BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO49782.1 dred0 ABO49782.1 GIB00494CH01 "conserved
hypothetical protein"
         (154 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

T12BB_XENLA RecName: Full=Transmembrane protein 120B-B;                35   6e-04

>T12BB_XENLA RecName: Full=Transmembrane protein 120B-B;
          Length = 335

 Score = 34.7 bits (78), Expect = 6e-04
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 64  LYLISSLALGMVTLRFYPREHREQLIYIAVLAALFL---MAEIILMKTGNFIHLKGWHLG 120
           LYL   L LG +T RF         ++  +L   F    + E IL+  G+   +KGW + 
Sbjct: 132 LYLTIILLLGAITCRFVLHYRVTDEVFNFLLVWYFCTLTIRESILISNGS--RIKGWWVS 189

Query: 121 KSYILNILGFIIITW 135
             Y+   L  +++TW
Sbjct: 190 HHYVSTFLSGVMLTW 204


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.328    0.143    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,690,681,457
Number of extensions: 356417996
Number of successful extensions: 873159
Number of sequences better than 1.0e-03: 9477
Number of HSP's gapped: 870781
Number of HSP's successfully gapped: 10156
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.3 bits)