BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO49729.1 dred0 ABO49729.1 GIB00494CH01 "hypothetical protein"
         (328 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KI20B_HUMAN RecName: Full=Kinesin-like protein KIF20B;AltName: F...    37   2e-04
NDC80_YEAST RecName: Full=Kinetochore protein NDC80;AltName: Ful...    35   7e-04

>KI20B_HUMAN RecName: Full=Kinesin-like protein KIF20B;AltName:
            Full=M-phase phosphoprotein 1;       
            Short=MPP1;AltName: Full=Kinesin-related motor
            interacting with PIN1;
          Length = 1820

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 36/165 (21%), Positives = 69/165 (41%), Gaps = 24/165 (14%)

Query: 153  NAKEINLKDCIRLYQQLKDENQRAIKTEKVRIRDLHDWMSYRHKLQNHENLKFNVPNHII 212
            N +  N  D +     L+DE Q   ++E+    D   W+  +  L        N+ N  +
Sbjct: 1428 NKEHENNTDVLGKLTNLQDELQ---ESEQKYNADRKKWLEEKMMLITQAKEAENIRNKEM 1484

Query: 213  RRLSMQNEKLKFFLPKESMELLKAGVELHNCVASYSRAMQDNSKWVVLVANDKGKLVACL 272
            ++ +   E+  FF  +  ME+L          A  +    D  KW      ++ +LVA L
Sbjct: 1485 KKYAEDRER--FFKQQNEMEIL---------TAQLTEKDSDLQKW----REERDQLVAAL 1529

Query: 273  EVQGRRLIQAKIDKNKPVSSDNKLNAEVISWAKEANLEIKTNDLK 317
            E+Q + LI + + K+  +    ++ +E       + +E +  D+K
Sbjct: 1530 EIQLKALISSNVQKDNEIEQLKRIISET------SKIETQIMDIK 1568


>NDC80_YEAST RecName: Full=Kinetochore protein NDC80;AltName:
           Full=Protein TID3;
          Length = 691

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 58/270 (21%), Positives = 113/270 (41%), Gaps = 29/270 (10%)

Query: 54  KQDFISALVATYSLPDKPIIKRILGANPFEASLLSEAMQLCKNYDYAIRLYKSFKLYNLL 113
           K++ I AL +  S   K + K+ +    FE     E  +L +  D  I + +S KL + +
Sbjct: 388 KEEEIKALQSNISELHKILRKKGISTEQFELQN-QEREKLTRELD-KINI-QSDKLTSSI 444

Query: 114 GSNRYGYEYTPDYVNRDVLQFLRDMLRVYGESGIVHMMENAKEINLKDCIRLYQQLKDEN 173
            S +   E         + + L D LR Y +S I ++  +  ++           + D +
Sbjct: 445 KSRKLEAE--------GIFKSLLDTLRQY-DSSIQNLTRSRSQLG--------HNVNDSS 487

Query: 174 QRAIKTEKVRIRDLHDWMSYRHKLQNHENLKFNVPNHIIRRLSMQNEKLKFFLPKESMEL 233
            +   +E +  RD H+ +SY         +  ++   I++      E++K  + K+++ L
Sbjct: 488 LKINISENLLDRDFHEGISYEQLFPKGSGINESIKKSILKLNDEIQERIK-TIEKDNITL 546

Query: 234 LKAGVELHNCVASYSRAMQDNSKWVVLVANDKGKLVACLEVQGRRLIQAKID---KNKPV 290
            K   ++ N     +   Q N K  + ++    K     +   R L+  +I+     K +
Sbjct: 547 EK---DIKNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLVAQRIEIEKMEKKI 603

Query: 291 SSDNKLNAEVISWAKE--ANLEIKTNDLKV 318
           +  N L    IS A+E   + E+K  +LKV
Sbjct: 604 NDSNLLMKTKISDAEELVTSTELKLEELKV 633


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.328    0.143    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,690,681,457
Number of extensions: 356417996
Number of successful extensions: 873159
Number of sequences better than 1.0e-03: 9477
Number of HSP's gapped: 870781
Number of HSP's successfully gapped: 10156
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.3 bits)