXX 205

Query: 191 ---PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
              PV G  GVIPA   +L  ++ LC++ G++LIFDEV CG  R         YGV PD+
Sbjct: 206 XXXPVAGNTGVIPAKPGFLADLRNLCDQNGIVLIFDEVMCGF-RVALGGAQSLYGVTPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETLLQK 302
            T+ K +GGG P+GA   K ++ +   P GD   A T  GNPLA TA L T++ L+ +
Sbjct: 265 TTMGKIIGGGLPVGAFGGKRKIMERVAPLGDVYQAGTLSGNPLALTAGLETLKILMDE 322


>ECTB_STRCO RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 423

 Score =  140 bits (353), Expect = 2e-35
 Identities = 117/402 (29%), Positives = 188/402 (46%), Gaps = 38/402 (9%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--LLHCSNIYW 79
           P    +  G+ ++D DG +YLDF +G      GH +  +  A+   ++   + H  ++  
Sbjct: 26  PTVFDRAVGSRMYDEDGHEYLDFFAGAGSLNYGHNNAVLKRALIDYLERDGVTHGLDMST 85

Query: 80  IEPQVKLAK----LLVENSCADKAFFCN-SGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
              +  L      +L       K  F   +G  A E A+KLARK   +        I++ 
Sbjct: 86  TAKRRFLETFQNTILRPRDLPYKVMFPGPTGTNAVESALKLARKVKGRE------SIVSF 139

Query: 135 TNSFHGRTLATVTATGQTKYQRGLD-PLPQGFAYVPFND-----------LEALKNTIGP 182
           TN+FHG +L ++  TG    + G   PL  G   +PF++            E L    G 
Sbjct: 140 TNAFHGMSLGSLAVTGNAFKRAGAGIPLVHGTP-MPFDNYFDGTVEDFIWFERLLEDQGS 198

Query: 183 ---HTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQ 239
                 AV++E VQGEGG+  A   +L  +  LCE + +LLI D++Q G GRTG F  ++
Sbjct: 199 GLNKPAAVIVETVQGEGGINVARAEWLRALADLCERQDMLLIVDDIQMGCGRTGAFFSFE 258

Query: 240 HYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMET 298
             G+ PDI+T++K++ G G P+   L K ++   ++PG+H  TF GN  A   + AT+E 
Sbjct: 259 EAGITPDIVTVSKSISGYGMPMALTLFKPEL-DVWEPGEHNGTFRGNNPAFVTATATLEA 317

Query: 299 LLQKG--VLENAWQMGEYFKAELTKLAAE-VPLVKEVRXXXXXXXXXXXXXXK--DIVAH 353
               G  + +   + GE  +  +  +  E +  VKE R              +   +   
Sbjct: 318 YWADGSAMEKQTRKRGEQVEQHMIAITEENLADVKEYRGRGLVWGLEFHDKDRAGRVAKR 377

Query: 354 CLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
             E GLLI  +     V++ LP L IT DE+D+ ++ L RA+
Sbjct: 378 AFELGLLIETSGPESEVVKLLPALTITPDELDEGMKTLARAV 419


>GSA_TOLAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  140 bits (352), Expect = 2e-35
 Identities = 103/324 (31%), Positives = 151/324 (46%), Gaps = 27/324 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P  + K  GA+++D DG +Y+D+V       LGH HP +  AV   V+  L   
Sbjct: 31  NGVGGTPRFIAKADGAYLFDVDGNRYIDYVGSWGPMLLGHNHPAIKAAVLAAVENGLSYG 90

Query: 76  NIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V +A+++ +     +     NSG EA   AI+LAR Y     G DK  I+  
Sbjct: 91  AP--TESEVLMAEMIRQIMPDMEMVRMVNSGTEATMSAIRLARGYT----GRDK--IVKF 142

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTI---GPHT 184
              +HG     +   G    T  Q     +P  FA       +NDL +++ T    G   
Sbjct: 143 EGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVEATFASYGSEI 202

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP    +LEG++ +C++ G LLI DEV  G  R        +YG+ 
Sbjct: 203 ACIIVEPVAGNMNCIPPVPGFLEGLRAICDKYGALLIIDEVMTGF-RVSLQGAQGYYGIT 261

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   K+++     P      A T  GNP+A  A LA ++ + Q
Sbjct: 262 PDLTTLGKIIGGGMPVGAFGGKKEIMAYIAPTGPVYQAGTLSGNPVAMAAGLAMLKAIQQ 321

Query: 302 KG----VLENAWQMGEYFKAELTK 321
            G    + E   Q+ E  KA   K
Sbjct: 322 PGLYDTLAEKTRQVAEGLKAAAAK 345


>GSA_KLEP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  140 bits (352), Expect = 2e-35
 Identities = 106/327 (32%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +  GA+++D DG+ Y+D+V       LGH HP +  AV +     L      
Sbjct: 30  GGTPLFIERADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAASRGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAALVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCIPPQPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQAYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRREVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LENAWQMGEYFKAELTKLA--AEVPLV 329
            E   ++       L   A  A +PLV
Sbjct: 321 HETLTELTNQLAQGLLDAARDAGIPLV 347


>GSA_BORPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  140 bits (352), Expect = 2e-35
 Identities = 103/303 (33%), Positives = 148/303 (48%), Gaps = 25/303 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + + QG +VWDA+G+QY+D+V       LGHAHPEV  AV  Q   +   S   
Sbjct: 30  GGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILGHAHPEVVRAV--QEAAVHGLSFGA 87

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +V+LA++L+      ++    +SG EA   AI+LAR    +H      +II     
Sbjct: 88  PTEAEVELAEMLIARLPSLEQVRLVSSGTEATMTAIRLARGATGRH------KIIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP----LPQGFAY----VPFNDLEALKNTIGPH---TCA 186
           +HG + + +   G      G +P    +P  F      + FN+L A+      H      
Sbjct: 142 YHGHSDSLLVKAGSGLLTFG-NPSSAGVPPEFVAHTLPLEFNNLAAVDAAFSQHGAEIAC 200

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EPV G   +I  A+ +L G+++LC   G +LIFDEV  G  R G        GV PD
Sbjct: 201 VIVEPVAGNMNLIKPAEGFLAGLRELCTRHGAVLIFDEVMTGF-RVGPQGVQGLTGVRPD 259

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           + TLAK +GGG P+GA   +  +     P      A T  GNP+A  A LATM  + + G
Sbjct: 260 LTTLAKVIGGGMPVGAFGGRADLMAHITPLGGVYQAGTLSGNPVAVAAGLATMRLIGEPG 319

Query: 304 VLE 306
             E
Sbjct: 320 FYE 322


>GSA_BORBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  140 bits (352), Expect = 2e-35
 Identities = 102/303 (33%), Positives = 146/303 (48%), Gaps = 25/303 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + + QG +VWDA+G+QY+D+V       LGHAHPEV  AV  Q   +   S   
Sbjct: 30  GGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILGHAHPEVVRAV--QEAAVHGLSFGA 87

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +V+LA++L+      ++    +SG EA   AI+LAR    +H      +II     
Sbjct: 88  PTEAEVELAEMLIARLPSLEQVRLVSSGTEATMTAIRLARGATGRH------KIIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGF--------AYVPFNDLEALKNTIGPH---TCA 186
           +HG + + +   G      G +P   G           + FN+L A+      H      
Sbjct: 142 YHGHSDSLLVKAGSGLLTFG-NPSSAGVPPEFVAHTLTLEFNNLAAVDAAFSQHGAEIAC 200

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EPV G   +I  A+ +L G+++LC   G +LIFDEV  G  R G        GV PD
Sbjct: 201 VIVEPVAGNMNLIKPAEGFLAGLRELCTRHGAVLIFDEVMTGF-RVGPQGVQGLTGVRPD 259

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           + TLAK +GGG P+GA   +  +     P      A T  GNP+A  A LATM  + + G
Sbjct: 260 LTTLAKVIGGGMPVGAFGGRADLMAHIAPLGGVYQAGTLSGNPVAVAAGLATMRLIGEPG 319

Query: 304 VLE 306
             E
Sbjct: 320 FYE 322


>GSA_ANATD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  140 bits (352), Expect = 2e-35
 Identities = 91/288 (31%), Positives = 147/288 (51%), Gaps = 19/288 (6%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P  + KG+G  ++D DG +Y+DFV       LGH  P+V   + + V+  +       IE
Sbjct: 35  PPVISKGKGCRIFDIDGNEYIDFVLSWGAMILGHCDPDVVNRMKEVVEDQIAFGAPTEIE 94

Query: 82  PQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGR 141
              K+AKL+ E +  D   F NSG EA   A++LA+ Y        K +I+     +HG 
Sbjct: 95  --YKMAKLVCETAQIDMVRFVNSGTEATMTAVRLAKGYT------GKKKIVKFAGCYHGH 146

Query: 142 ----TLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHT---CAVMLEPVQG 194
                    +A  + + +R  + + Q    V +N+L++++     +     AV++EPV G
Sbjct: 147 HDIFLKEAGSAVAELRLKRIDEDIVQNTIVVEYNNLDSVEKAFKENKDEIAAVIIEPVAG 206

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GV+PA + +L+ ++++C   G LLIFDEV  G  R         Y VEPD++T  K +
Sbjct: 207 NMGVVPAKKEFLQVLREICNLHGSLLIFDEVITGF-RLSLKGARALYNVEPDLVTFGKII 265

Query: 255 GGGFPIGAMLAKEQVAQAFQPGDH---ASTFGGNPLAATASLATMETL 299
           GGG P GA+  K+++ +   P  +   A T  GNP+  +A  AT++ L
Sbjct: 266 GGGLPCGAVGGKKEIMECLAPQGNVFQAGTMSGNPIVMSAGYATIKKL 313


>GSA2_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  140 bits (352), Expect = 2e-35
 Identities = 99/319 (31%), Positives = 159/319 (49%), Gaps = 28/319 (8%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSNIYW 79
           P+ + +G+G+ ++D DG +Y+D+V       LGH +  V E++ K  +  T    S    
Sbjct: 36  PIFMQRGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAENGTSFGAST--- 92

Query: 80  IEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
            E + +LAKL+++     +     +SG EA   A++LAR Y  ++      +I+     +
Sbjct: 93  -EVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRN------KILKFEGCY 145

Query: 139 HGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVM 188
           HG   + +   G      GL     +P+G A     VP+NDLE++       G     V+
Sbjct: 146 HGHGDSLLIKAGSGVATLGLPDSPGVPEGIAMNTITVPYNDLESVALAFREYGEDIAGVI 205

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           +EPV G  GV+P  + +L+G++ + E+ G LLIFDEV  G  R        ++GV PD+ 
Sbjct: 206 VEPVAGNMGVVPPQEGFLQGLRDMTEQYGALLIFDEVMTGF-RVDYNCAQGYFGVTPDLT 264

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVL 305
            L K +GGG P+GA   K  + +   P      A T  GNPLA TA L T++ L  +   
Sbjct: 265 CLGKVIGGGLPVGAYGGKADIMERIAPSGPIYQAGTLSGNPLAMTAGLETLQQLTPESYQ 324

Query: 306 ENAWQMGEYFKAELTKLAA 324
           E   + G+  +  ++K AA
Sbjct: 325 EFV-KKGDMLEEGISKAAA 342


>GSA_SYNPX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  139 bits (351), Expect = 3e-35
 Identities = 100/324 (30%), Positives = 147/324 (45%), Gaps = 23/324 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +G + WD DG +Y+D++        GHAHPEV  A+ + ++         
Sbjct: 32  GGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICGHAHPEVISALQEAIEKGTSFGAPC 91

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA+++++     +   F NSG EA    ++L R +     G DK  +I     
Sbjct: 92  ALENT--LAEMVIDAVPSVEMVRFVNSGTEACMAVLRLMRAFT----GRDK--VIKFEGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHTCA---V 187
           +HG     +   G      GL   P             P+NDLEA+K     +  A   V
Sbjct: 144 YHGHADMFLVKAGSGVATLGLPDSPGVPRSTTANTLTAPYNDLEAVKALFAENPDAIAGV 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEP+ G  G I     +LEG+++L +E G LL+FDEV  G  R        H+GV PD+
Sbjct: 204 ILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDEVMTGF-RISYGGAQAHFGVTPDL 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   +  +     P      A T  GNPLA TA + T+E L Q G 
Sbjct: 263 TTMGKVIGGGLPVGAYGGRADIMGMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKQPGS 322

Query: 305 LENAWQMGEYFKAELTKLAAEVPL 328
            E      E   A + + A    L
Sbjct: 323 YEKLTATTEKLIAGIKEAATAAGL 346


>GSA_MANSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  139 bits (351), Expect = 3e-35
 Identities = 97/309 (31%), Positives = 147/309 (47%), Gaps = 23/309 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K +GA++WD D +QY+D+V       LGH HP +  AV K  +  L      
Sbjct: 30  GGTPVFIQKAKGAYIWDTDDKQYVDYVGSWGPMILGHNHPAILSAVIKTAENGLSFGAPT 89

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE  + LA+L+ +     +     +SG EA   AI+LAR Y       ++ +II     
Sbjct: 90  PIE--IDLAELVCKLIPSMEMVRMVSSGTEATMSAIRLARGYT------NRDKIIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG   + +   G    T  Q     +P  FA       +NDLE++K     +      +
Sbjct: 142 YHGHADSLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLESVKQAFEQYPQDIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L+G+++LC + G + I DEV  G  R        +Y VEPD+
Sbjct: 202 IVEPVAGNMNCVPPQNNFLQGLRELCNQYGAVFIIDEVMTGF-RVALGGAQSYYNVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   K+++ Q   P      A T  GNP+A  A LA +  L + G 
Sbjct: 261 TCLGKVIGGGMPVGAFGGKKEIMQFIAPTGPVYQAGTLSGNPIAMAAGLACLTELQKAGN 320

