BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO50894.1 dred0 ABO50894.1 GIB00494CH01 "Protein-glutamate
O-methyltransferase"
         (256 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CHER_BACHD RecName: Full=Chemotaxis protein methyltransferase;  ...   225   4e-61
CHER_THEMA RecName: Full=Chemotaxis protein methyltransferase;  ...   207   8e-56
CHER_LISMO RecName: Full=Chemotaxis protein methyltransferase;  ...   201   8e-54
CHER_LISIN RecName: Full=Chemotaxis protein methyltransferase;  ...   197   8e-53
CHER_BACSU RecName: Full=Chemotaxis protein methyltransferase;  ...   194   7e-52
CHER1_PSEAE RecName: Full=Chemotaxis protein methyltransferase 1...   140   9e-36
CHER_BORBU RecName: Full=Chemotaxis protein methyltransferase;  ...   138   5e-35
CHER2_VIBCH RecName: Full=Chemotaxis protein methyltransferase 2...   131   7e-33
CHER_ECOLI RecName: Full=Chemotaxis protein methyltransferase;  ...   128   6e-32
CHER_VIBPA RecName: Full=Chemotaxis protein methyltransferase;  ...   127   1e-31
CHER_SALTY RecName: Full=Chemotaxis protein methyltransferase;  ...   126   2e-31
CHER3_VIBCH RecName: Full=Chemotaxis protein methyltransferase 3...   126   2e-31
CHER_RHIEC RecName: Full=Probable chemotaxis protein methyltrans...   124   9e-31
CHER1_VIBCH RecName: Full=Chemotaxis protein methyltransferase 1...   120   1e-29
CHER_VIBAN RecName: Full=Chemotaxis protein methyltransferase;  ...   120   2e-29
YH19_RHOCA RecName: Full=Uncharacterized 104.1 kDa protein in hy...   115   6e-28
FRZF_MYXXA RecName: Full=Protein methyltransferase frzF;        ...   109   3e-26
CHER2_PSEAE RecName: Full=Chemotaxis protein methyltransferase 2...    91   1e-20
CHER_CAMJE RecName: Full=Chemotaxis protein methyltransferase;  ...    90   2e-20
CHER_CAMJJ RecName: Full=Chemotaxis protein methyltransferase;  ...    89   3e-20
Y028_RICPR RecName: Full=Uncharacterized protein RP028;                35   7e-04

>CHER_BACHD RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 257

 Score =  225 bits (573), Expect = 4e-61
 Identities = 111/253 (43%), Positives = 168/253 (66%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           D++ F E++ +  G+DL+ YKE Q+KRRL  L  ++ Y D++++F  +T++    +EFL+
Sbjct: 4   DYNWFIEQVKERTGIDLNLYKETQMKRRLIALREKRNYQDFRSYFTAMTNDDTLQNEFLE 63

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANG 122
            +TINVSEFFR+ K +  L+  ++P+LL+ +  LK+WSAACS G EPYT+A+IL++    
Sbjct: 64  RMTINVSEFFRNRKRWDVLDETIIPQLLKEKKRLKVWSAACSTGEEPYTLAMILQKHLPL 123

Query: 123 KRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFK 182
           K   I ATD+D  ILQ A  G Y    ++ I  +    +FT ++  Y++SN++K  V FK
Sbjct: 124 KDVSILATDIDRAILQQAKVGYYTERSLKEIPVELKEGFFTKDRAGYYVSNELKQAVTFK 183

Query: 183 QHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNYAE 242
           QHNLLAD + +  DLI CRNV IYFT EA+ ++  +F+++L PGG LF+G +E IF  ++
Sbjct: 184 QHNLLADRFERDCDLIVCRNVLIYFTEEAKRELYHKFSEALRPGGVLFVGSTEQIFEASK 243

Query: 243 IGFEKVSPCFYRK 255
            G E     FYRK
Sbjct: 244 YGLETNETFFYRK 256


>CHER_THEMA RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 282

 Score =  207 bits (527), Expect = 8e-56
 Identities = 107/242 (44%), Positives = 156/242 (64%), Gaps = 2/242 (0%)

