BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO49306.1 dred0 ABO49306.1 GIB00494CH01 "protein of unknown
function UPF0118"
         (343 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YRRI_BACSU RecName: Full=UPF0118 membrane protein yrrI;               160   2e-41
YUEF_BACSU RecName: Full=UPF0118 membrane protein yueF;               119   3e-29
YUBA_BACSU RecName: Full=UPF0118 membrane protein yubA;               116   3e-28
PERM_HAEIN RecName: Full=Putative permease perM homolog;              107   1e-25
TQSA_SHIFL RecName: Full=AI-2 transport protein tqsA;AltName: Fu...    94   2e-21
TQSA_ECOLI RecName: Full=AI-2 transport protein tqsA;AltName: Fu...    94   2e-21
YHHT_ECOLI RecName: Full=UPF0118 inner membrane protein yhhT;          75   1e-15
YHHT_ECO57 RecName: Full=UPF0118 inner membrane protein yhhT;          75   1e-15
Y1211_METTH RecName: Full=UPF0118 membrane protein MTH_1211;           74   1e-15
PERM_ECOLI RecName: Full=Putative permease perM;                       73   4e-15
PERM_ECO57 RecName: Full=Putative permease perM;                       73   4e-15
Y063_SYNY3 RecName: Full=UPF0118 membrane protein sll0063;             70   4e-14
Y1800_ARCFU RecName: Full=UPF0118 membrane protein AF_1800;            67   2e-13
YCT2_BACPF RecName: Full=UPF0118 membrane protein in ctaF 3'regi...    64   2e-12
Y1187_THEMA RecName: Full=UPF0118 membrane protein TM_1187;            59   8e-11
Y060_SYNY3 RecName: Full=UPF0118 membrane protein sll0060;             58   1e-10
YDBI_BACSU RecName: Full=UPF0118 membrane protein ydbI;                57   2e-10
Y630_RICPR RecName: Full=UPF0118 membrane protein RP630;               50   3e-08
YTVI_BACSU RecName: Full=UPF0118 membrane protein ytvI;                48   1e-07
Y006_BORBU RecName: Full=UPF0118 membrane protein BB_0006;             41   2e-05
Y553_TREPA RecName: Full=UPF0118 membrane protein TP_0553;             37   2e-04
Y1177_METJA RecName: Full=UPF0118 membrane protein MJ1177;             35   0.001

>YRRI_BACSU RecName: Full=UPF0118 membrane protein yrrI;
          Length = 353

 Score =  160 bits (405), Expect = 2e-41
 Identities = 91/287 (31%), Positives = 153/287 (53%), Gaps = 2/287 (0%)

Query: 49  LVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIV 108
           + E +  +G PR ++IL++Y+         L  GVP ++ QL  + ENIP++ +    ++
Sbjct: 59  VTEWLHGKGLPRTLSILVIYVLFFGGIGWALYKGVPVLIVQLTDLSENIPMFAETYNGLL 118

Query: 109 RNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSNLFYIALAPVLAF 168
            ++     D   P G+   +D+ IR  E+     +  ++  +  +L      A  P L F
Sbjct: 119 LHVHNHTDD--WPDGMHHRIDKMIRQTEAFFAGTIEGAISGIRNVLDYFLIAATIPFLVF 176

Query: 169 YIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMV 228
           Y++KD++L+K     + PK   +      R VDD   ++IRG L V +I+G+++ ++F V
Sbjct: 177 YMVKDIELMKKTVWYLTPKSWRKRGSAFLRDVDDSLGDYIRGQLLVCLILGVIAGISFWV 236

Query: 229 IGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLIIQQVEGNI 288
            GL              +IPYFGP IGA PA+ IA+  S    L V++ V I+Q +EGNI
Sbjct: 237 FGLPYPLILGLISGVTNVIPYFGPFIGAVPALLIAMTISVKAVLVVVITVFILQFMEGNI 296

Query: 289 ISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIV 335
           +SP I+G  + +HP+VI+           I GM+LAVP  A++K+++
Sbjct: 297 LSPFIVGRSLKMHPVVIMXXXXXXXXXXXIVGMILAVPATAVLKVMM 343


>YUEF_BACSU RecName: Full=UPF0118 membrane protein yueF;
          Length = 369

 Score =  119 bits (299), Expect = 3e-29
 Identities = 78/306 (25%), Positives = 143/306 (46%), Gaps = 13/306 (4%)

Query: 35  PFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMV 94
           P ++A +L ++ NP+V  +EK+  PR                       P +  Q+  + 
Sbjct: 43  PMLIAGILYFIFNPVVRLLEKK-IPRTXXXXXXXXXXXXXXXXXSASVGPIITAQVTGLF 101

Query: 95  ENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMALL 154
            N+P Y  Q++ + +++      + M    Q  V   I  +E  + + ++     + + L
Sbjct: 102 NNLPDYIKQIQALTKDLSHSQWFTWMMN--QDYVS--ISKIEQSLTSFLQNLPQNITSSL 157