Query: 305 LENAWQMGE 313
            E   Q+ E
Sbjct: 321 QERLAQLTE 329


>GSA_GEOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  139 bits (351), Expect = 3e-35
 Identities = 93/321 (28%), Positives = 154/321 (47%), Gaps = 23/321 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  G  ++D DG  ++D+V       LGH HP+V  A+   V      S   
Sbjct: 32  GSDPLFIKKAAGPRIYDEDGNAFIDYVGSWGPMILGHCHPQVVSAIKAAVDN--GASFGA 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA+++++     +     +SG EA   AI+LAR Y     G D   I+  +  
Sbjct: 90  PTELEITLAEMVIDAVPSIEMVRMVSSGTEATMSAIRLARGYT----GRDN--ILKFSGC 143

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHT---CAV 187
           +HG + + +   G      G+   P       +      +NDL++++  +  +      +
Sbjct: 144 YHGHSDSLLVKAGSGAATFGVPDSPGVPADLAKHTLTATYNDLDSVRALVAANKGSIACI 203

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G  G +P  + +LEG++ +C E+G++LIFDEV  G  R       + YGV PD+
Sbjct: 204 IVEPVAGNMGTVPPKEGFLEGLRSICSEEGIVLIFDEVMSGF-RVAYGGVQELYGVTPDM 262

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++     P      A T  GNPLA TA + T++ L Q G 
Sbjct: 263 TTLGKIIGGGLPVGAFGGKKEIMSLLSPAGGVYQAGTLSGNPLAMTAGIETLKLLKQPGF 322

Query: 305 LENAWQMGEYFKAELTKLAAE 325
            +   +   +    + K A +
Sbjct: 323 YQKLEEKSAFVAEGIAKAAKD 343


>GSA_CYAP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  139 bits (351), Expect = 3e-35
 Identities = 100/324 (30%), Positives = 153/324 (47%), Gaps = 29/324 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +GA++WD DG QY+D+V        GHAHP+V  A+ + ++         
Sbjct: 38  GGQPIVFDRVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPDVIAALHEALE-----KGTS 92

Query: 79  WIEPQVK---LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
           +  P V+   LA++++E     +   F NSG EA    ++L R +        + +II  
Sbjct: 93  FGAPSVQENILAEMVIEAVPSIEMVRFVNSGTEACMSVLRLMRAFT------GREKIIKF 146

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP------QGFAY-VPFNDLEALKNTIGPH---T 184
              +HG     +   G      GL   P        F    P+NDLEA+K     +    
Sbjct: 147 EGCYHGHADMFLVKAGSGVATLGLPDSPGVPKATTSFTLTAPYNDLEAVKALFAENPDDI 206

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             V+LEPV G  G +     +LEG+++L +E G LL+FDEV  G  R       + +GV 
Sbjct: 207 AGVILEPVVGNSGFVLPDAGFLEGLRELTKEYGALLMFDEVMTGF-RLAYGGAQEKFGVT 265

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++ + +   P      A T  GNPLA TA + T+E L +
Sbjct: 266 PDLTTLGKVIGGGLPVGAYGGRQDIMEMVAPSGPMYQAGTLSGNPLAMTAGIKTLELLQK 325

Query: 302 KGVLENAWQMGEYFKAELTKLAAE 325
            G  +    + +     L KLA +
Sbjct: 326 PGTYDYLNDITQKLADGLLKLAQD 349


>GSA_CYAA5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  139 bits (351), Expect = 3e-35
 Identities = 101/321 (31%), Positives = 146/321 (45%), Gaps = 23/321 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA++WD DG QY+D+V        GHAHPEV  A+   +          
Sbjct: 38  GGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVIAALHDALDRGTSFGAPC 97

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA+++++     +   F NSG EA    ++L R +     G DK  II     
Sbjct: 98  LLEN--VLAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAFT----GRDK--IIKFQGC 149

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G      GL   P             P+NDLEA+K     +      V
Sbjct: 150 YHGHADMFLVQAGSGVATLGLPDSPGVPKTTTANTLTAPYNDLEAVKALFAENPDEIAGV 209

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G +     +L+G+++L  E G LL+FDEV  G  R       + +GV PD+
Sbjct: 210 ILEPVVGNSGFVVPDGGFLQGLRELTNEYGALLVFDEVMTGF-RLSYGGAQEKFGVTPDL 268

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   ++ +     P      A T  GNPLA TA + T+E L + G 
Sbjct: 269 TTLGKVIGGGLPVGAYGGRKDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLQKPGT 328

Query: 305 LENAWQMGEYFKAELTKLAAE 325
                Q+ +     L K+A E
Sbjct: 329 YNQLEQITQQLSEGLLKIAKE 349


>GSA_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  139 bits (351), Expect = 3e-35
 Identities = 98/316 (31%), Positives = 160/316 (50%), Gaps = 24/316 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + +G+G+ ++D DG +Y+D+V       LGH +  V E++ K  +     S     E
Sbjct: 36  PIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAE--YGTSFGAPTE 93

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            + +LAKL+++     +     +SG EA   A++LAR Y  ++      +I+     +HG
Sbjct: 94  VENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRN------KILKFEGCYHG 147

Query: 141 RTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVMLE 190
              + +   G      GL     +P+G A     VP+NDLE++K      G     V++E
Sbjct: 148 HGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVE 207

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           PV G  GV+P  + +L+G++ + E+ G LLIFDEV  G  R        ++GV PD+  L
Sbjct: 208 PVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGF-RVDYNCAQGYFGVTPDLTCL 266

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVLEN 307
            K +GGG P+GA   K ++ +   P      A T  GNPLA TA L T++ L  +   +N
Sbjct: 267 GKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQLTPES-YKN 325

Query: 308 AWQMGEYFKAELTKLA 323
             + G+  +  ++K A
Sbjct: 326 FIKKGDRLEEGISKTA 341


>GSA_ANAVT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  139 bits (351), Expect = 3e-35
 Identities = 101/346 (29%), Positives = 153/346 (44%), Gaps = 31/346 (8%)

Query: 3   NQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNC 52
           +QEI A  Q  +            + G  P+     +GA++WD DG QY+D+V       
Sbjct: 11  SQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAI 70

Query: 53  LGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGA 112
            GHAHP+V  A+ + ++         ++E  V    ++      +   F NSG EA    
Sbjct: 71  CGHAHPDVIGALHEALEKGTSFGAPSFLE-NVLAEMVIAAVPSIEMVRFVNSGTEACMAV 129

Query: 113 IKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGF 165
           ++L R +       ++ ++I     +HG     +   G      GL   P          
Sbjct: 130 LRLMRAFT------NREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKSATSST 183

Query: 166 AYVPFNDLEALKNTIGPH---TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
              P+NDLEA+K     +      V+LEPV G  G I     +LEG+++L  E G LL+F
Sbjct: 184 LTAPYNDLEAVKALFAENRDQIAGVILEPVVGNAGFITPDAGFLEGLRELTHEHGALLVF 243

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HA 279
           DEV  G  R       + +GV PD+ TL K +GGG P+GA   +  +     P      A
Sbjct: 244 DEVMTGF-RIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRRDIMSMIAPAGPVYQA 302

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
            T  GNPLA TA + T+E L + G  E   ++ +     L ++A E
Sbjct: 303 GTLSGNPLAMTAGIKTLELLQKPGAYEYLERITKKLADGLLQVAQE 348


>GSA_SHISS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IIEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_PSESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  139 bits (350), Expect = 4e-35
 Identities = 97/299 (32%), Positives = 146/299 (48%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+      GA+V D D ++Y+D+V       LGH+HP+V +AV  Q++  L      
Sbjct: 30  GGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRNQLEHGLSYGAPT 89

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E +  +A L+ E     +     +SG EA   AI+LAR +     G D   II     
Sbjct: 90  AMETE--MADLVCELVPSMEMVRMVSSGTEATMSAIRLARGFT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G      G+     +P  FA     VPFNDL A+++    +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTLGVPSSPGVPAAFAKHTLTVPFNDLNAVRDLLAEVGQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  YL+G++ LC+E G++LIFDEV  G  R        +Y V+PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGYLQGLRALCDEHGVVLIFDEVMTGF-RVALGGAQAYYDVKPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            T  K +GGG P+G    K ++     P      A T  GNPLA  A L T+  + + G
Sbjct: 261 STFGKIIGGGMPVGCFGGKREIMSHIAPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG 319


>GSA_PSEPF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/316 (31%), Positives = 153/316 (48%), Gaps = 34/316 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA+V D D ++Y+D+V       LGH+HP+V +AV  Q++  L      
Sbjct: 30  GGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRNQLQHGLSYGAPT 89

Query: 79  WIEPQVK-LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E ++  L   LV +   +     +SG EA   AI+LAR +     G D   II     
Sbjct: 90  AMETEMADLVCSLVPS--LEMVRMVSSGTEATMSAIRLARGFT----GRDS--IIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNT---IGPHTCAV 187
           +HG + + +   G     +G+     +P  FA     +PFND++A++     +G     +
Sbjct: 142 YHGHSDSLLVKAGSGALTQGVPSSAGVPAAFAKHTLTLPFNDIDAVEKMLAEVGQDVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P A  +LEG++ LC++ G++LIFDEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPAPGFLEGLRSLCDKHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T  K +GGG P+G    K  + +   P      A T  GNPLA  A L T+  + + G 
Sbjct: 261 TTFGKIIGGGMPVGCFGGKRLIMERIAPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPG- 319

Query: 305 LENAWQMGEYFKAELT 320
                     F AELT
Sbjct: 320 ----------FHAELT 325


>GSA_NOSP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  139 bits (350), Expect = 4e-35
 Identities = 102/347 (29%), Positives = 158/347 (45%), Gaps = 33/347 (9%)

Query: 3   NQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNC 52
           +QE+ A  Q  +            + G  P+   + +GA++WD DG QY+D+V       
Sbjct: 11  SQEVFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDRVKGAYIWDVDGNQYIDYVGTWGPAI 70

Query: 53  LGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEG 111
            GHAHPEV  A+ + ++          +E    LA+++++     +   F NSG EA  G
Sbjct: 71  CGHAHPEVIAALHEALEKGTSFGAPSTLEN--VLAEMVIDAVPSIEMVRFVNSGTEACMG 128

Query: 112 AIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QG 164
            ++L R +       ++ +II     +HG     +   G      GL   P         
Sbjct: 129 VLRLMRAFT------NRDKIIKFEGCYHGHADTFLVKAGSGVATLGLPDSPGVPKAATST 182

Query: 165 FAYVPFNDLEALKNTIGPH---TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLI 221
               P+NDLE++K     +      V+LEPV G  G I     +LEG+++L  E G LL+
Sbjct: 183 TLTAPYNDLESVKALFEENRDEIAGVILEPVVGNAGFIAPDAGFLEGLRELTHEYGALLV 242

Query: 222 FDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---H 278
           FDEV  G  R       + +GV PD+ TL K +GGG P+GA   +  +     P      
Sbjct: 243 FDEVMTGF-RIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRRDIMSMVAPAGPVYQ 301

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
           A T  GNPLA TA + T+E L + G  +   ++ +     L ++A E
Sbjct: 302 AGTLSGNPLAMTAGIKTLELLQKPGTYDYLERITKKLADGLLQIAKE 348


>GSA_ERWT9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 97/302 (32%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G +P+ + +  GA+++DADG+ Y+D+V       LGH HP +  AV    +  L   
Sbjct: 27  NGVGGVPLFIERANGAYLYDADGKAYIDYVGSWGPMVLGHNHPAIRNAVIDAAERGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +VK+A L+ E     D     NSG EA   AI+LAR +  +       +II  
Sbjct: 87  AP--TEMEVKMAALVTELVPTMDMVRMVNSGTEATMSAIRLARGFTHRD------KIIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG     +   G    T  Q     +P  FA       +NDL +++     +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    +P    +L G++ LC+E   LLI DEV  G  R        HYGVE
Sbjct: 199 ACIIVEPVAGNMNCVPPLPDFLPGLRALCDEFDALLIIDEVMTGF-RVALAGAQAHYGVE 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+GA   + +V +A  PG     A T  GNP+A  A  A +  + Q
Sbjct: 258 PDLTCLGKIIGGGMPVGAFGGRREVMEALAPGGPVYQAGTLSGNPIAMAAGFACLTEVAQ 317

Query: 302 KG 303
            G
Sbjct: 318 PG 319


>GSA_ECOUT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOLU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOL6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOL5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO8A RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO81 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO55 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO45 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO27 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO24 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_DESHY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  139 bits (350), Expect = 4e-35
 Identities = 110/329 (33%), Positives = 146/329 (44%), Gaps = 37/329 (11%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           GR P+ + KGQGA +WD DG  YLD+V       LGHAHP V  A    +K        Y
Sbjct: 34  GREPIFIAKGQGARLWDIDGNSYLDYVLSWGPLILGHAHPVVVGA----IKAAAERGTSY 89

Query: 79  WIEPQVKLAKLLVENSCAD---KAF-------FCNSGAEANEGAIKLARKYAKQHLGPDK 128
                   A   +E  CA+   KAF         +SG EA   A++LAR       G +K
Sbjct: 90  G-------APTEIETECAEEVIKAFPSMEMVRMVSSGTEATMSALRLARGVT----GRNK 138