Query: 15  FGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSEFFRD 74
           FGL+L SYK  ++KRR + LL RK    Y+ + N L  +K    EF+D +TINV+EFFR+
Sbjct: 40  FGLNLSSYKPQRVKRRTE-LLLRKYNVGYREYLNMLIKDKKYLDEFMDKMTINVTEFFRN 98

Query: 75  IKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDN 134
            + +  L  +++P + +N   +K WSA CS+G EPY++AI++ E+    + +I ATD+D 
Sbjct: 99  PEKWWELRDEIIPLIAKNSLRMKFWSAGCSSGEEPYSLAILVHELNLSYKTRILATDIDI 158

Query: 135 TILQAAASGSYGADLVRNISKDRLAKYFT-VEQGRYFISNKIKSKVNFKQHNLLADTYPK 193
            +L+ A  G Y      +  K+ L KYF  +  GRY I + +K  V FK+H+LL D + K
Sbjct: 159 GVLRRAQEGIYEERAFVSTPKEYLEKYFEKLPDGRYRIKDSVKKIVEFKRHDLLKDPFEK 218

Query: 194 GYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFY 253
            +DLI CRNV IYF  EA++++  +FA+SL PGG+LF+G +E IFNY E+GFE   P  Y
Sbjct: 219 NFDLIVCRNVVIYFEPEAKNELYRKFAESLKPGGFLFVGNTERIFNYKELGFEIYKPFIY 278

Query: 254 RK 255
           RK
Sbjct: 279 RK 280


>CHER_LISMO RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 262

 Score =  201 bits (510), Expect = 8e-54
 Identities = 105/254 (41%), Positives = 154/254 (60%), Gaps = 1/254 (0%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           D+  F   + +  GLDL  YKE Q+KRR+ + + +K+Y  +  FF +L  +     EF+ 
Sbjct: 8   DYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKKYITFGEFFKHLKKDAVLLDEFIS 67

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQN-RGNLKIWSAACSNGCEPYTIAIILEEIAN 121
            +TINVS FFR+   +  LE +VLP LL++ RG L++WSAACS+G EPY++A+++E    
Sbjct: 68  LITINVSSFFRNRNRWDALEKQVLPRLLEDSRGKLRVWSAACSSGEEPYSLAMMMERSVG 127

Query: 122 GKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNF 181
            + + I ATDL+  IL+ A  G Y +  +  +S+      F  +   Y I  K +  + F
Sbjct: 128 TRHYDILATDLEPAILKRAVIGEYQSRQMEELSEQERHTAFVEKGDTYQILPKYRKSIRF 187

Query: 182 KQHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNYA 241
           ++H+LL D Y KG+DLI CRNV IYFT E + +   +FA+SL  GG LFIGGSE I N A
Sbjct: 188 RRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAYQKFAESLRRGGVLFIGGSEQILNPA 247

Query: 242 EIGFEKVSPCFYRK 255
           + G   ++  FY K
Sbjct: 248 DYGLATLNNFFYIK 261


>CHER_LISIN RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 262

 Score =  197 bits (501), Expect = 8e-53
 Identities = 103/254 (40%), Positives = 153/254 (60%), Gaps = 1/254 (0%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           D+  F   + +  GLDL  YKE Q+KRR+ + + +K+Y  +  FF +L  +     EF+ 
Sbjct: 8   DYLYFTRVVKRDLGLDLTLYKETQMKRRILSFIVKKKYITFGEFFKHLKKDALLLDEFIS 67

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQN-RGNLKIWSAACSNGCEPYTIAIILEEIAN 121
            +TINVS FFR+   +  LE +V+P LL++ RG L++WSAACS+G EPY++AI++E    
Sbjct: 68  LITINVSAFFRNRNRWDVLEKQVIPRLLEDSRGKLRVWSAACSSGEEPYSLAIMMERSVG 127

Query: 122 GKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNF 181
            + + I ATDL+  IL+ A  G Y +  +  +++      F  +   Y I  + +  + F
Sbjct: 128 TRHYDILATDLEPAILKRAVIGEYQSRQMEELNEQERRSAFIEKGDTYQILPEYRKAIRF 187