Query: 155 SNLF--------YIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSN 206
           S +F             P + FY++KD     +    I+P     +   + + + D  + 
Sbjct: 158 SAVFGXXXXXXXXXXXXPFILFYMLKDGHRFPHLAVKILPASYRTEGLKIFKDLSDTLAA 217

Query: 207 FIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLH 266
           + +G L + + VG    + +++ GL              +IPY GP +GAAPAV +  + 
Sbjct: 218 YFQGQLLICLFVGTACFIGYLIAGLPYALILGIVMAITNIIPYVGPFLGAAPAVIVGFMD 277

Query: 267 SKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVP 326
           S    L  I+ V+I+QQ++GN++SP ++G  +  HPL II+ L+  G   GI GM+LAVP
Sbjct: 278 SPAKALFAIIVVVIVQQLDGNLLSPLVIGKRLNTHPLTIILLLIGAGSFGGILGMILAVP 337

Query: 327 LAAIIK 332
           + A++K
Sbjct: 338 VYAVVK 343


>YUBA_BACSU RecName: Full=UPF0118 membrane protein yubA;
          Length = 388

 Score =  116 bits (291), Expect = 3e-28
 Identities = 81/319 (25%), Positives = 140/319 (43%), Gaps = 14/319 (4%)

Query: 34  VPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKM 93
           +P IL  ++ Y+LNP+V+ +E                             P +  Q+  +
Sbjct: 56  LPIILTGIVFYLLNPVVDFLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFLKEQIMSL 115

Query: 94  VENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRV----LAIVRKSM-- 147
           ++NIP Y D VE    N  K+   S+     QQ ++  I  + ++V      IV  +   
Sbjct: 116 IDNIPRYVDVVE----NQTKQLIGSNFVNQAQQTMNINISDLATKVSDQAATIVNSTFTG 171

Query: 148 --DLLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFS 205
             + + AL   +  I   P + FY++KD + +  +    VP  L E  + +  +++   S
Sbjct: 172 VGNFIGALTEIIISIVTVPFILFYLLKDGRKLPVYILKFVPTRLKEQTYTVLSEMNHRLS 231

Query: 206 NFIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALL 265
           ++IRG + V                 +             ++PY G             +
Sbjct: 232 SYIRGQIIVSXXXXXXXXXXXXXXXXDYASLLAVIAACTSIVPYLGXXXXXXXXXXXXXV 291

Query: 266 HSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAV 325
            S  M LK+++   I+Q +EG +ISP+IMG  + +HP+ II  LL  G LFG+ G++LA+
Sbjct: 292 TSPLMLLKLVIVWTIVQLIEGKLISPQIMGKNLHIHPITIIFLLLTAGKLFGVVGIILAI 351

Query: 326 PLAAIIKIIVS--FVWRKL 342
           P  A+ K+I +  F W K+
Sbjct: 352 PGYAVAKVITTHLFDWFKM 370


>PERM_HAEIN RecName: Full=Putative permease perM homolog;
          Length = 349

 Score =  107 bits (268), Expect = 1e-25
 Identities = 74/308 (24%), Positives = 146/308 (47%), Gaps = 10/308 (3%)

Query: 35  PFILAIVLVYMLN-PLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKM 93
           P ++A+VL Y+L  P+    +    PR++A ++++   + +A    +  VP + NQ   +
Sbjct: 41  PLLIALVLSYLLEIPINFLNQYLKCPRMLATILIFGSFIGLAAVFFLVLVPMLWNQTISL 100

Query: 94  VENIPLYTDQVEEIVRNIQKRFA---DSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLL 150
           + ++P   ++  E + N+ K +    D SM   +   V E+I        + V+ S+  +
Sbjct: 101 LSDLPAMFNKSNEWLLNLPKNYPELIDYSMVDSIFNSVREKILGFGE---SAVKLSLASI 157

Query: 151 MALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG 210
           M L+S   Y  L P++ F+++KD   +       +PK      F   +++    SN+I G
Sbjct: 158 MNLVSLGIYAFLVPLMMFFMLKDKSELLQGVSRFLPKNR-NLAFXRWKEMQQQISNYIHG 216

Query: 211 HLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLHSKYM 270
            L  ++IV +++ + F++ GL              L+PY G +I   P   +AL      
Sbjct: 217 KLLEILIVTLITYIIFLIFGLNYPLLLAFAVGLSVLVPYIGAVIVTIPVALVALFQFGIS 276

Query: 271 TL--KVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLA 328
                +I+A  + Q ++GN++ P +    + LHPL+II++               A+PLA
Sbjct: 277 PTFWYIIIAFAVSQLLDGNLLVPYLFSEAVNLHPLIIIISXXXXXXXXXXXXXXXAIPLA 336