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDP-LPQGFA----YVPFNDLEALKNTI--- 180
                     HG +L     +G   +     P +P   A       +NDLE LK      
Sbjct: 139 IIKFEGCYHGHGDSLLIKAGSGALTFGVPTSPGVPSSVASQTIVAQYNDLEGLKEIFKEC 198

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
           G    AV+LEPV G  GV+     +L G++ L ++ G LLIFDEV  G  R         
Sbjct: 199 GEDIAAVILEPVTGNMGVVLPQPGFLAGLRTLTQDYGSLLIFDEVMTGF-RVSYGGAQGR 257

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATME 297
           Y ++PD+  L K +GGG P+ A   K +  +   P      A T  GNPLA  A LAT++
Sbjct: 258 YQIDPDLTCLGKVIGGGLPVAAYGGKRKYMEQVAPSGPIYQAGTLSGNPLAMAAGLATLK 317

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEV 326
            L Q+GV E   +        L  +A E+
Sbjct: 318 LLQQEGVYEGLEKKTTRLAEGLQSIAQEL 346


>GSA_DESHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 430

 Score =  139 bits (350), Expect = 4e-35
 Identities = 110/329 (33%), Positives = 146/329 (44%), Gaps = 37/329 (11%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           GR P+ + KGQGA +WD DG  YLD+V       LGHAHP V  A    +K        Y
Sbjct: 34  GREPIFIAKGQGARLWDIDGNSYLDYVLSWGPLILGHAHPVVVGA----IKAAAERGTSY 89

Query: 79  WIEPQVKLAKLLVENSCAD---KAF-------FCNSGAEANEGAIKLARKYAKQHLGPDK 128
                   A   +E  CA+   KAF         +SG EA   A++LAR       G +K
Sbjct: 90  G-------APTEIETECAEEVIKAFPSMEMVRMVSSGTEATMSALRLARGVT----GRNK 138

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDP-LPQGFA----YVPFNDLEALKNTI--- 180
                     HG +L     +G   +     P +P   A       +NDLE LK      
Sbjct: 139 IIKFEGCYHGHGDSLLIKAGSGALTFGVPTSPGVPSSVASQTIVAQYNDLEGLKEIFKEC 198

Query: 181 GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH 240
           G    AV+LEPV G  GV+     +L G++ L ++ G LLIFDEV  G  R         
Sbjct: 199 GEDIAAVILEPVTGNMGVVLPQPGFLAGLRTLTQDYGSLLIFDEVMTGF-RVSYGGAQGR 257

Query: 241 YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATME 297
           Y ++PD+  L K +GGG P+ A   K +  +   P      A T  GNPLA  A LAT++
Sbjct: 258 YQIDPDLTCLGKVIGGGLPVAAYGGKRKYMEQVAPSGPIYQAGTLSGNPLAMAAGLATLK 317

Query: 298 TLLQKGVLENAWQMGEYFKAELTKLAAEV 326
            L Q+GV E   +        L  +A E+
Sbjct: 318 LLQQEGVYEGLEKKTARLAEGLQSIAQEL 346


>GSA_ACTSZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  139 bits (350), Expect = 4e-35
 Identities = 100/316 (31%), Positives = 150/316 (47%), Gaps = 27/316 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA++ D DG+QY+D+V       LGH HP + +AV K V   L      
Sbjct: 30  GGTPVFIQKAAGAYITDTDGKQYIDYVGSWGPMVLGHNHPAIIDAVLKAVPNGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ LA+L+       +     +SG EA   AI+LAR Y K+       +II     
Sbjct: 89  -TEGEITLAELVCRLIPSIELVRMVSSGTEATMSAIRLARGYTKRD------KIIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG + + +   G    T  Q     +P+ FA       +NDL ++K     +      +
Sbjct: 142 YHGHSDSLLVKAGSGALTLGQPSSPGVPEDFAKHTLTCTYNDLNSVKCAFERYPQDIACL 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L+GV++LC++ G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IIEPVAGNMNCVPPKPGFLQGVRELCDQYGALLIIDEVMTGF-RVALGGAQAYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG- 303
             L K +GGG P+GA   K ++ +   P      A T  GNP+A  A LA +  L + G 
Sbjct: 261 TALGKIIGGGMPVGAFGGKREIMEYIAPTGPVYQAGTLSGNPIAMAAGLACLTELSKPGN 320

Query: 304 ---VLENAWQMGEYFK 316
              + E   Q+ E  K
Sbjct: 321 EQQLAEKTQQLAEGLK 336


>GSA_ECO5E RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (349), Expect = 6e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO57 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  139 bits (349), Expect = 6e-35
 Identities = 100/302 (33%), Positives = 141/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGVEPD+
Sbjct: 202 IVEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVEPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_VIBF1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  138 bits (348), Expect = 7e-35
 Identities = 94/299 (31%), Positives = 148/299 (49%), Gaps = 23/299 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +  G  ++DADG+ Y+D+V       LGH H  + EAV    +  L      
Sbjct: 30  GGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILGHNHAAIREAVISAAQRGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ +A+L+ E     ++    +SG EA   AI+LAR Y     G DK  I+     
Sbjct: 89  -TETEITMAELVSELVPSMEQVRMVSSGTEATMSAIRLARGYT----GRDK--IMKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT---CAV 187
           +HG   + +   G    T  Q     +P  FA       FNDL++++     +      +
Sbjct: 142 YHGHADSLLVKAGSGALTLGQPSSPGVPADFAKYTLTATFNDLDSVRELFAVNKGEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP  + + EG++Q+C+E+G LLIFDEV  G  R  +     +Y ++PD+
Sbjct: 202 IVEPVAGNMNCIPPVEGFHEGLRQICDEEGALLIFDEVMTGF-RVAENCAQGYYNIKPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
            TL K +GGG P+GA   +++V Q   P      A T  GNP+A  A  A ++ L ++G
Sbjct: 261 TTLGKVIGGGMPVGAFGGRKEVMQYIAPTGPVYQAGTLSGNPVAMAAGFACLKVLTEEG 319


>GSA_SERP5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  138 bits (348), Expect = 7e-35
 Identities = 99/324 (30%), Positives = 150/324 (46%), Gaps = 23/324 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G +P+ + +  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L   
Sbjct: 30  NGVGGVPLFIERADGAYLFDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAQRGLSFG 89

Query: 76  NIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +VK+A+L+ E     D     NSG EA   AI+LAR Y       ++ +II  
Sbjct: 90  AP--TEMEVKMAELVTELVPTMDMVRMVNSGTEATMSAIRLARGYT------NRDKIIKF 141

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---T 184
              +HG     +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 142 EGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTFNDLDSVRTAFEQYPSEI 201

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    +P    +L G++ LC++ G LLI DEV  G  R        +Y V 
Sbjct: 202 ACIIVEPVAGNMNCVPPLPEFLPGLRALCDKYGALLIIDEVMTGF-RVALAGAQSYYDVV 260

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+GA   + +V  A  P      A T  GNP+A  A  A +  + Q
Sbjct: 261 PDLTCLGKIIGGGMPVGAFGGRREVMAALAPTGPVYQAGTLSGNPIAMAAGFACLTEVSQ 320

Query: 302 KGVLENAWQMGEYFKAELTKLAAE 325
            GV +   ++ +   A L   A E
Sbjct: 321 VGVHQTLTELTDMLAAGLLHAAKE 344


>GSA_GLOVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  138 bits (348), Expect = 7e-35
 Identities = 92/302 (30%), Positives = 142/302 (47%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + + +GA++WD DG +Y+++++    + +GH+HPEV  A+ + +          
Sbjct: 37  GSEPVFIERAEGAYLWDVDGNRYIEYINTWGPSIVGHSHPEVISALREALPKGTSYGAPT 96

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E Q  +A+ +++     +   F NSG EA   A++LAR +        + +II     
Sbjct: 97  RLENQ--MARTVIDAIPAVEMVRFVNSGTEATMSALRLARAFT------GREKIIKFEGC 148

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDL---EALKNTIGPHTCAV 187
           +HG     +   G      GL   P             P+NDL   EAL          +
Sbjct: 149 YHGHADMLLVQAGSGVATLGLPDSPGVPKSTTAATLTAPYNDLAAVEALFKQYPSDVAGL 208

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G +     +LEG++ L    G +LIFDEV  G  R         YG+EPD+
Sbjct: 209 ILEPVVGNAGCLVPEIGFLEGLRDLTHAHGTVLIFDEVMTGF-RLSYGGAQARYGIEPDL 267

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   + ++ Q   P      A T  GNPLA TA + T+E L + G 
Sbjct: 268 TCLGKIIGGGLPVGAYAGRREIMQMVAPAGPMYQAGTLSGNPLAMTAGIKTLEILQRPGT 327

Query: 305 LE 306
            E
Sbjct: 328 YE 329


>GSA_ERWCT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  138 bits (348), Expect = 7e-35
 Identities = 100/305 (32%), Positives = 142/305 (46%), Gaps = 23/305 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA+++D D + Y+D+V       LGH HP + +AV    +  L   
Sbjct: 27  NGVGGTPLFIERADGAYLYDVDEQAYIDYVGSWGPMVLGHNHPSIRDAVIAAAERGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V++A+L+       D     NSG EA   AI+LAR Y     G DK  II  
Sbjct: 87  AP--TEMEVQMARLVTSLVPSMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG     +   G    T  Q     +P  FA       +NDL +++ T   +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFARHTLTCVYNDLSSVRTTFEQYPDEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            A+++EPV G    +P    +L G++ LC+E G L I DEV  G  R        HYGV 
Sbjct: 199 AAIIVEPVAGNMNCVPPLPDFLPGLRALCDEFGALFIIDEVMTGF-RVALAGAQSHYGVV 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+GA   K +V QA  P      A T  GNP+A  A  A +  + +
Sbjct: 258 PDLTCLGKIIGGGMPVGAFGGKREVMQALAPTGPVYQAGTLSGNPIAMAAGFACLTEVAK 317

Query: 302 KGVLE 306
            GV E
Sbjct: 318 PGVHE 322


>GSA1_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 428

 Score =  138 bits (348), Expect = 7e-35
 Identities = 94/288 (32%), Positives = 146/288 (50%), Gaps = 27/288 (9%)

Query: 28  GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSNIYWIEPQVK 85
           G+G+ ++D DG +Y+D+V       LGH  P+V   + + +   T    S +     + K
Sbjct: 41  GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDKGTSFGASTLL----ENK 96

Query: 86  LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLA 144
           LA+L+++     +K    +SG EA    ++LAR Y  ++      +I+     +HG + +
Sbjct: 97  LAQLVIDRVPSIEKVRMVSSGTEATLDTLRLARGYTGRN------KIVKFEGCYHGHSDS 150

Query: 145 TVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVMLEPVQG 194
            +   G      GL     +P+G A     VP+NDL+ALK      G     V++EPV G
Sbjct: 151 LLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLDALKIAFEKFGDDIAGVIVEPVAG 210

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GV+P  + +L+G++ +  E G LLIFDEV  G  R G      H+GV PD+  L K +
Sbjct: 211 NMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGF-RVGYHCAQGHFGVTPDLTCLGKVI 269

Query: 255 GGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETL 299
           GGG P+GA   K+++     P G+   A T  GNPLA T+   T+  L
Sbjct: 270 GGGLPVGAFGGKKEIMDHIAPLGNIYQAGTLSGNPLAMTSGYETLSQL 317


>ECTB_HALEL RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 421

 Score =  138 bits (348), Expect = 7e-35
 Identities = 106/409 (25%), Positives = 189/409 (46%), Gaps = 41/409 (10%)

Query: 15  MNTYGR-LPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT--L 71
           + TY R  P+   K + A + D +GR+Y+DF++G      GH +P + +A+   + +  +
Sbjct: 13  VRTYSRSFPVVFTKARNARLTDEEGREYIDFLAGAGTLNYGHNNPHLKQALLDYIDSDGI 72

Query: 72  LHCSNIYWIEPQVKLAKLLVENSCADKAFFCN------SGAEANEGAIKLARKYAKQHLG 125
           +H  + +W   +    + L E     +           +G  A E AI+LAR      + 
Sbjct: 73  VHGLD-FWTAAKRDYLETLEEVILKPRGLDYKVHLPGPTGTNAVEAAIRLAR------VA 125

Query: 126 PDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-QGFAYVPFND--------LEAL 176
             ++ I++ TN FHG T+  +  TG  K++     +P Q  +++PF+         L+  
Sbjct: 126 KGRHNIVSFTNGFHGVTMGALATTGNRKFREATGGVPTQAASFMPFDGYLGSSTDTLDYF 185

Query: 177 KNTIGPHT------CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLG 230
           +  +G  +       AV++E VQGEGG+  A   +L+ ++ +C    +LLI D++Q G G
Sbjct: 186 EKLLGDKSGGLDVPAAVIVETVQGEGGINVAGLEWLKRLESICRANDILLIIDDIQAGCG 245

Query: 231 RTGKFLGYQHYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAA 289
           RTGKF  ++H G+ PDI+T +K+L G G P   +L + ++   ++PG +  TF G  L  
Sbjct: 246 RTGKFFSFEHAGITPDIVTNSKSLSGYGLPFAHVLMRPEL-DKWKPGQYNGTFRGFNLXX 304