Query: 182 KQHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNYA 241
           ++H+LL D Y KG+DLI CRNV IYFT E + +   +FA SL  GG LFIGGSE I N A
Sbjct: 188 RRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAYQKFADSLRRGGVLFIGGSEQILNPA 247

Query: 242 EIGFEKVSPCFYRK 255
           + G   ++  FY K
Sbjct: 248 DYGLATLNNFFYIK 261


>CHER_BACSU RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 256

 Score =  194 bits (493), Expect = 7e-52
 Identities = 106/257 (41%), Positives = 153/257 (59%), Gaps = 2/257 (0%)

Query: 1   MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEF 60
           M  +  F  K  Q  G+DL  YKE Q+KRRL +L  +K +  ++ F   L  ++   +E 
Sbjct: 1   MDTYSVFTTKWKQLTGVDLTLYKEAQMKRRLTSLYEKKGFQSFKDFAAALEKDQALLNET 60

Query: 61  LDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIA 120
           LD +TINVSEF+R+ K ++ LET +LP L++    LKIWSAACS G EPYT+A++L++  
Sbjct: 61  LDRMTINVSEFYRNYKRWEVLETAILP-LIKTSRPLKIWSAACSTGEEPYTLAMLLDQQK 119

Query: 121 NGKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGR-YFISNKIKSKV 179
               +QI ATD+D   L+ A  G Y    ++ +      +YFT    R Y +  +IK  +
Sbjct: 120 GLPGYQILATDIDEKALEKAKKGVYQERSLQEVPLSVKDRYFTQNANRSYEVKTEIKKNI 179

Query: 180 NFKQHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFN 239
            FK+HNLLAD Y + +DLI CRNV IYFT  A++++  + A SL   G LF+G +E IFN
Sbjct: 180 TFKKHNLLADRYEQDFDLIVCRNVFIYFTESAKEELYLKMAHSLKKNGVLFVGSTEQIFN 239

Query: 240 YAEIGFEKVSPCFYRKK 256
             + G       FY+K+
Sbjct: 240 PEKFGLVPADTFFYQKR 256


>CHER1_PSEAE RecName: Full=Chemotaxis protein methyltransferase 1;  
                 EC=2.1.1.80;
          Length = 274

 Score =  140 bits (354), Expect = 9e-36
 Identities = 87/250 (34%), Positives = 142/250 (56%), Gaps = 14/250 (5%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFL- 61
           DF+ F+  + +T G+ L S K+  +  RL+ L+ ++           + + +    E + 
Sbjct: 7   DFELFRVFLEKTCGIVLGSNKQYLVSSRLNKLMEQQGIKSLGELVQRIQTQRGGLREMVV 66

Query: 62  DYLTINVSEFFRDIKMFQTLETKVLPELLQNRGN--LKIWSAACSNGCEPYTIAIILEEI 119
           D +T N + +FRD   F+ L+ +VLPEL++  G   L+IWSAACS+G EPY++++ ++E 
Sbjct: 67  DAMTTNETLWFRDTYPFEVLKQRVLPELIKANGGQRLRIWSAACSSGQEPYSLSMAIDEF 126

Query: 120 ANGKRHQIDA------TDLDNTILQAAASGSYGA-DLVRNISKDRLAKYFTVE-QGRYFI 171
                 Q+ A      TDL  ++L AA +G Y    + R +S +RL +YF  +  GR+ +
Sbjct: 127 EKTNLGQLKAGVQIVATDLSGSMLTAAKAGEYDTLAMGRGLSPERLQRYFDAKGPGRWAV 186

Query: 172 SNKIKSKVNFKQHNLLADTYPK--GYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYL 229
              I+S+V F+  NLL D+Y     +D++ CRNV IYF+ E +  +  R   +L PGGYL
Sbjct: 187 KPAIRSRVEFRALNLL-DSYASLGKFDMVFCRNVLIYFSAEVKRDILLRIHGTLKPGGYL 245