Query: 329 AIIKIIVS 336
            ++K +++
Sbjct: 337 TLVKAVIN 344


>TQSA_SHIFL RecName: Full=AI-2 transport protein tqsA;AltName:
           Full=Transport of quorum-sensing signal protein;
          Length = 344

 Score = 93.6 bits (231), Expect = 2e-21
 Identities = 77/304 (25%), Positives = 137/304 (45%), Gaps = 19/304 (6%)

Query: 34  VPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKM 93
           VPFILA+ +  +LNPLV+ M +   PRV+A+ IL   +V+    LL Y    + + L ++
Sbjct: 35  VPFILALFIAVILNPLVQHMVRWRVPRVLAVSILMTIIVMAMVLLLAY----LGSALNEL 90

Query: 94  VENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMAL 153
              +P Y + +   ++ ++          G+   VD+   +++                 
Sbjct: 91  TRTLPQYRNSIMTPLQALEPLL----QRVGIDVSVDQLAHYIDPXXXXXXXXXXXXXXXX 146

Query: 154 -LSNLFYIALAPVLAFYIMKDL--KLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG 210
            +S++F            +  L  K  +   R       VE +  + R +D V S+++  
Sbjct: 147 XMSSIFXXXXXXXXXXXEVPQLPGKFQQMMARP------VEGMAAIQRAIDSV-SHYLVL 199

Query: 211 HLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVG-IALLHSKY 269
              + +I G+++      + +               IP  G ++ A P +  + + +  Y
Sbjct: 200 KTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIGSVLAAIPPIAQVLVFNGFY 259

Query: 270 MTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAA 329
             L V+   L+I  V GNI+ P+IMG  +GL  LV+ ++L+  G L G  GMLL+VPL  
Sbjct: 260 EALLVLAGYLLINLVFGNILEPRIMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTI 319

Query: 330 IIKI 333
           I+KI
Sbjct: 320 IVKI 323


>TQSA_ECOLI RecName: Full=AI-2 transport protein tqsA;AltName:
           Full=Transport of quorum-sensing signal protein;
          Length = 344

 Score = 93.6 bits (231), Expect = 2e-21
 Identities = 77/304 (25%), Positives = 137/304 (45%), Gaps = 19/304 (6%)

Query: 34  VPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKM 93
           VPFILA+ +  +LNPLV+ M +   PRV+A+ IL   +V+    LL Y    + + L ++
Sbjct: 35  VPFILALFIAVILNPLVQHMVRWRVPRVLAVSILMTIIVMAMVLLLAY----LGSALNEL 90

Query: 94  VENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMAL 153
              +P Y + +   ++ ++          G+   VD+   +++                 
Sbjct: 91  TRTLPQYRNSIMTPLQALEPLL----QRVGIDVSVDQLAHYIDPXXXXXXXXXXXXXXXX 146

Query: 154 -LSNLFYIALAPVLAFYIMKDL--KLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG 210
            +S++F            +  L  K  +   R       VE +  + R +D V S+++  
Sbjct: 147 XMSSIFXXXXXXXXXXXEVPQLPGKFQQMMARP------VEGMAAIQRAIDSV-SHYLVL 199

Query: 211 HLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVG-IALLHSKY 269
              + +I G+++      + +               IP  G ++ A P +  + + +  Y
Sbjct: 200 KTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIGSVLAAIPPIAQVLVFNGFY 259

Query: 270 MTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAA 329
             L V+   L+I  V GNI+ P+IMG  +GL  LV+ ++L+  G L G  GMLL+VPL  
Sbjct: 260 EALLVLAGYLLINLVFGNILEPRIMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTI 319

Query: 330 IIKI 333
           I+KI
Sbjct: 320 IVKI 323


>YHHT_ECOLI RecName: Full=UPF0118 inner membrane protein yhhT;
          Length = 349

 Score = 74.7 bits (182), Expect = 1e-15
 Identities = 69/303 (22%), Positives = 139/303 (45%), Gaps = 17/303 (5%)

Query: 34  VPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKM 93
           V  +LA+    +LNPLV    +RG  R VAI I+ + ++I  T+L+  GV  +     + 
Sbjct: 35  VQLLLALFFAIVLNPLVTWFIRRGVQRPVAITIVVVVMLIALTALV--GV--LAASFNEF 90

Query: 94  VENIPLYTDQVEEIVRNIQKR--FADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLM 151
           +  +P +  ++   +  +Q+   F +  M P      +  ++ ++S    +V  +  L+ 
Sbjct: 91  ISMLPKFNKELTRKLFKLQEMLPFLNLHMSP------ERMLQRMDSE--KVVTFTTALMT 142

Query: 152 ALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRGH 211
            L   +               +++ +    R  +    +  +  L R +  V S+++   
Sbjct: 143 GLSGAMASXXXXXXXXXXXXXEVRHVPYKMRFALNNPQIH-IAGLHRALKGV-SHYLALK 200