Query: 290 TASLATMETLLQKGVLE-NAWQMGEYFKAELTKLAA-----EVPLVKEVRXXXXXXXXXX 343
                 M         E +  +     +    K+AA      +   +  R          
Sbjct: 305 XXXXXXMRKYWSDDTFERDVQRKARIVEERFGKIAAWLSENGIEASERGRGLMRGIDVGS 364

Query: 344 XXXXKDIVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILK 390
                 I     E GL+I  +  +G V++ L PL I  +++ + + IL+
Sbjct: 365 GDIADKITHQAFENGLIIETSGQDGEVVKCLCPLTIPDEDLVEGLDILE 413


>BIOB_BACFR RecName: Full=Biotin synthase;       
           EC=2.8.1.6;AltName: Full=Biotin synthetase;
          Length = 748

 Score =  138 bits (348), Expect = 7e-35
 Identities = 120/400 (30%), Positives = 185/400 (46%), Gaps = 30/400 (7%)

Query: 16  NTYGRLPMALVK-GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHC 74
           +T   LP+  VK   GA +    G+  ++ +S       G+ HP + +AV  Q+  + H 
Sbjct: 335 STSNPLPVYKVKRADGATITLESGQTLIEGMSSWWCAVHGYNHPILNQAVQDQLSRMSHV 394

Query: 75  S-NIYWIEPQVKLAKLLVE--NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
                  +P ++L KLL+        K F+ +SG+ A E A+K+A +Y      P+K   
Sbjct: 395 MFGGLTHDPAIELGKLLLPLVPPSMQKIFYADSGSVAVEVALKMAVQYWYAAGKPEKNNF 454

Query: 132 ITATNSFHGRTLATVTAT----------GQTKYQRGLDPLPQGFAYVPFN--DLEALKNT 179
           +T  N +HG T   ++            G     R   P P       +N  D+  L++ 
Sbjct: 455 VTIRNGYHGDTWNAMSVCDPVTGMHSIFGSALPIRHFLPAPSSRFGDEWNPEDIRPLEHL 514

Query: 180 IGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKF 235
           +  H     A +LEP VQG GG+      YL    +LC   G+LLIFDE+  G GRTGK 
Sbjct: 515 LEKHADELAAFILEPIVQGAGGMRFYHPEYLREAARLCHRYGVLLIFDEIATGFGRTGKL 574

Query: 236 LGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQ---PGD--HASTFGGNPLAA 289
             ++H GVEPDI+ + KAL GG+  + A+L   +VA       PG   H  TF GNPLA 
Sbjct: 575 FAWEHAGVEPDIMCIGKALTGGYMTLSAVLTTNEVADCISNHAPGAFMHGPTFMGNPLAC 634

Query: 290 TASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK- 348
             + A++  LL  G  EN  ++      EL   A E+P V +VR                
Sbjct: 635 AVACASVRLLLTSGWQENVKRIEAQLNRELAP-ARELPQVADVRVLGAIGVIEMKEPVNM 693

Query: 349 -DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQ 387
             +    +E+G+ +    G ++  +PP IIT +++ +  +
Sbjct: 694 AYLQRRFVEEGIWLR-PFGKLIYVMPPFIITPEQLTKLTE 732


>GSA_VIBPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  138 bits (347), Expect = 9e-35
 Identities = 102/332 (30%), Positives = 160/332 (48%), Gaps = 29/332 (8%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA ++DADGR Y+D+V       LGH H  + EAV    +  L   
Sbjct: 27  NGVGGSPLFIERADGALIFDADGRAYIDYVGSWGPMILGHNHAVIREAVIDAAQRGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E ++ +A+L+ E     ++    +SG EA   AI+LAR +     G DK  I+  
Sbjct: 87  AP--TEMEIAMAELVSELVPSMEQIRMVSSGTEATMSAIRLARGFT----GRDK--IMKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG   + +   G    T  Q     +P  FA       FNDL++++     +    
Sbjct: 139 EGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTATFNDLDSVRELFAANKGEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    IP  + + EG++++C+++G LLIFDEV  G  R        HY ++
Sbjct: 199 ACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGF-RVALGGAQAHYNIK 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   +++V Q   P      A T  GNP+A  A  A +  L +
Sbjct: 258 PDLTTLGKVIGGGMPVGAFGGRKEVMQYVAPTGPVYQAGTLSGNPVAMAAGFACLNLLKE 317

Query: 302 KG----VLENAWQMGEYFKAELTKLAAEVPLV 329
           +G    +     Q+ + FK+   K    +PLV
Sbjct: 318 EGNEKRLASKTKQLADGFKSLAEKHG--IPLV 347


>GSA_PHOLL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  138 bits (347), Expect = 9e-35
 Identities = 103/330 (31%), Positives = 152/330 (46%), Gaps = 25/330 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ +    GA+++D DG+ Y+D+V       LGH H  +  AV K  +  L   
Sbjct: 27  NGVGGTPLFIKHADGAYLYDVDGKAYIDYVGSWGPMVLGHNHSAIRNAVIKAAEQGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                  +V++A+L+ E     D     NSG EA   AI+LAR Y  +       +II  
Sbjct: 87  AP--TAAEVEMAQLVTELVPSMDMVRMVNSGTEATMSAIRLARGYTHRD------KIIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---T 184
              +HG     +   G    T  Q     +P  F        +NDL +++     +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTIGQPNSPGVPVDFVKHTLTCTYNDLSSVREAFEQYPQEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             +++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +Y VE
Sbjct: 199 ACIIVEPVAGNMNCVPPQPEFLPGLRALCDEFGALLIIDEVMTGF-RVALSGAQSYYDVE 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PDI  L K +GGG P+GA   + +V +   P      A T  GNP+A  A LA ++ + Q
Sbjct: 258 PDITCLGKIIGGGMPVGAFGGRYEVMEKLAPIGPVYQAGTLSGNPIAMAAGLACLKEVSQ 317

Query: 302 KGVLENAWQMGEYFKAELTK--LAAEVPLV 329
            GV +   ++ +   A LTK   AA +PLV
Sbjct: 318 PGVHQRLTELTDNLAAGLTKSAKAANIPLV 347


>GSA_CYAP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  138 bits (347), Expect = 9e-35
 Identities = 95/305 (31%), Positives = 143/305 (46%), Gaps = 29/305 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+     +GA++WD D  QY+D+V        GHAHP+V  A+ K +          
Sbjct: 38  GGQPIVFDHVEGAYIWDVDNNQYIDYVGTWGPAICGHAHPDVISALHKALD-----KGTS 92

Query: 79  WIEPQVK---LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
           +  P ++   LA+++++     +   F NSG EA    ++L R Y  +       +II  
Sbjct: 93  FGAPCMQENILAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAYTNRE------KIIKF 146

Query: 135 TNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHT--- 184
              +HG     +   G      GL   P             P+NDLEA+K     +    
Sbjct: 147 EGCYHGHADMFLVKAGSGVATLGLPDSPGVPKTTTSNTLTAPYNDLEAVKALFENNKDEI 206

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
             ++LEPV G  G IP    +LEG+++L +E G LL+FDEV  G  R       + +GV 
Sbjct: 207 AGLILEPVVGNAGFIPPDAGFLEGLRELTKEYGALLVFDEVMTGF-RIAYGGAQEKFGVT 265

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+ TL K +GGG P+GA   ++++     P      A T  GNPLA TA + T+E L +
Sbjct: 266 PDLTTLGKVIGGGLPVGAYGGRKEIMSLVAPSGPMYQAGTLSGNPLAMTAGIKTLELLQK 325

Query: 302 KGVLE 306
            G  +
Sbjct: 326 PGTYD 330


>GSA_BORPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  138 bits (347), Expect = 9e-35
 Identities = 102/303 (33%), Positives = 147/303 (48%), Gaps = 25/303 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + + QG +VWDA+G+QY+D+V       LGHAHPEV  AV  Q   +   S   
Sbjct: 30  GGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILGHAHPEVVRAV--QEAAVHGLSFGA 87

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +V+LA++L+      ++    +SG EA   AI+LAR    +H      +II     
Sbjct: 88  PTEAEVELAEMLIARLPSLEQVRLVSSGTEATMTAIRLARGATGRH------KIIKFEGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGF--------AYVPFNDL---EALKNTIGPHTCA 186
           +HG + + +   G      G +P   G           + FN+L   +A  +  G     
Sbjct: 142 YHGHSDSLLVKAGSGLLTFG-NPSSAGVPPEFVAHTLTLEFNNLAVVDAAFSQHGAEIAC 200

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           V++EPV G   +I  A+ +L G+++LC   G +LIFDEV  G  R G        GV PD
Sbjct: 201 VIVEPVAGNMNLIKPAEGFLAGLRELCTRHGAVLIFDEVMTGF-RIGPQGVQGLTGVRPD 259

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           + TLAK +GGG P+GA   +  +     P      A T  GNP+A  A LATM  + + G
Sbjct: 260 LTTLAKVIGGGMPVGAFGGRADLMTHIAPLGGVYQAGTLSGNPVAVAAGLATMRLIGEPG 319

Query: 304 VLE 306
             E
Sbjct: 320 FYE 322


>GSA_ANASP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  138 bits (347), Expect = 9e-35
 Identities = 101/346 (29%), Positives = 152/346 (43%), Gaps = 31/346 (8%)

Query: 3   NQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNC 52
           +QEI A  Q  +            + G  P+     +GA++WD DG QY+D+V       
Sbjct: 11  SQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAI 70

Query: 53  LGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGA 112
            GHAHP+V  A+   ++         ++E  V    ++      +   F NSG EA    
Sbjct: 71  CGHAHPDVIGALHDALEKGTSFGAPSFLE-NVLAEMVIAAVPSIEMVRFVNSGTEACMAV 129

Query: 113 IKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGF 165
           ++L R +       ++ ++I     +HG     +   G      GL   P          
Sbjct: 130 LRLMRAFT------NREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKSATSST 183

Query: 166 AYVPFNDLEALKNTIGPH---TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
              P+NDLEA+K     +      V+LEPV G  G I     +LEG+++L  E G LL+F
Sbjct: 184 LTAPYNDLEAVKALFEENRDQIAGVILEPVVGNAGFITPDAGFLEGLRELTHEHGALLVF 243

Query: 223 DEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HA 279
           DEV  G  R       + +GV PD+ TL K +GGG P+GA   +  +     P      A
Sbjct: 244 DEVMTGF-RIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRRDIMSMIAPAGPVYQA 302

Query: 280 STFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAE 325
            T  GNPLA TA + T+E L + G  E   ++ +     L ++A E
Sbjct: 303 GTLSGNPLAMTAGIKTLELLQKPGAYEYLERITKKLADGLLQVALE 348


>GSA2_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 429

 Score =  138 bits (347), Expect = 9e-35
 Identities = 98/299 (32%), Positives = 150/299 (50%), Gaps = 30/299 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +G+G+ V+D DG +Y+D+V        GHA+  V E++    K +      +
Sbjct: 33  GMNPLFMEQGKGSKVYDIDGNEYIDYVLSWGPLIHGHANERVVESL----KAVAEKGTSF 88

Query: 79  WIEPQV--KLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               ++  KLA+L++E     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 89  GAPTEIENKLAQLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRN------KILKFI 142

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTC 185
             +HG   + +   G      GL     +P+G A     V +NDLE++K      G    
Sbjct: 143 GCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAQNTITVAYNDLESVKYAFEQFGDDIA 202

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            V++EPV G  GV+P    +LEG++++ ++ G LLIFDEV  G  R     G  +YGV P
Sbjct: 203 CVIVEPVAGNMGVVPPIPGFLEGLREVTQQYGALLIFDEVMTGF-RVAYNCGQGYYGVTP 261

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           D+  L K +GGG P+GA   K ++ +   P      A T  GNPLA TA     ETL+Q
Sbjct: 262 DLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMTAG---YETLIQ 317


>GSA_VIBFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 431

 Score =  137 bits (346), Expect = 1e-34
 Identities = 96/300 (32%), Positives = 148/300 (49%), Gaps = 25/300 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +  G  ++DADG+ Y+D+V       LGH H  + EAV    +  L      
Sbjct: 30  GGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILGHNHAAIREAVISAAQRGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++ +A+L+ E     ++    +SG EA   AI+LAR Y     G DK  I+     
Sbjct: 89  -TETEITMAELVSELVPSMEQVRMVSSGTEATMSAIRLARGYT----GRDK--IMKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTI----GPHTCA 186
           +HG   + +   G    T  Q     +P  FA       FNDL++++       G   C 
Sbjct: 142 YHGHADSLLVKAGSGALTLGQPSSPGVPADFAKYTLTATFNDLDSVRELFTANKGEIAC- 200

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPD 246
           +++EPV G    IP  + + EG++Q+C+E+G LLIFDEV  G  R  +     +Y ++PD
Sbjct: 201 IIVEPVAGNMNCIPPVEGFHEGLRQICDEEGALLIFDEVMTGF-RVAENCAQGYYNIKPD 259

Query: 247 IITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKG 303
           + TL K +GGG P+GA   ++ V Q   P      A T  GNP+A  A  A ++ L ++G
Sbjct: 260 LTTLGKVIGGGMPVGAFGGRKDVMQYIAPTGPVYQAGTLSGNPVAMAAGFACLKVLTEEG 319


>GSA_GEOLS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 428

 Score =  137 bits (346), Expect = 1e-34
 Identities = 96/301 (31%), Positives = 148/301 (49%), Gaps = 27/301 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +  G+ ++D D   Y+D+V       LGH  PEV  AV    K  +   + +
Sbjct: 32  GADPLFIKRASGSKIFDEDNNTYIDYVGSWGPMILGHCFPEVVNAV----KQCMENGSSF 87