Query: 212 LTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPA-VGIALLHSKYM 270
             + +  G++  L   ++G++              +P  G +I A P  + + L +  Y 
Sbjct: 201 TLLSLWTGVIVWLGLELMGVQFALMWAVLAFLLNYVPNIGAVISAVPPMIQVLLFNGVYE 260

Query: 271 TLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAI 330
            + V    L++  V GNI+ P++MG+ +G+  +V+ ++LL  G L G  GMLL+VPL ++
Sbjct: 261 CILVGALFLVVHMVIGNILEPRMMGHRLGMSTMVVFLSLLIWGWLLGPVGMLLSVPLTSV 320

Query: 331 IKI 333
            KI
Sbjct: 321 CKI 323


>YHHT_ECO57 RecName: Full=UPF0118 inner membrane protein yhhT;
          Length = 349

 Score = 74.7 bits (182), Expect = 1e-15
 Identities = 69/303 (22%), Positives = 139/303 (45%), Gaps = 17/303 (5%)

Query: 34  VPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKM 93
           V  +LA+    +LNPLV    +RG  R VAI I+ + ++I  T+L+  GV  +     + 
Sbjct: 35  VQLLLALFFAIVLNPLVTWFIRRGVQRPVAITIVVVVMLIALTALV--GV--LAASFNEF 90

Query: 94  VENIPLYTDQVEEIVRNIQKR--FADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLM 151
           +  +P +  ++   +  +Q+   F +  M P      +  ++ ++S    +V  +  L+ 
Sbjct: 91  ISMLPKFNKELTRKLFKLQEMLPFLNLHMSP------ERMLQRMDSE--KVVTFTTALMT 142

Query: 152 ALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRGH 211
            L   +               +++ +    R  +    +  +  L R +  V S+++   
Sbjct: 143 GLSGAMASXXXXXXXXXXXXXEVRHVPYKMRFALNNPQIH-IAGLHRALKGV-SHYLALK 200

Query: 212 LTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPA-VGIALLHSKYM 270
             + +  G++  L   ++G++              +P  G +I A P  + + L +  Y 
Sbjct: 201 TLLSLWTGVIVWLGLELMGVQFALMWAVLAFLLNYVPNIGAVISAVPPMIQVLLFNGVYE 260

Query: 271 TLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAI 330
            + V    L++  V GNI+ P++MG+ +G+  +V+ ++LL  G L G  GMLL+VPL ++
Sbjct: 261 CILVGALFLVVHMVIGNILEPRMMGHRLGMSTMVVFLSLLIWGWLLGPVGMLLSVPLTSV 320

Query: 331 IKI 333
            KI
Sbjct: 321 CKI 323


>Y1211_METTH RecName: Full=UPF0118 membrane protein MTH_1211;
          Length = 334

 Score = 74.3 bits (181), Expect = 1e-15
 Identities = 60/300 (20%), Positives = 134/300 (44%), Gaps = 40/300 (13%)

Query: 38  LAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVENI 97
           L  V  Y++ P+  R+ +R     V+I++  + V++    +L++ V  ++N    ++   
Sbjct: 36  LGAVFAYIVRPVALRINRRIPYLSVSIILAMIVVIMPLVGILVFTVDSIINSAPSLLS-- 93

Query: 98  PLYTDQVEEIVRNIQKRFADSSMPPG---VQQIVDERIRWVESRVLAIVRKSMDLLMALL 154
                             A S   PG   +Q   +  +  + + +  I+  S++ ++A+L
Sbjct: 94  -----------------LAGSIHVPGAGNLQPSAENTLANLRTVLRDILSGSLNYVVAIL 136

Query: 155 SNLFYIALAPVL----AFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG 210
            ++  I+L   +     FY  +D K +  + R+++P+E    +  +A + + V  +   G
Sbjct: 137 QSVPMISLQLFVFLSSTFYFARDGKRLVGYIRTLIPEETRPFMERMASETERVLLSIFYG 196

Query: 211 HLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLHSKYM 270
           H    + +G+++++ F ++G              +LIP  GP     P     L    ++
Sbjct: 197 HFLTALAIGLMAAVGFHLLGYPYAILLGIMTGLFQLIPVIGPWAAYTP-----LSIYDFV 251

Query: 271 TLKVILAVLIIQQVEGNIIS-------PKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLL 323
           T  ++  VL++  + G  +S       PK+ G    +HP++ +V  L G  ++G+AG ++
Sbjct: 252 TGNILRGVLVL--IFGLFLSTIDIYLRPKLSGKYADIHPMIFLVGFLGGPVVWGVAGFIV 309


>PERM_ECOLI RecName: Full=Putative permease perM;
          Length = 353

 Score = 72.8 bits (177), Expect = 4e-15
 Identities = 64/251 (25%), Positives = 117/251 (46%), Gaps = 15/251 (5%)

Query: 93  MVENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVL----AIVRKSMD 148
           ++ ++P   +++ +    + +R+  + M  G+   + E +R   SR+L    ++V+ S+ 
Sbjct: 99  LIRDMPGMLNKLSDFAATLPRRYP-ALMDAGIIDAMAENMR---SRMLTMGDSVVKISLA 154

Query: 149 LLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKE--LVEDVFYLARKVDDVFSN 206
            L+ LL+                KD + + N  R ++P+   L   V+   ++++   +N
Sbjct: 155 SLVGLLTIAXXXXXXXXXXXXXXKDKEQMLNAVRRVLPRNRGLAGQVW---KEMNQQITN 211

Query: 207 FIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLH 266
           +IRG +  +++VGI +                       LIPY G  +   P VG+AL  
Sbjct: 212 YIRGKVLEMIVVGIATWXXXXXXXXXXXXXXAVLVGFSVLIPYIGAFVVTIPVVGVALFQ 271

Query: 267 SKYMT--LKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLA 324
               T         LIIQ ++GN++ P +    + LHPLVII++               A
Sbjct: 272 FGAGTEFWSCFAVYLIIQALDGNLLVPVLFSEAVNLHPLVIILSXXXXXXXXXXXXXXXA 331

Query: 325 VPLAAIIKIIV 335
           +PLA +IK ++
Sbjct: 332 IPLATLIKAVI 342


>PERM_ECO57 RecName: Full=Putative permease perM;
          Length = 353

 Score = 72.8 bits (177), Expect = 4e-15
 Identities = 64/251 (25%), Positives = 117/251 (46%), Gaps = 15/251 (5%)

Query: 93  MVENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVL----AIVRKSMD 148
           ++ ++P   +++ +    + +R+  + M  G+   + E +R   SR+L    ++V+ S+ 
Sbjct: 99  LIRDMPGMLNKLSDFAATLPRRYP-ALMDAGIIDAMAENMR---SRMLTMGDSVVKISLA 154

Query: 149 LLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKE--LVEDVFYLARKVDDVFSN 206
            L+ LL+                KD + + N  R ++P+   L   V+   ++++   +N
Sbjct: 155 SLVGLLTIAXXXXXXXXXXXXXXKDKEQMLNAVRRVLPRNRGLAGQVW---KEMNQQITN 211

Query: 207 FIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLH 266
           +IRG +  +++VGI +                       LIPY G  +   P VG+AL  
Sbjct: 212 YIRGKVLEMIVVGIATWXXXXXXXXXXXXXXAVLVGFSVLIPYIGAFVVTIPVVGVALFQ 271

Query: 267 SKYMT--LKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLA 324
               T         LIIQ ++GN++ P +    + LHPLVII++               A
Sbjct: 272 FGAGTEFWSCFAVYLIIQALDGNLLVPVLFSEAVNLHPLVIILSXXXXXXXXXXXXXXXA 331

Query: 325 VPLAAIIKIIV 335
           +PLA +IK ++
Sbjct: 332 IPLATLIKAVI 342


>Y063_SYNY3 RecName: Full=UPF0118 membrane protein sll0063;
          Length = 395

 Score = 69.7 bits (169), Expect = 4e-14
 Identities = 65/309 (21%), Positives = 135/309 (43%), Gaps = 26/309 (8%)

Query: 37  ILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVEN 96
           ++A V+ ++LN  V  +EK+G+ R VA   ++L  +I+ T+L +  +P  ++Q +++V  
Sbjct: 62  LIASVIAFLLNYPVAWLEKQGAKRFVAASFVFLTALIIFTALGVTLIPLALSQAQQLVAR 121

Query: 97  IPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSN 156
           +P + D  ++ +  + ++      P     ++ +    + SR+ A        L  L  +
Sbjct: 122 LPDWLDSGQKQLVLLDQKAEILGWPVNFDGLIPQ----INSRLAA-------ELQNLAGS 170

Query: 157 LFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVF-----YLARKVDDVFS------ 205
              +AL+ +  F +++ L +              +DV+     +L  +    FS      
Sbjct: 171 TLNLALS-LTVFTVVRLLDVXXXXXXXXXXXXHTDDVWQSIIGWLPERFQKPFSDTLRRS 229

Query: 206 --NFIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIA 263
             N+  G L     + +     F+++ +              LIP FG  +G      + 
Sbjct: 230 FQNYFLGQLVSATCMALGLISGFLLLKVPFGLLFGLTVGVMALIP-FGGSVGIVLVTFLV 288

Query: 264 LLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLL 323
            L    M                N I+P+++G+  GL+P  ++++LL G  + G+ G+++
Sbjct: 289 ALRDIGMXXXXXXXXXXXXXXXENGIAPRVLGSVTGLNPFWVLISLLTGARIGGLLGVIV 348

Query: 324 AVPLAAIIK 332
           AVP A +IK
Sbjct: 349 AVPSAVMIK 357


>Y1800_ARCFU RecName: Full=UPF0118 membrane protein AF_1800;
          Length = 340