Query: 79  WI--EPQVKLAKLLVENSCA-DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               E ++ LA+++++   + +     +SG EA   AI+LAR Y     G DK  I+  +
Sbjct: 88  GAPTELEITLAQMVIDAMPSIEMVRMVSSGTEATMSAIRLARGYT----GRDK--ILKFS 141

Query: 136 NSFHGRTLATVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALKNTIGPHT---C 185
             +HG   A +   G      G+     +P  FA       +N L ++K  I  ++    
Sbjct: 142 GCYHGHADALLVKAGSGAATFGVPDSPGVPADFAKHTLTAEYNSLASVKTLITENSGQIA 201

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
            ++LEPV G  G +P    +LEG+++LC  +G++LIFDEV  G  R         YGV P
Sbjct: 202 CIILEPVAGNMGTVPPRPGFLEGLRELCTNEGIILIFDEVMSGF-RVAYGGAQSLYGVTP 260

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+ TL K +GGG P+GA   K ++ +   P      A T  GNPLA TA + T++ L Q 
Sbjct: 261 DMTTLGKIIGGGLPVGAFGGKREIMEKLSPSGGVYQAGTLSGNPLAMTAGIETLKFLQQP 320

Query: 303 G 303
           G
Sbjct: 321 G 321


>GSA_CITK8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  137 bits (346), Expect = 1e-34
 Identities = 105/327 (32%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +     L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAARGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFARHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCIPPQPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLTEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLA--AEVPLV 329
            E   ++       L   A  A++PLV
Sbjct: 321 HETLDELTTRLAEGLLDAAQEADIPLV 347


>GSA_ALHEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 429

 Score =  137 bits (346), Expect = 1e-34
 Identities = 96/292 (32%), Positives = 139/292 (47%), Gaps = 23/292 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + + +G +++D DG +Y+D+V        GHAHP+V  AV  Q       S   
Sbjct: 30  GGEPPFIARAEGPYLYDEDGNRYVDYVCSWGPMVAGHAHPKVVRAV--QAAAADGLSFGA 87

Query: 79  WIEPQVKLA-KLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E ++++A KL       ++    NSG EA   A++LAR     H G +K  II     
Sbjct: 88  PTEVEIRMAEKLKAMLPSLERVRMVNSGTEATMSALRLARG----HTGREK--IIKFRGC 141

Query: 138 FHGRTLATVTATGQTKYQRGLDPLPQGFAYV-------PFNDLEALKNT---IGPHTCAV 187
           +HG   A +   G      G+   P   A V       P+ND EA++     +G    AV
Sbjct: 142 YHGHVDALLVQAGSGALTLGIPGSPGVPAAVVEQTITLPYNDAEAVRECFQRMGDEIAAV 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +LE +++ C++ G +LIFDEV  G  R G       YG+ PD+
Sbjct: 202 IVEPVAGNMNCVPPVPGFLEALRECCDDHGSVLIFDEVMTGF-RVGVQCAQGRYGITPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATM 296
             L K +GGG P+GA   K Q+     P      A T  GNP+A  A LAT+
Sbjct: 261 TCLGKVIGGGMPVGAFGGKAQIMADLAPEGPVYQAGTLSGNPVAMAAGLATL 312


>GSA_ACAM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 432

 Score =  137 bits (346), Expect = 1e-34
 Identities = 99/330 (30%), Positives = 146/330 (44%), Gaps = 41/330 (12%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +GA VWD DG QY+D+V        GHAHPEV  A+    K  L     +
Sbjct: 37  GGQPIVFDRVKGAHVWDVDGNQYIDYVGTWGPAICGHAHPEVLTAL----KEALDKGTSF 92

Query: 79  WIEPQVKLAKLLVENSCADKAF----------FCNSGAEANEGAIKLARKYAKQHLGPDK 128
                   A  L+EN  A+             F NSG EA    ++L R +  +      
Sbjct: 93  G-------APCLLENVLAEMVIDAVPSVEVVRFVNSGTEACMSVLRLMRAFTGRE----- 140

Query: 129 YEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQ-------GFAYVPFNDLEALKNTIG 181
            ++I     +HG     +   G      GL   P             P+NDL++++    
Sbjct: 141 -KVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKSVTGNTLTAPYNDLQSVQALFS 199

Query: 182 PHT---CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGY 238
            H      V+LEPV G  G IP    +LEG++++ +E G LL+FDEV  G  R       
Sbjct: 200 QHPDQIAGVILEPVVGNAGFIPPDAGFLEGLREITKENGALLVFDEVMTGF-RISYGGAQ 258

Query: 239 QHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLAT 295
           + +G+ PD+ TL K +GGG P+GA   +  +     P      A T  GNPLA TA + T
Sbjct: 259 EKFGITPDLTTLGKVIGGGLPVGAYGGRRDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKT 318

Query: 296 METLLQKGVLENAWQMGEYFKAELTKLAAE 325
           +E L + G  +   ++     + L ++A E
Sbjct: 319 LELLRRSGTYDQLDRVTGKLISGLLQIARE 348


>BIOB_BACFN RecName: Full=Biotin synthase;       
           EC=2.8.1.6;AltName: Full=Biotin synthetase;
          Length = 748

 Score =  137 bits (346), Expect = 1e-34
 Identities = 120/400 (30%), Positives = 185/400 (46%), Gaps = 30/400 (7%)

Query: 16  NTYGRLPMALVK-GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHC 74
           +T   LP+  VK   GA +    G+  ++ +S       G+ HP + +AV  Q+  + H 
Sbjct: 335 STSNPLPVYKVKRADGATITLESGQTLIEGMSSWWCAVHGYNHPILNQAVQDQLSRMSHV 394

Query: 75  S-NIYWIEPQVKLAKLLVE--NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEI 131
                  +P ++L KLL+        K F+ +SG+ A E A+K+A +Y      P+K   
Sbjct: 395 MFGGLTHDPAIELGKLLLPLVPPSMQKIFYADSGSVAVEVALKMAVQYWYAAGKPEKNNF 454

Query: 132 ITATNSFHGRTLATVTAT----------GQTKYQRGLDPLPQGFAYVPFN--DLEALKNT 179
           +T  N +HG T   ++            G     R   P P       +N  D+  L+  
Sbjct: 455 VTIRNGYHGDTWNAMSVCDPVTGMHSIFGSALPIRHFLPAPSSRFGDEWNPEDIRPLEYL 514

Query: 180 IGPHT---CAVMLEP-VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKF 235
           +  H     A +LEP VQG GG+      YL+   +LC   G+LLIFDE+  G GRTGK 
Sbjct: 515 LEKHADELAAFILEPIVQGAGGMRFYHPEYLKEAARLCHRYGVLLIFDEIATGFGRTGKL 574

Query: 236 LGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAFQ---PGD--HASTFGGNPLAA 289
             ++H GVEPDI+ + KAL GG+  + A+L   +VA       PG   H  TF GNPLA 
Sbjct: 575 FAWEHAGVEPDIMCIGKALTGGYMTLSAVLTTNEVADCISNHAPGAFMHGPTFMGNPLAC 634

Query: 290 TASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXK- 348
             + A++  LL  G  EN  ++      EL   A E+P V +VR                
Sbjct: 635 AVACASVRLLLTSGWQENVKRIEAQLNRELAP-ARELPQVADVRVLGAIGVIEMKEPVNM 693

Query: 349 -DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQ 387
             +    +E+G+ +    G ++  +PP IIT +++ +  +
Sbjct: 694 AYLQRRFVEEGIWLR-PFGKLIYVMPPFIITPEQLTKLTE 732


>GSA_SYNY3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 433

 Score =  137 bits (345), Expect = 2e-34
 Identities = 97/301 (32%), Positives = 138/301 (45%), Gaps = 21/301 (6%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +GA +WD DG QY+D+V        GHAHP+V  A+ KQ           
Sbjct: 38  GGQPIVFDRVEGAQIWDVDGNQYIDYVGTWGPAICGHAHPDVISAL-KQALDKGTSFGAP 96

Query: 79  WIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
             +  V    ++      +   F NSG EA    ++L R +        + +II     +
Sbjct: 97  CAQENVLAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAFT------GREKIIKFEGCY 150

Query: 139 HGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTI--GPHTCA-VM 188
           HG     +   G      GL   P       +     P+NDLEA+K      P + A V+
Sbjct: 151 HGHADMFLVKAGSGVATLGLPDSPGVPSNTTKATLTAPYNDLEAVKALFVENPDSIAGVI 210

Query: 189 LEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDII 248
           LEPV G  G I     +LEG+++L +E G LL+FDEV  G  R         +G+ PD+ 
Sbjct: 211 LEPVVGNAGFILPDAGFLEGLRELTKEYGALLVFDEVMTGF-RVSYGGAQARFGITPDLT 269

Query: 249 TLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGVL 305
           TL K +GGG P+GA   +E++     P      A T  GNPLA TA + T+E L + G  
Sbjct: 270 TLGKVIGGGLPVGAYGGREEIMAMVAPAGPMYQAGTLSGNPLAMTAGIKTLEILQKPGSY 329

Query: 306 E 306
           E
Sbjct: 330 E 330


>GSA_PELTS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 434

 Score =  137 bits (345), Expect = 2e-34
 Identities = 98/302 (32%), Positives = 144/302 (47%), Gaps = 26/302 (8%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + KG+GA ++D D  +Y+D+V       LGH HP V  A+    + L      +
Sbjct: 34  GLNPVFVKKGEGARIYDFDDNEYIDYVCSWGPLILGHRHPRVVGAL---ERCLNEVGTSF 90

Query: 79  WIEPQVK--LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
               +++  LA+++VE     +     NSG EA   A++LAR Y  ++      +I+   
Sbjct: 91  GAPTELENILAEMIVEAVPSIEMVRLVNSGTEAAMSALRLARGYTGRN------KIVKFE 144

Query: 136 NSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTI---GPHTC 185
             +HG     +   G      G+   P        G     +NDL  L+      G    
Sbjct: 145 GCYHGHADFLLIKAGSGALTFGVPTSPGIPXXXXXGTIVARYNDLAGLEEIFKLEGEDIA 204

Query: 186 AVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEP 245
           AV++EPV G  GV+P A  +LEG++ L    G LLIFDEV  G  R       + YGV P
Sbjct: 205 AVIVEPVAGNMGVVPPAPGFLEGLRNLTARYGSLLIFDEVITGF-RLAYGGAQELYGVAP 263

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQK 302
           D+  L K +GGG P+GA   + ++ +   P      A T  GNPLA +A +AT+E L Q 
Sbjct: 264 DLTCLGKVIGGGLPVGAYGGRREIMEQVAPSGPVYQAGTLSGNPLAVSAGIATLEVLKQP 323

Query: 303 GV 304
           GV
Sbjct: 324 GV 325


>GSA_HAEPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  137 bits (345), Expect = 2e-34
 Identities = 99/321 (30%), Positives = 156/321 (48%), Gaps = 31/321 (9%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ +   +GA++ D++G++Y+D+V       LGH HP + +AV K V   L      
Sbjct: 30  GGTPVFIDSAKGAYITDSEGKRYIDYVGSWGPMVLGHNHPAIIDAVLKAVPNGLSFGAPT 89

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            IE  ++LA+L+ +     +     +SG EA   AI+LAR Y K+       +II     
Sbjct: 90  AIE--IELAELVCKLVPSIEMVRMVSSGTEATMSAIRLARGYTKRD------KIIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG + + +   G    T  Q     +P+ FA       +N+L ++K     +      +
Sbjct: 142 YHGHSDSLLVKAGSGALTLGQPSSPGVPEDFAKHTLTCEYNNLASVKQAFEQYPNDIACL 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP  + +L+G+++LC + G + I DEV  G  R        +YGV PD+
Sbjct: 202 IIEPVAGNMNCIPPKEGFLQGLRELCTQYGAVFIIDEVMTGF-RVALGGAQSYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            TL K +GGG P+GA   K+++ +   P      A T  GNP+A +A LA +  L + G 
Sbjct: 261 TTLGKIIGGGMPVGAFGGKKEIMEFIAPTGPVYQAGTLSGNPIAMSAGLACLTELSKAG- 319

Query: 305 LENAWQMGEYFKAELTKLAAE 325
                   E   AE TK  AE
Sbjct: 320 -------NEQLLAEKTKTLAE 333


>GSA_DESDG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 422

 Score =  137 bits (345), Expect = 2e-34
 Identities = 93/292 (31%), Positives = 149/292 (51%), Gaps = 23/292 (7%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ + +GQG+ ++  DGR+Y+DFV       LGHAHP V +A+ + V      S     E
Sbjct: 33  PVFVERGQGSKLYSVDGREYIDFVESWGPLLLGHAHPAVNKAIHEAVDK--GSSFGAPCE 90

Query: 82  PQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG 140
            +++LA+ +V+     +     +SG EA   A++LAR Y  ++      ++I     +HG
Sbjct: 91  DEIRLAEAVVDAVPSIEMVRMVSSGTEATMSALRLARGYTGRN------KLIKFEGCYHG 144

Query: 141 RTLATVTATGQTKYQRGL-------DPLPQGFAYVPFNDLEALKNTIGPH---TCAVMLE 190
              A + + G       +       D +       P+N+LE +K     H     AV++E
Sbjct: 145 HGDAFLASAGSGVATLSIPGTPGVPDTVVADTLLAPYNNLERVKALFENHGADIAAVIVE 204