 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 60/280 (21%), Positives = 125/280 (44%), Gaps = 24/280 (8%)

Query: 37  ILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVEN 96
           ++ +V  Y+  P+  ++E  G  R+ A +I    V++  + L+ YG+ + +NQ   ++ +
Sbjct: 32  VMGVVFAYVAKPVKRKIEHVG--RIKASVIATAIVILPISVLMFYGLIQGLNQAIYLITH 89

Query: 97  IPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMD-------L 149
             +    +E  + NI  +        G+++  +E ++W+ S V +I++ S+         
Sbjct: 90  YKV----IESGILNILSKM-------GIEE-GEEYVKWITSNVFSILQSSIQPSAVEITK 137

Query: 150 LMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIR 209
              LL   F+I++  V+ FY + D++     T S+VP             +D  F +   
Sbjct: 138 KATLLILNFFISI--VVCFYALADMENFVRRTTSVVPXXXXXXXXXXXXXIDVTFESLWF 195

Query: 210 GHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIALLHSKY 269
           G+  V +++G++S   F+   +              LIP F   +   P     LL    
Sbjct: 196 GNFVVAILIGLVSLPFFLYFNVPFAPLLSGLMFLAALIPIFAEWMIILPVSLYLLLVDVG 255

Query: 270 MTLK-VILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVA 308
             L  +++ V+ +  +   I+ P  +G    +HPLV+++A
Sbjct: 256 RGLSFLLIGVVFLYVLPELILRPYFVGYTSKIHPLVLMLA 295


>YCT2_BACPF RecName: Full=UPF0118 membrane protein in ctaF
           3'region;AltName: Full=ORF2;
          Length = 385

 Score = 63.9 bits (154), Expect = 2e-12
 Identities = 52/258 (20%), Positives = 103/258 (39%), Gaps = 9/258 (3%)

Query: 81  YGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADS--SMPPGVQQIVDERIRWVESR 138
           Y   + + Q  ++VEN P Y   +     N Q+   +   ++PP + Q ++  +    S 
Sbjct: 112 YIATKAITQGTQIVENSPQYISDINRAWLNFQRNLEEKYENLPPELVQEINITVTNTLSD 171

Query: 139 VLAIVRKS------MDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVED 192
           + + +R          L+ ++   L    +  +  F  M +L  ++    S + +   E 
Sbjct: 172 LRSNIRDRNLIQDITSLISSIPGYLVTFLVYLIALFLFMLELPRLREKLYSYLSERTKEK 231

Query: 193 VFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGP 252
           V ++  ++  V   F +    V +I+ I++ +  + I  E            + +P  G 
Sbjct: 232 VNFMTSRLSYVIWGFFKAQFLVSIIIFIVTLIGLLFIAPEVALLMAFIIWLIDFVPIIGS 291

Query: 253 LIGAAPAVGIALLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAG 312
           ++  AP     L+     T                 + PK+MG  +GL PL  ++A+  G
Sbjct: 292 IVILAPWAIFQLIVGDVSTGSKXXXXXXXXXXXRRTVEPKVMGKHIGLSPLATLIAMYLG 351

Query: 313 GHLFGIAGMLLAVPLAAI 330
             LFG+ G ++  PL  I
Sbjct: 352 LMLFGVIGFIIG-PLLVI 368


>Y1187_THEMA RecName: Full=UPF0118 membrane protein TM_1187;
          Length = 324

 Score = 58.5 bits (140), Expect = 8e-11
 Identities = 60/298 (20%), Positives = 118/298 (39%), Gaps = 23/298 (7%)

Query: 38  LAIVLVYMLNPLVERMEK-RGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVEN 96
           L+I++ Y+   L   ++K R  PRV++ ++++L +   A +      P +V + +K+   
Sbjct: 37  LSIIIDYVARFLEVFIKKPRVLPRVISNVLVFLTIAYSAVNFF----PVIVREAQKVFSE 92

Query: 97  IPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSN 156
           I    D++   + NI        +P                    +V K    ++  + +
Sbjct: 93  I----DRIRSGLENID-------IPGWXXXXXXXXXXXXXXXXXXLVNK----IVGYVPS 137

Query: 157 LFYIALAPVLAFYIMKDLK-LIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVV 215
               A+  V+  +I+  LK LIK     + P    +   +L     + F  F+ G + V 
Sbjct: 138 FITAAILIVITAFIVSSLKRLIKENVHYLFPTNPSDGKEFLKTTYTE-FERFVGGQVLVA 196

Query: 216 VIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAAPAVGIAL-LHSKYMTLKV 274
           + VG+       +  +             + +PY G +I A P + +A  +H        
Sbjct: 197 IFVGLFVGFGAFIFKIPSAFFLGMLAFVTDFVPYLGVVISAIPLLMLAFSVHXXXXXXXX 256

Query: 275 ILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAIIK 332
               +   Q+E  +++PKI  N + +H           G LF   G+L+A+P    +K
Sbjct: 257 XXXXVAANQLEMWVLAPKIQSNTLNVHWFXXXXXXXXXGDLFSFGGVLIALPFLIFLK 314


>Y060_SYNY3 RecName: Full=UPF0118 membrane protein sll0060;
          Length = 344

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 24/71 (33%), Positives = 48/71 (67%)

Query: 262 IALLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGM 321
           IA   S ++ +KV+    ++ QV  N ++PK++G   G+HP+ I+++L+ G  + G+ G+
Sbjct: 267 IASFQSIWLGIKVLAIATVVDQVVENGLAPKLLGRVTGVHPVWILLSLMIGAKVAGLLGI 326

Query: 322 LLAVPLAAIIK 332
           L+A+P+A+ I+
Sbjct: 327 LVAIPIASFIR 337


>YDBI_BACSU RecName: Full=UPF0118 membrane protein ydbI;
          Length = 350

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 53/268 (19%), Positives = 107/268 (39%), Gaps = 15/268 (5%)

Query: 62  VAILILYLGVVIVATSLLMYGV-PRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSM 120
           +  L + L V++     + Y V    + QL K +++I  + D +      I   F D + 
Sbjct: 69  ITFLYMLLAVLLTVGGFVFYPVVAAQIQQLVKQIKHIAYHPDSIP-FFDEITSVFGDIN- 126

Query: 121 PPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNW 180
              +   V E    V + +  I    + ++MAL+ ++F++     L+ ++ K        
Sbjct: 127 ---ISSYVKEGFNVVYTYLADISTFGLQVVMALILSMFFLFEKKRLSEFMAK-------- 175

Query: 181 TRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXX 240
            ++   +   E++ +   K    F   +     + ++  IL+ +A  ++           
Sbjct: 176 FKTSKLRVFYEEIAFFGSKFARTFGKVLEAQFIIALVNCILTFIALWIMHFPQLFGLSIM 235

Query: 241 XXXXELIPYFGPLIGAAPAVGIALLHSKYM-TLKVILAVLIIQQVEGNIISPKIMGNCMG 299
                LIP  G +I   P   IA      M  L ++L +  I  +E   ++PK+M     
Sbjct: 236 VFFLGLIPVAGVVISLIPLSIIAYSTGGGMYVLYIVLVIFAIHAIETYFLNPKLMSAKTE 295

Query: 300 LHPLVIIVALLAGGHLFGIAGMLLAVPL 327
           L        L+   H FGI G+++ +P+
Sbjct: 296 LPIFFTFTVLIFSEHFFGIWGLIIGIPI 323


>Y630_RICPR RecName: Full=UPF0118 membrane protein RP630;
          Length = 351

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 3/143 (2%)

Query: 175 KLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEXX 234
           K+I N   S++P +    +  +   ++++ S++IRG L + +++    S+AF        
Sbjct: 173 KIITNM-ESLLPIKTRPKILEILSAINNLLSSYIRGQLNICLLLSTYYSIAFTXXXXXXX 231

Query: 235 XXXXXXXXXXELIPYFGPLIG--AAPAVGIALLHSKYMTLKVILAVLIIQQVEGNIISPK 292
                        P  G  I       +G          L +++  LI    E  I++PK
Sbjct: 232 XXXXXXXXXXXXXPLLGTFISFLLTLIIGYLTFGITSKLLYIMIIYLIGNIGESYILTPK 291

Query: 293 IMGNCMGLHPLVIIVALLAGGHL 315
           I+G+ +GLHPL II A+ A G L
Sbjct: 292 IIGDKIGLHPLWIIFAIFACGSL 314


>YTVI_BACSU RecName: Full=UPF0118 membrane protein ytvI;
          Length = 371

 Score = 47.8 bits (112), Expect = 1e-07
 Identities = 49/291 (16%), Positives = 117/291 (40%), Gaps = 25/291 (8%)

Query: 35  PFILAIVLVYMLNPLVERMEK-RGSPRVV--------------AILILYLGVVIVATSLL 79
           PF++A++L  +++P+V+ ++K  G PR +                  + +  ++  T+ L
Sbjct: 35  PFLIALILSSVIHPVVDYLDKVTGFPRTINXXXXXXXXXXXXXXXXTILVAEIVTGTAYL 94

Query: 80  MYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFAD------SSMPPGVQQIVDERIR 133
              +P  ++      E   L+T  ++ +   +   F +      +S+   +Q + D   +
Sbjct: 95  AKTLPPHISTFISYCEK--LFTTHIQPLYNELTLLFQELETNQQASIVTHIQTLGDSAAK 152