Query: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250
           P  G  G++  A  +L+G+++LC+  G LLIFDEV  G  R       Q++G+ PD+ TL
Sbjct: 205 PTAGNMGLVRPAAGFLQGLRELCDRYGALLIFDEVITGF-RLSYGGAQQYFGITPDLTTL 263

Query: 251 AKALGGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETL 299
            K +GGG P+GA   + ++ +   P GD   A T  GNP+A  A +AT+  L
Sbjct: 264 GKIIGGGMPVGAYGGRREIMERIAPCGDVYQAGTLAGNPVAMAAGIATLAEL 315


>GSA_CELJU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  137 bits (345), Expect = 2e-34
 Identities = 92/299 (30%), Positives = 137/299 (45%), Gaps = 31/299 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   K  GA++WDADG++Y+D+V       LGHAHPEV   V    K  L      
Sbjct: 30  GGTPVFFEKALGAYIWDADGKRYIDYVQSWGPMVLGHAHPEVINTVIDAAKHGLS----- 84

Query: 79  WIEPQVKLAKLLVENSCA-----DKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
                 +    L E  C+     D   F +SG EA   AI+LAR + K+       +II 
Sbjct: 85  -FGAPTERETTLAEKLCSLMPGMDMVRFVSSGTEATMSAIRLARAFTKRD------KIIK 137

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAY-------VPFNDLEALKN---TIGPH 183
               +HG + + +   G      G+   P   A        + +N+ E ++     +G  
Sbjct: 138 FEGCYHGHSDSLLIKAGSGALTLGVPSSPGVPAVLADHTITLDYNNAEQVRECFAELGEQ 197

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
              +++EPV G    +P    +LE ++++C+  G +LI DEV  G  R        +YG+
Sbjct: 198 IACIIVEPVVGNMNCVPPVPGFLECLREVCDRYGSVLILDEVMTGF-RVSPTGAQGYYGI 256

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
           + DI TL K +GGG P+GA   +  + Q   P      A T  GNP+A  A L T+E L
Sbjct: 257 KADITTLGKVIGGGMPVGAFGGRRDIMQMIAPSGPVYQAGTLSGNPVAMAAGLKTLELL 315


>ECTB_VIBPA RecName: Full=Diaminobutyrate--2-oxoglutarate
           transaminase;         EC=2.6.1.76;AltName:
           Full=Diaminobutyrate--2-oxoglutarate aminotransferase;
          Length = 421

 Score =  137 bits (345), Expect = 2e-34
 Identities = 101/410 (24%), Positives = 181/410 (44%), Gaps = 23/410 (5%)

Query: 5   EILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAV 64
           +I    +  V +     P+   K +G W+    G +YLDF++G      GH +P + +A+
Sbjct: 2   DIFKKQESNVRSYSNNFPVVFRKAKGCWLETEQGERYLDFLAGAGSLNYGHNNPVLKQAL 61

Query: 65  CKQVKT--LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQ 122
            + ++   + H  +++  E +      L       +            G           
Sbjct: 62  LEYIEMDGITHGLDMH-SEAKAGFLAALDNYILKPRKLDYKVQFTGPTGTNXXXXXXXXX 120

Query: 123 HLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALK----- 177
                +  ++  TN FHG T   + ATG   +++G          +PF     +      
Sbjct: 121 XXXXGRSSVVAFTNGFHGCTAGALAATGNQHHRQGNGSSLTNVTRIPFEGYAGVDGLALF 180

Query: 178 ------NTIG-PHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLG 230
                 N+ G     AV+LE VQGEGG+  A+  +L+ + ++C+   +LLI D++Q G G
Sbjct: 181 ETMLNDNSAGMDKPAAVLLETVQGEGGLNAASNEWLQRLSKICKANDILLIVDDIQAGCG 240

Query: 231 RTGKFLGYQHYGVEPDIITLAKALGG-GFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAA 289
           RTG F  ++  G+EPDI+TL+K++GG G P+  +L K ++ Q ++PG+H  TF GN  A 
Sbjct: 241 RTGTFFSFEPSGIEPDIVTLSKSIGGYGLPMAVVLLKPELDQ-WKPGEHNGTFRGNNHAF 299

Query: 290 TASLATMETLLQKGVLE-NAWQMGEYFKAELTKLAAEVP---LVKEVRXXXXXXXXXXXX 345
             +   +E        E +  Q  +     + +     P   + K+ R            
Sbjct: 300 ITAAKALEIYWSNDDFETHIKQCSQNVSEVIDRCVRRFPQMFVQKKGRGMMIGIECIHGD 359

Query: 346 XXKDIVAHCLEQGLLINCT--NGNVLRFLPPLIITKDEIDQAVQILKRAM 393
              +I   C + G++I     +  V++F  PL I++ E++Q + I +RA+
Sbjct: 360 LAAEIAKACFDDGMVIETAGPDDEVVKFFCPLTISESELNQGLSIFERAV 409


>BIOK_BACSU RecName: Full=Lysine-8-amino-7-oxononanoate
           aminotransferase;         EC=2.6.1.n2;AltName:
           Full=7,8-diamino-pelargonic acid aminotransferase;
          Length = 448

 Score =  137 bits (345), Expect = 2e-34
 Identities = 115/428 (26%), Positives = 185/428 (43%), Gaps = 56/428 (13%)

Query: 15  MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQV-----K 69
           M  Y   P+ +  G G  V D +G++Y D  S + +N  GH   E+ +A+ KQ+      
Sbjct: 20  MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHS 79

Query: 70  TLLHCSNIYWIEPQVKLAKLLVENSCAD--KAFFCNSGAEANEGAIKLARKYAKQHLGPD 127
           TLL  +N+    P  +LA+ L++ S     + F+ +SGAEA E A+K+A +Y K    P+
Sbjct: 80  TLLGMTNV----PATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPE 135

Query: 128 KYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAV 187
           K + I   N +HG T+  V+      +     PL       P   +   ++   P  C  
Sbjct: 136 KQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPYVYRSESG-DPDECRD 194

Query: 188 MLEP---------------------VQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQ 226
                                    VQG  G+I   + YL GV++LC    +L+I DEV 
Sbjct: 195 QCXXXXXXXXXXXXXXXXXXSIESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVA 254

Query: 227 CGLGRTGKFLGYQHYGVEPDIITLAKALGGGF-PIGAMLAKEQVAQAF-------QPGDH 278
            G GRTGK    +H  V+PD++   K + GG+ PI    A E + +AF       +   H
Sbjct: 255 TGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFH 314

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXX 338
             ++ GN L    +L  +     + ++E   +  +     L  L A +P V ++R     
Sbjct: 315 GHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFM 373

Query: 339 XXXXXXXXXK-------------DIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQA 385
                    +              +     E G+L     G+V+ FLPPL  T +E+ + 
Sbjct: 374 CGAELVRSKETKEPYPADRRIGYKVSLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEM 432

Query: 386 VQILKRAM 393
           V I+K+A+
Sbjct: 433 VAIMKQAI 440


>GSA_SALTY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  137 bits (344), Expect = 2e-34
 Identities = 103/327 (31%), Positives = 150/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+       D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +     ++
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIASI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++       L + A E  +PLV
Sbjct: 321 HETLDELTTRLAEGLCEAAQEAGIPLV 347


>GSA_SALPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  137 bits (344), Expect = 2e-34
 Identities = 104/327 (31%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+       D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAEV--PLV 329
            E   ++       L + A EV  PLV
Sbjct: 321 HETLDELTTRLAEGLCEAAQEVGIPLV 347


>GSA_SALCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  137 bits (344), Expect = 2e-34
 Identities = 104/327 (31%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+       D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAEV--PLV 329
            E   ++       L + A EV  PLV
Sbjct: 321 HETLDELTTRLAEGLCEAAQEVGIPLV 347


>GSA_PECCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  137 bits (344), Expect = 2e-34
 Identities = 100/305 (32%), Positives = 142/305 (46%), Gaps = 23/305 (7%)

Query: 16  NTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCS 75
           N  G  P+ + +  GA+++DAD + Y+D+V       LGH HP + +AV    +  L   
Sbjct: 27  NGVGGTPLFIERADGAYLYDADEQAYIDYVGSWGPMVLGHNHPAIRDAVIAAAERGLSFG 86

Query: 76  NIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITA 134
                E +V++A+L+       D     NSG EA   AI+LAR Y     G DK  II  
Sbjct: 87  AP--TEMEVQMARLVTSLVPSMDMVRMVNSGTEATMSAIRLARGYT----GRDK--IIKF 138

Query: 135 TNSFHGRTLATVTATGQ---TKYQRGLDPLPQGFAY----VPFNDLEALKNTIGPHT--- 184
              +HG     +   G    T  Q     +P  FA       +NDL +++     +    
Sbjct: 139 EGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFARHTLTCVYNDLSSVRAAFEQYPDEI 198

Query: 185 CAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVE 244
            A+++EPV G    +P    +L G++ LC+E G L I DEV  G  R        HYGV 
Sbjct: 199 AAIIVEPVAGNMNCVPPLPDFLPGLRALCDEFGALFIIDEVMTGF-RVALAGAQSHYGVV 257

Query: 245 PDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQ 301
           PD+  L K +GGG P+GA   K +V QA  P      A T  GNP+A  A  A +  + +
Sbjct: 258 PDLTCLGKIIGGGMPVGAFGGKREVMQALAPTGPVYQAGTLSGNPIAMAAGFACLTEVAK 317

Query: 302 KGVLE 306
            GV E
Sbjct: 318 PGVHE 322


>GSA_COXBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 435

 Score =  137 bits (344), Expect = 2e-34
 Identities = 102/330 (30%), Positives = 150/330 (45%), Gaps = 33/330 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH----C 74
           G +P  + K  G ++ D D ++Y+D+V       LGHAHP V +A  + V+  L     C
Sbjct: 31  GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQNGLSFGAPC 90

Query: 75  SNIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            N      ++KLA L+ E     +K    NSG EA   A++LAR          + +II 
Sbjct: 91  EN------EIKLAALIGEFMPSIEKVRMVNSGTEATMSALRLARGVT------GRSKIIK 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLE---ALKNTIGPH 183
               +HG     +   G      G+   P       Q      FNDL+   AL       
Sbjct: 139 FEGCYHGHADCLLVNAGSGALTFGMPSSPGVPLGTVQDTLTATFNDLDSVAALFEKYSKD 198

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
             A+++EP+ G   +IPAA  +L G+++LC + G LLIFDEV  G  R  K      Y +
Sbjct: 199 IAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGF-RVAKGGAQSLYNI 257

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLL 300
            PD+  L K +GGG P+GA   + ++     P      A T  GNP+A  A LAT++ L 
Sbjct: 258 RPDLTALGKIIGGGMPVGAYGGRREIMNQLSPEGPVYQAGTLSGNPVAMAAGLATLKELT 317

Query: 301 QKGVLENAWQMGEYFKAELTK--LAAEVPL 328
            +    N  +  E     +     AA++PL
Sbjct: 318 AENFYSNLKEKTERLVMGILSRAKAAKIPL 347


>GSA_COXBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 435

 Score =  137 bits (344), Expect = 2e-34
 Identities = 102/330 (30%), Positives = 150/330 (45%), Gaps = 33/330 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH----C 74
           G +P  + K  G ++ D D ++Y+D+V       LGHAHP V +A  + V+  L     C
Sbjct: 31  GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQNGLSFGAPC 90

Query: 75  SNIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            N      ++KLA L+ E     +K    NSG EA   A++LAR          + +II 
Sbjct: 91  EN------EIKLAALIGEFMPSIEKVRMVNSGTEATMSALRLARGVT------GRSKIIK 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLE---ALKNTIGPH 183
               +HG     +   G      G+   P       Q      FNDL+   AL       
Sbjct: 139 FEGCYHGHADCLLVNAGSGALTFGMPSSPGVPLGTVQDTLTATFNDLDSVAALFEKYSKD 198

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
             A+++EP+ G   +IPAA  +L G+++LC + G LLIFDEV  G  R  K      Y +
Sbjct: 199 IAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGF-RVAKGGAQSLYNI 257

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLL 300
            PD+  L K +GGG P+GA   + ++     P      A T  GNP+A  A LAT++ L 
Sbjct: 258 RPDLTALGKIIGGGMPVGAYGGRREIMNQLSPEGPVYQAGTLSGNPVAMAAGLATLKELT 317

Query: 301 QKGVLENAWQMGEYFKAELTK--LAAEVPL 328
            +    N  +  E     +     AA++PL
Sbjct: 318 AENFYSNLKEKTERLVMGILSRAKAAKIPL 347


>GSA_COXBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 435

 Score =  137 bits (344), Expect = 2e-34
 Identities = 102/330 (30%), Positives = 150/330 (45%), Gaps = 33/330 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH----C 74
           G +P  + K  G ++ D D ++Y+D+V       LGHAHP V +A  + V+  L     C
Sbjct: 31  GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQNGLSFGAPC 90

Query: 75  SNIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            N      ++KLA L+ E     +K    NSG EA   A++LAR          + +II 
Sbjct: 91  EN------EIKLAALIGEFMPSIEKVRMVNSGTEATMSALRLARGVT------GRSKIIK 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLE---ALKNTIGPH 183
               +HG     +   G      G+   P       Q      FNDL+   AL       
Sbjct: 139 FEGCYHGHADCLLVNAGSGALTFGMPSSPGVPLGTVQDTLTATFNDLDSVAALFEKYSKD 198

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
             A+++EP+ G   +IPAA  +L G+++LC + G LLIFDEV  G  R  K      Y +
Sbjct: 199 IAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGF-RVAKGGAQSLYNI 257

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLL 300
            PD+  L K +GGG P+GA   + ++     P      A T  GNP+A  A LAT++ L 
Sbjct: 258 RPDLTALGKIIGGGMPVGAYGGRREIMNQLSPEGPVYQAGTLSGNPVAMAAGLATLKELT 317

Query: 301 QKGVLENAWQMGEYFKAELTK--LAAEVPL 328
            +    N  +  E     +     AA++PL
Sbjct: 318 AENFYSNLKEKTERLVMGILSRAKAAKIPL 347


>GSA_COXB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 435

 Score =  137 bits (344), Expect = 2e-34
 Identities = 102/330 (30%), Positives = 150/330 (45%), Gaps = 33/330 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH----C 74
           G +P  + K  G ++ D D ++Y+D+V       LGHAHP V +A  + V+  L     C
Sbjct: 31  GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQNGLSFGAPC 90

Query: 75  SNIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            N      ++KLA L+ E     +K    NSG EA   A++LAR          + +II 
Sbjct: 91  EN------EIKLAALIGEFMPSIEKVRMVNSGTEATMSALRLARGVT------GRSKIIK 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLE---ALKNTIGPH 183
               +HG     +   G      G+   P       Q      FNDL+   AL       
Sbjct: 139 FEGCYHGHADCLLVNAGSGALTFGMPSSPGVPLGTVQDTLTATFNDLDSVAALFEKYSKD 198

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
             A+++EP+ G   +IPAA  +L G+++LC + G LLIFDEV  G  R  K      Y +
Sbjct: 199 IAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGF-RVAKGGAQSLYNI 257

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLL 300
            PD+  L K +GGG P+GA   + ++     P      A T  GNP+A  A LAT++ L 
Sbjct: 258 RPDLTALGKIIGGGMPVGAYGGRREIMNQLSPEGPVYQAGTLSGNPVAMAAGLATLKELT 317

Query: 301 QKGVLENAWQMGEYFKAELTK--LAAEVPL 328
            +    N  +  E     +     AA++PL
Sbjct: 318 AENFYSNLKEKTERLVMGILSRAKAAKIPL 347


>GSA_COXB1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 435

 Score =  137 bits (344), Expect = 2e-34
 Identities = 102/330 (30%), Positives = 150/330 (45%), Gaps = 33/330 (10%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLH----C 74
           G +P  + K  G ++ D D ++Y+D+V       LGHAHP V +A  + V+  L     C
Sbjct: 31  GGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILGHAHPAVIQAAQEAVQNGLSFGAPC 90

Query: 75  SNIYWIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIIT 133
            N      ++KLA L+ E     +K    NSG EA   A++LAR          + +II 
Sbjct: 91  EN------EIKLAALIGEFMPSIEKVRMVNSGTEATMSALRLARGVT------GRSKIIK 138

Query: 134 ATNSFHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLE---ALKNTIGPH 183
               +HG     +   G      G+   P       Q      FNDL+   AL       
Sbjct: 139 FEGCYHGHADCLLVNAGSGALTFGMPSSPGVPLGTVQDTLTATFNDLDSVAALFEKYSKD 198

Query: 184 TCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGV 243
             A+++EP+ G   +IPAA  +L G+++LC + G LLIFDEV  G  R  K      Y +
Sbjct: 199 IAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGF-RVAKGGAQSLYNI 257

Query: 244 EPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLL 300
            PD+  L K +GGG P+GA   + ++     P      A T  GNP+A  A LAT++ L 
Sbjct: 258 RPDLTALGKIIGGGMPVGAYGGRREIMNQLSPEGPVYQAGTLSGNPVAMAAGLATLKELT 317

Query: 301 QKGVLENAWQMGEYFKAELTK--LAAEVPL 328
            +    N  +  E     +     AA++PL
Sbjct: 318 AENFYSNLKEKTERLVMGILSRAKAAKIPL 347


>GSA_CAMHC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 450

 Score =  137 bits (344), Expect = 2e-34
 Identities = 91/290 (31%), Positives = 148/290 (51%), Gaps = 21/290 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + KG+GA+++D +G +YLDFV        GHA  ++ +AV K  K+ L      
Sbjct: 29  GSEPFMVQKGKGAYIYDIEGNKYLDFVQSWGPLIFGHADKDIQDAVIKTAKSGLSFGASS 88

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E   KLAKL++      DK  F +SG EA   AI+LAR ++    G DK  II     
Sbjct: 89  PLE--TKLAKLILSKFDWLDKIRFVSSGTEATMSAIRLARGFS----GKDK--IIKFEGC 140

Query: 138 FHGRT---LATVTATGQTKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPHTC-AVML 189
           +HG +   L                 +P+  A       +ND++++KN +       +++
Sbjct: 141 YHGHSDSLLVKXXXXXXXXXXXXXXXVPEDTAKNTYLAIYNDIDSVKNIVEKEDIGTIII 200

Query: 190 EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIIT 249
           EP+ G  G++PA + +L  ++++C+EK ++LI DEV  G  R G+   Y  YG++ DI+T
Sbjct: 201 EPIAGNMGLVPADKEFLIKLRKICDEKKIVLILDEVMSGF-RAGELGSYGIYGIKGDIVT 259

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATM 296
             K +GGG  + A   K+++     P      A T  GNP++  A +A++
Sbjct: 260 FGKVIGGGMNVAAFAGKKEIMDMISPLGPVYQAGTLSGNPVSMAAGIASL 309


>GSA2_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           2;         Short=GSA 2;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 2;
          Length = 434

 Score =  137 bits (344), Expect = 2e-34
 Identities = 92/295 (31%), Positives = 140/295 (47%), Gaps = 23/295 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   +G+G+ V+D DG +Y+D+V       LGH  P V +A+ +Q +         
Sbjct: 34  GMTPIFAERGEGSRVYDIDGNEYIDYVLSWGPLILGHRDPVVTKAIQEQAEKGWTFGTP- 92

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E + K+A+L+++     +     NSG EA   A++LAR Y        K +I+     
Sbjct: 93  -TELETKMAELVIDRVPSIEMVRMVNSGTEATMAALRLARGYT------GKTKILKFEGC 145

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALK---NTIGPHTCAV 187
           +HG   + +   G      GL   P            VP+NDL+A++      G     V
Sbjct: 146 YHGHGDSLLIKAGSGVATLGLPDSPGVPKELASHTLTVPYNDLDAVRVAFEKYGDDLAGV 205

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EP  G  G +P    +LEG++++ E+ G LLIFDEV  G  R G      ++GV PD+
Sbjct: 206 IVEPAAGNMGFVPPQPGFLEGLREITEQNGALLIFDEVMTGF-RVGYNCAQGYFGVTPDL 264

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
             L K +GGG P+GA   K ++ +   P      A T  GNPLA  A   T+  L
Sbjct: 265 TCLGKVIGGGLPVGAYGGKREIMEQIAPQGPIYQAGTLSGNPLAMIAGYTTLSQL 319


>GSA1_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 428

 Score =  137 bits (344), Expect = 2e-34
 Identities = 94/288 (32%), Positives = 146/288 (50%), Gaps = 27/288 (9%)

Query: 28  GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSNIYWIEPQVK 85
           G+G+ ++D DG +Y+D+V       LGH  P+V   + + +   T    S +     + K
Sbjct: 41  GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDKGTSFGASTLL----ENK 96

Query: 86  LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLA 144
           LA+L+++     +K    +SG EA    ++LAR Y  ++      +I+     +HG + +
Sbjct: 97  LAQLVIDRVPSIEKVRMVSSGTEATLDTLRLARGYTGRN------KIVKFEGCYHGHSDS 150

Query: 145 TVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVMLEPVQG 194
            +   G      GL     +P+G A     VP+NDL+ALK      G     V++EPV G
Sbjct: 151 LLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLDALKIAFEKFGDDIAGVIVEPVAG 210

Query: 195 EGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKAL 254
             GVIP  + +L+G++ +  E G LLIFDEV  G  R G      ++GV PD+  L K +
Sbjct: 211 NMGVIPPIEGFLQGLRDITTEYGALLIFDEVMTGF-RVGYHCAQGYFGVTPDLTCLGKVI 269

Query: 255 GGGFPIGAMLAKEQVAQAFQP-GD--HASTFGGNPLAATASLATMETL 299
           GGG P+GA   K+++     P G+   A T  GNPLA T+   T+  L
Sbjct: 270 GGGLPVGAFGGKKEIMDQIAPLGNIYQAGTLSGNPLAMTSGYETLSQL 317


>AGT2L_CAEEL RecName: Full=Alanine--glyoxylate aminotransferase
           2-like;         EC=2.6.1.-;
          Length = 467

 Score =  137 bits (344), Expect = 2e-34
 Identities = 112/431 (25%), Positives = 194/431 (45%), Gaps = 63/431 (14%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y   P  + +    +++D    ++LD +S   V  +GH HP+V EA+ KQ+ T     N+
Sbjct: 46  YSDDPFMVSRASMQYLYDEKSNKFLDCISN--VQHVGHCHPKVVEAISKQLAT--STCNV 101

Query: 78  YWIEPQVK--LAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITAT 135
            ++  Q+     ++L      D   FCNSG+EAN+ A++LAR Y K        + I   
Sbjct: 102 RFVSTQLTDCAEQILSTLPGLDTVLFCNSGSEANDLALRLARDYTKHK------DAIVIE 155

Query: 136 NSFHGRTLATVTATGQTKYQRG----------LDPLPQGFA----------------YVP 169
           +++HG    T+  +   K+  G          + P P  F                 Y  
Sbjct: 156 HAYHGHVTTTMELSPY-KFDHGSTVSQPDWVHVAPCPDVFRGKHRLADNELTNEDKLYAA 214

Query: 170 ----FNDLEALKNTIGPHTCAV---MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIF 222
                +D++++ N +    C V     E +Q  GG +   + Y + V       G L+I 
Sbjct: 215 GKQYSDDVKSILNDVESRQCGVAAYFAEALQSCGGQVIPPKDYFKDVATHVRNHGGLMII 274

Query: 223 DEVQCGLGRTG-KFLGYQHY--GVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPG-DH 278
           DEVQ G GR G K+  +Q Y  G  PDI+T+ K +G GFP+ A+  ++++A A      +
Sbjct: 275 DEVQTGFGRIGRKYWAHQLYDDGFLPDIVTMGKPMGNGFPVSAVATRKEIADALGGEVGY 334

Query: 279 ASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXX 338
            +T+GGNP+A  A ++ M+ +  + +LE++ QMGE  +  L  L  +   + ++R     
Sbjct: 335 FNTYGGNPVACAAVISVMKVVKDENLLEHSQQMGEKLEVALRDLQKKHECIGDIRGVGLF 394

Query: 339 XXXXXXXXXK-----------DIVAHCLEQGLLINC--TNGNVLRFLPPLIITKDEIDQA 385
                                 I+A     G+L+N    + N+L+  PPL   ++ I + 
Sbjct: 395 WGIDLVKDRNTREPDQKLAIATILALRKSYGILLNADGPHTNILKIKPPLCFNENNILET 454

Query: 386 VQILKRAMLVV 396
           V  L + + ++
Sbjct: 455 VTALDQVLTLM 465


>GSA_SYNR3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 434

 Score =  136 bits (343), Expect = 3e-34
 Identities = 92/302 (30%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+   + +GA+ WD DG +Y+D++        GHA+PEV EA+ + +          
Sbjct: 38  GGQPIVFDRVEGAYAWDVDGNRYIDYIGSWGPAICGHANPEVIEALQQALTKGTSFGAPC 97

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E    LA++++      +   F NSG EA    ++L R Y  +       ++I     
Sbjct: 98  ALENT--LAEMVINAVPSVEMVRFVNSGTEACMAVLRLMRAYTGRE------KVIKFEGC 149

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTIGPHT---CAV 187
           +HG     +   G      GL   P             P+NDLEA+K     +      V
Sbjct: 150 YHGHADMFLVKAGSGVATLGLPDSPGVPSSTTANTLTAPYNDLEAVKALFAENPDSISGV 209

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           +LEPV G  G IP    +LEG++++  E G LL+FDEV  G  R         +G+ PD+
Sbjct: 210 ILEPVVGNAGFIPPDFGFLEGLREITREYGALLVFDEVMTGF-RISYGGAQARFGITPDL 268

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
            T+ K +GGG P+GA   ++ + +   P      A T  GNPLA TA + T+E L + G 
Sbjct: 269 TTMGKVIGGGLPVGAYGGRKDIMEMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLKRPGT 328

Query: 305 LE 306
            E
Sbjct: 329 YE 330


>GSA_SHIDS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_SHIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPQPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_SHIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPQPEFLPGLRALCDEFGTLLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_SALPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 103/327 (31%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+       D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++       L + A E  +PLV
Sbjct: 321 HETLDELTTRLAEGLCEAAQEAGIPLV 347


>GSA_SALPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 103/327 (31%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+       D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++       L + A E  +PLV
Sbjct: 321 HETLDELTTRLAEGLCEAAQEAGIPLV 347


>GSA_SALHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 103/327 (31%), Positives = 149/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+       D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E   ++       L + A E  +PLV
Sbjct: 321 HETLDELTTRLAEGLCEAAQEAGIPLV 347


>GSA_NAUPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 420

 Score =  136 bits (343), Expect = 3e-34
 Identities = 89/293 (30%), Positives = 146/293 (49%), Gaps = 21/293 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P  + KG+GA+++D +G +YLD++        GH   ++ +A+C  V   +      
Sbjct: 26  GGEPPFIEKGEGAYIYDINGNKYLDYIQSWGPLIFGHCDKDIEKAICNAVSKGVSFGAPT 85