Query: 134 WVESRVLAIVRKSMDLLMALLSNLFYIALAPVLA-FYIMKDLKLIKNWTRSIVPKELVED 192
                +L+ + + +    ALL N   + +  +LA F++ KD   +K     I+P  +  +
Sbjct: 153 NA-GLLLSHILEMIPRFFALLPNTAAVLIFSLLATFFMTKDWHKLKAMLVLILPDRVTAN 211

Query: 193 VFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGP 252
              ++ ++    + FI+    +V I  ++  +   ++ +E            +L+PY G 
Sbjct: 212 SKAISSELKKAMTGFIKAQAVLVFITMVIVFIGLSLLKVEHAATIAFLIGLVDLLPYLGA 271

Query: 253 LIGAAPAVGIALLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPL 303
                P +    +  +                +  +  PKI+   +G+ PL
Sbjct: 272 GSVFVPWILYLSITGQLPQAXXXXXXXXXXXXQRQLTEPKILSKSIGIDPL 322


>Y006_BORBU RecName: Full=UPF0118 membrane protein BB_0006;
          Length = 374

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 10/149 (6%)

Query: 202 DVFSNFIRGHLTVVVIV----GILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGPLIGAA 257
           D  +N I  +L + ++V    GIL  +   + G +              IP  G ++ A 
Sbjct: 202 DTINNQIGKYLGIKILVSCLTGILVFIGLTLFGQDFPLVWAVLSFVFNFIPSIGSIL-AV 260

Query: 258 PAVGIALLHSKYMTLKVILAVLI----IQQVEGNIISPKIMGNCMGLHPLVIIVALLAGG 313
             + I  L   Y  L ++L V I    IQ + GNI+ PK+ G  + + P           
Sbjct: 261 FFIVITSLIQFYPNLNIVLYVFIYNTSIQMLIGNILEPKMQGKRLDISPXXXXXXXXXXX 320

Query: 314 HLFGIAGMLLAVPLAAIIKIIVSFV-WRK 341
                    ++ P   I+K+IV  V W K
Sbjct: 321 XXXXXXXXXISYPFTVIVKVIVDNVSWLK 349


>Y553_TREPA RecName: Full=UPF0118 membrane protein TP_0553;
          Length = 403

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 250 FGPLIGAAPA---VGIAL-LHSKYM--TLKVILAVLIIQQVEGNIISPKIMGNCMGLHPL 303
           F PL+G A     VGI++   S +M  TL + +A   I  ++ + + P ++ N M +HPL
Sbjct: 280 FLPLVGCACVWLPVGISIGFTSGWMRGTLFLFVAGSSITIID-SFLRPLLLQNKMRIHPL 338

Query: 304 VIIVALLAGGHLFGIAGMLLAVPLAAIIKIIV 335
           +I  ++L G   FG  GM+L   L  ++  ++
Sbjct: 339 LIFFSMLGGVQTFGFNGMVLGPILVILLFTVI 370


>Y1177_METJA RecName: Full=UPF0118 membrane protein MJ1177;
          Length = 334

 Score = 35.0 bits (79), Expect = 0.001
 Identities = 52/296 (17%), Positives = 111/296 (37%), Gaps = 16/296 (5%)

Query: 35  PFI----LAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQL 90
           PFI     +    YM  P+   + K+ +  + A L + + ++ + T  +   +  M   L
Sbjct: 27  PFIDVLAYSCAFAYMALPVYNILRKKFNKTISAGLAISIYILPIMTITIYALLTFMEIIL 86

Query: 91  EKMVENIPLYTDQVEEIVRNIQ-KRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDL 149
               ++I  Y +++  I  +   +R  ++     + + +DE I+++ S+    +     L
Sbjct: 87  SFNTKSIEPYINEILSIYNSFMLERIINNEQI--IAKYIDEFIKYLVSQFSGKIIDVGYL 144

Query: 150 LMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIR 209
           ++ ++  LF       L FY ++D    KN   S VP E  E +      + D + N   
Sbjct: 145 IVKVIMVLF-------LTFYFLRDGDKAKNLIISFVPDEYKEKMRIYLSYLHDSYKNLFX 197

Query: 210 GHLTVVVIVGILSSLAFMVIGLEXXXXXXXXXXXXELIPYFGP-LIGAAPAVGIALLHS- 267
                                               L+P  G  ++  + A+   L+H  
Sbjct: 198 XXXXXXXXXXXXXXXXXXXXXXPYAELFAIITGIFALLPILGGWMVYISIAIYFFLIHDY 257

Query: 268 KYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLL 323
                  I   L +      +I P ++   + +HP+++++A L      G++G  +
Sbjct: 258 TKAVFMFIYGELFLSIAPDFVIRPYLVKKEVDIHPVLVVIAFLMAPLSLGLSGFAI 313


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.317    0.134    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,536,164,002
Number of extensions: 345440147
Number of successful extensions: 847430
Number of sequences better than 1.0e-03: 8666
Number of HSP's gapped: 837593
Number of HSP's successfully gapped: 9058
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.7 bits)