Query: 79  WIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  V+LAK +++     D   F NSG EA   AI++AR  +       K +II     
Sbjct: 86  TVE--VELAKEVLDLFPHLDLIRFVNSGTEATMSAIRVARGVS------GKDDIIKFEGC 137

Query: 138 FHGRTLATVTATGQTKYQRGLDPLP-------QGFAYVPFNDLEALKNTI-GPHTCAVML 189
           +HG + + + + G      G    P       +      +ND+E++K      +   V++
Sbjct: 138 YHGHSDSLLVSAGSGAATFGTPSSPGVPADFTKHTLLAKYNDIESVKKCFENGNVGCVII 197

Query: 190 EPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIIT 249
           EP+ G   ++PA + +L  +++LC + G +LIFDEV  G  R G    Y  YG+E DI+T
Sbjct: 198 EPIAGNMSLVPAEKEFLTELRELCTKNGAILIFDEVMSGF-RAGLRGSYDVYGIEADIVT 256

Query: 250 LAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETL 299
             K +GGG P+GA   K+ + +   P      A T  GNP+A +A LA ++ L
Sbjct: 257 FGKVIGGGMPVGAFAGKKVIMEQLSPEGPIYQAGTLSGNPVAMSAGLAMLKKL 309


>GSA_ENT38 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 104/327 (31%), Positives = 150/327 (45%), Gaps = 25/327 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + +  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIERADGAFLYDVDGKAYIDYVGSWGPMVLGHNHPTIRNAVIEAAQRGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAELVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL+ ++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLDTVRAAFEQYPQEVACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP    +L G++ LC+E G LLI DEV  G  R        +Y V PD+
Sbjct: 202 IVEPVAGNMNCIPPQPDFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQSYYDVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   ++ V +A  P      A T  GNP+A  A  A +  + Q G+
Sbjct: 261 TCLGKIIGGGMPVGAFGGRKDVMEALAPTGPVYQAGTLSGNPIAMAAGFACLTEVAQPGI 320

Query: 305 LENAWQMGEYFKAELTKLAAE--VPLV 329
            E    +       L + A E  VPLV
Sbjct: 321 HETLTDLTAQLANGLLEAAEETGVPLV 347


>GSA_ECOSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOLI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKYTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECODH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKYTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECOBW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKYTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>GSA_ECO7I RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 426

 Score =  136 bits (343), Expect = 3e-34
 Identities = 99/302 (32%), Positives = 140/302 (46%), Gaps = 23/302 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K  GA+++D DG+ Y+D+V       LGH HP +  AV +  +  L      
Sbjct: 30  GGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAP- 88

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
             E +VK+A+L+ E     D     NSG EA   AI+LAR +     G DK  II     
Sbjct: 89  -TEMEVKMAQLVTELVPTMDMVRMVNSGTEATMSAIRLARGFT----GRDK--IIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG     +   G    T  Q     +P  FA       +NDL +++     +      +
Sbjct: 142 YHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACI 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    +P    +L G++ LC+E G LLI DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYGVVPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   +  V  A  P      A T  GNP+A  A  A +  + Q GV
Sbjct: 261 TCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGV 320

Query: 305 LE 306
            E
Sbjct: 321 HE 322


>AT2L1_DANRE RecName: Full=Alanine--glyoxylate aminotransferase
           2-like 1;         EC=2.6.1.-;
          Length = 492

 Score =  136 bits (343), Expect = 3e-34
 Identities = 109/425 (25%), Positives = 198/425 (46%), Gaps = 62/425 (14%)

Query: 22  PMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIE 81
           P+ +V+ +G ++++    +YLD ++ +A   +GH HP+V  A  KQ++ L   +N  ++ 
Sbjct: 31  PIKIVRAKGQYMYNEKDEKYLDCINNVAH--VGHCHPDVVSAGAKQMELLN--TNSRFLH 86

Query: 82  PQVKLAKLLVENSCADK---AFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSF 138
             + L    ++ +  +K    +F NSG+EAN+ A++LA +Y          +IIT  N++
Sbjct: 87  DSLVLYAQRLQATLPEKLSVCYFVNSGSEANDLALRLAWQYTGHK------DIITLDNAY 140

Query: 139 HGRTLATVTATGQTKYQRGLDPLPQGFAYVPFND------------------LEALKNTI 180
           HG   + +  +   K+ +     P    +V  +                    E +K  I
Sbjct: 141 HGHVSSLIDISPY-KFHQMAGAEPSQHVHVALSPDTYRGKYREDHPDPATAYAENVKEVI 199

Query: 181 ------GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGK 234
                 G    A + E +Q  GG +     Y + V Q     G + I DEVQ G GR G 
Sbjct: 200 EEAHKKGHEIAAFIAESLQSCGGQVIPPMGYFQKVAQHVRNAGGIFIADEVQVGFGRVGT 259

Query: 235 -FLGYQHYGVE--PDIITLAKALGGGFPIGAMLAKEQVAQAFQPG--DHASTFGGNPLAA 289
            F G+Q  G +  PDI+T+ K +G G P+  ++   ++A++F     ++ +TFGGNP++ 
Sbjct: 260 HFWGFQLQGEDFVPDIVTMGKPIGNGHPMSCVITSREIAESFMSSGMEYFNTFGGNPVSC 319

Query: 290 TASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVR----------XXXXXX 339
              LA +  + ++ +  NA  +G Y    L  L    PLV +VR                
Sbjct: 320 AIGLAVLNVIEKEDLQGNALHVGGYLTQLLEDLKKRHPLVGDVRGRGLFVGLELVRNQSK 379

Query: 340 XXXXXXXXKDIVAHCLEQGLLINC--TNGNVLRFLPPLIITKDE-------IDQAVQILK 390
                   ++++    EQ +L++    + NVL+F PP+  ++++       IDQ +  L+
Sbjct: 380 RTPATAEAQEVIYRLKEQRILLSADGPHRNVLKFKPPMCFSREDAEFAVEKIDQILTDLE 439

Query: 391 RAMLV 395
           +AM++
Sbjct: 440 KAMVL 444


>GSA_PICTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 420

 Score =  136 bits (342), Expect = 4e-34
 Identities = 96/297 (32%), Positives = 149/297 (50%), Gaps = 25/297 (8%)

Query: 18  YGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNI 77
           Y  +P+   +G+G+ ++D +G++Y+D+  G     LGHA P+VA A+ +Q    +   +I
Sbjct: 25  YRPVPVMFERGRGSRIYDVNGKEYIDYSLGFGPMILGHADPDVASAIKRQADNGILFGSI 84

Query: 78  YWIEPQVKLAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATN 136
              E +V+L  ++  +    +K  F NSG EA   AI+LAR Y K+     KY I+    
Sbjct: 85  --TENEVRLGNIIKNHVKSIEKMRFTNSGTEATMHAIRLARGYTKR-----KY-ILKMEG 136

Query: 137 SFHGRTLATVTATGQTKYQRGL---DPLPQGFA-------YVPFNDLEALKNTIGPHTCA 186
            FHG     +  +G      G+   + +P+          Y   N +E+L N  G    A
Sbjct: 137 GFHGAHDYALIKSGSGTMTFGVPSSNGVPEEITKTVLVGKYNDENSIESLFNEYGNDIAA 196

Query: 187 VMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH-YGVEP 245
           V+ EP+ G  GVI     +LE ++++  +   LLIFDEV  G      F GYQ    ++P
Sbjct: 197 VITEPILGNIGVINPEPGFLEFLREITNKYNSLLIFDEVITGF--RFAFSGYQDIINIKP 254

Query: 246 DIITLAKALGGGFPIGAMLAKEQVAQAFQPGDH---ASTFGGNPLAATASLATMETL 299
           DI T+ K +GGG PIG   +  ++     P  +   + TF GNPL+  A +A ME L
Sbjct: 255 DITTMGKIIGGGAPIGLFGSSSEIMDLISPSGNVYESGTFSGNPLSMAAGIAAMEKL 311


>GSA_PASMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  136 bits (342), Expect = 4e-34
 Identities = 96/309 (31%), Positives = 147/309 (47%), Gaps = 23/309 (7%)

Query: 19  GRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIY 78
           G  P+ + K QGA+++D +G QY+D+V       LGH HP + +AV    +  L      
Sbjct: 30  GGTPIFIEKAQGAYLYDTEGNQYIDYVGSWGPMILGHNHPTILDAVISTAQNGLSFGAPT 89

Query: 79  WIEPQVKLAKLLVE-NSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNS 137
            +E  ++LA+L+       D     +SG EA   AI+LAR Y K+       +II     
Sbjct: 90  ALE--IELAELVCSLVPSIDMVRMVSSGTEATMSAIRLARGYTKRD------KIIKFEGC 141

Query: 138 FHGRTLATVTATGQ---TKYQRGLDPLPQGFA----YVPFNDLEALKNTIGPH---TCAV 187
           +HG   + +   G    T  Q     +P  FA       +NDL+++K+    +      +
Sbjct: 142 YHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTCTYNDLDSVKHAFEQYPNEIACL 201

Query: 188 MLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDI 247
           ++EPV G    IP  + +L+G++ LC++ G + I DEV  G  R        +YGV PD+
Sbjct: 202 IVEPVAGNMNCIPPQEGFLQGLRALCDQYGAVFIIDEVMTGF-RVALGGAQTYYGVTPDL 260

Query: 248 ITLAKALGGGFPIGAMLAKEQVAQAFQPGD---HASTFGGNPLAATASLATMETLLQKGV 304
             L K +GGG P+GA   K+ + Q   P      A T  GNP+A  A LA +  L + G 
Sbjct: 261 TCLGKVIGGGMPVGAFGGKKAIMQHIAPLGPVYQAGTLSGNPIAMAAGLACLTELKKAGN 320

Query: 305 LENAWQMGE 313
            +   Q  E
Sbjct: 321 AQRLAQQTE 329


>GSA_CLOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
                 Short=GSA;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase;
          Length = 427

 Score =  136 bits (342), Expect = 4e-34
 Identities = 110/361 (30%), Positives = 167/361 (46%), Gaps = 46/361 (12%)

Query: 1   MNNQEILAMGQQYV----------MNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAV 50
           MNN EI    ++Y+              G  P  +  G+G  + D DG++Y+DFV     
Sbjct: 1   MNNLEIFEESKKYMPGGVNSPVRCFKEMGMNPPVIKSGKGVIIKDEDGKEYIDFVLAWGP 60

Query: 51  NCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVEN-SCADKAFFCNSGAEAN 109
             LGH   +V +A+ +  +  L       +E  ++L+K + EN    D     NSG EA 
Sbjct: 61  LLLGHCDEDVVKAIKETSENALAFGAPTKLE--LELSKFMCENLDNVDMIRMVNSGTEAT 118

Query: 110 EGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVP 169
             A+KLAR Y        K +I+     +HG     +   G      G+     G   VP
Sbjct: 119 MSAVKLARGYT------GKSKIVKFAGCYHGHFDGFLIEAGSGVLTEGIP----GSLGVP 168

Query: 170 -----------FNDLEALKNTI---GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEE 215
                      +ND   +K      G    AV++EPV G  GVI A + +++ ++ LC+E
Sbjct: 169 KESVENTLIGLYNDKTQIKELFKKQGNEIAAVIIEPVAGNMGVIKANEDFIKELRSLCDE 228

Query: 216 KGLLLIFDEVQCGLGRTGKFLGYQH-YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQ 274
            G LLIFDEV  G      F G Q  + ++PD+IT AK +GGG P GA   K+++ +   
Sbjct: 229 YGALLIFDEVMTGF--RVAFKGAQTLFDIKPDLITYAKIMGGGLPCGAYAGKKEIMEKLS 286

Query: 275 PGD---HASTFGGNPLAATASLATMETLLQK-GVLENAWQMGEYFKAELTKLAAE--VPL 328
           P      A T  GNP+  +A LAT+  L     + ++  ++GE  +  L K++ E  VPL
Sbjct: 287 PCGGVYQAGTMSGNPVVMSAGLATLTKLKNNIELYDHVEKIGEKLQEGLIKISKENDVPL 346

Query: 329 V 329
           +
Sbjct: 347 I 347


>GSA1_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
           1;         Short=GSA 1;         EC=5.4.3.8;AltName:
           Full=Glutamate-1-semialdehyde aminotransferase 1;
          Length = 428

 Score =  136 bits (342), Expect = 4e-34
 Identities = 93/288 (32%), Positives = 146/288 (50%), Gaps = 27/288 (9%)

Query: 28  GQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVK--TLLHCSNIYWIEPQVK 85
           G+G+ ++D DG +Y+D+V       LGH  P+V   + + +   T    S +     + K
Sbjct: 41  GKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDKGTSFGASTLL----ENK 96

Query: 86  LAKLLVEN-SCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLA 144
           LA+L+++     +K    +SG EA    ++LAR Y  ++      +I+     +HG + +
Sbjct: 97  LAQLVIDRVPSIEKVRMVSSGTEATLDTLRLARGYTGRN------KIVKFEGCYHGHSDS 150

Query: 145 TVTATGQTKYQRGLDP---LPQGFAY----VPFNDLEALK---NTIGPHTCAVMLEPVQG 194
            +   G      GL     +P+G A     VP+NDL+ALK      G     V++EPV G
Sbjct: 151 LLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLDALKIAFEKFGDDIAGVIVEPVAG 210

Query: 195 EGGVIPAA