Query: 230 FIGGSETIFN 239
           F+G SE + N
Sbjct: 246 FLGASEALNN 255


>CHER_BORBU RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 283

 Score =  138 bits (348), Expect = 5e-35
 Identities = 87/267 (32%), Positives = 141/267 (52%), Gaps = 16/267 (5%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWH--EF 60
           +  R  + +Y  FG++L   K+  ++ RL +LL  K + ++  + N+L  +       E 
Sbjct: 18  ELSRLIKIVYNNFGINLSEKKKLLIESRLSSLLKVKGFKNFTEYINFLEKSTGNIQLIEL 77

Query: 61  LDYLTINVSEFFRDIKMFQTLETKVLPELLQN-----RGNLKIWSAACSNGCEPYTIAII 115
           +D ++ N + FFR+ K F  L  K+LP+L +         ++IWSA CS+G EPYTIA++
Sbjct: 78  IDKISTNHTYFFRESKHFDFLNNKILPKLTEKILNSENSEIRIWSAGCSSGEEPYTIAMM 137

Query: 116 LEEIANGKRH----QIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFT-VEQGRYF 170
           L+E     R     +I ATD+  ++L  A  G Y  D + N+ K    KY   ++  ++ 
Sbjct: 138 LKEYMEHNRVNFKVKILATDISISVLNEAREGIYPEDRIINLPKYLKIKYLNQLQDDKFQ 197

Query: 171 ISNKIKSKVNFKQHNLLADTYP--KGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGY 228
           +   +K  V FK+ NL+ + +P  K +DLI CRNV IYF  + ++ +  +F   L    Y
Sbjct: 198 VKEILKKMVYFKKLNLMDEKFPFSKKFDLIFCRNVMIYFDEKTRNNLANKFNSYLKKDSY 257

Query: 229 LFIGGSETIFNYAEIGFEKVSPCFYRK 255
           L IG SETI     +  E + P  Y+K
Sbjct: 258 LLIGHSETIRGNKNL--EYIMPATYKK 282


>CHER2_VIBCH RecName: Full=Chemotaxis protein methyltransferase 2;  
                 EC=2.1.1.80;
          Length = 288

 Score =  131 bits (329), Expect = 7e-33
 Identities = 86/254 (33%), Positives = 139/254 (54%), Gaps = 13/254 (5%)

Query: 2   TDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLT--SNKNAWHE 59
           TDF RF++  YQ  G+   + K   + +RL   +   ++  ++ +F YL   ++      
Sbjct: 9   TDFCRFRDYFYQKTGIFFENSKRYFVDKRLLQRIELTEHQSFRGYFTYLRFQASGEELQA 68

Query: 60  FLDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGN--LKIWSAACSNGCEPYTIAIILE 117
            ++ LT+N + FFR+I   ++L  +VL +++++R    ++IWS  CS+G EPY+I + L 
Sbjct: 69  VINALTVNETYFFREISQLESLVEEVLDDIVRHRPGELIRIWSMPCSSGEEPYSIVLFLL 128

Query: 118 EIANGKRHQID----ATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVE-QGRYFIS 172
           E    K  Q+D    A+D+D  ILQ AA G + A  V+N+    L KYF++   G Y + 
Sbjct: 129 EHWP-KLEQVDIEIIASDIDTGILQKAAQGIFSARSVKNLPNSSLNKYFSLRADGSYQLI 187

Query: 173 NKIKSKVNFKQHNL--LADTYPKG-YDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYL 229
           + I+  V F Q NL   A+    G  D+I CRN+ IYF   ++      F + LNPGG L
Sbjct: 188 DDIRQSVRFTQTNLNNRAEVQKLGAMDVIFCRNLLIYFDDISRRNAVESFYEQLNPGGVL 247

Query: 230 FIGGSETIFNYAEI 243
           F+G SE++   + I
Sbjct: 248 FLGHSESMSRISSI 261


>CHER_ECOLI RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 286

 Score =  128 bits (321), Expect = 6e-32
 Identities = 84/252 (33%), Positives = 130/252 (51%), Gaps = 15/252 (5%)

Query: 4   FDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNA--WHEFL 61
           F R  + IYQ  G+ L  +K + +  RL   L      D+  + N L SN+++  W  F+
Sbjct: 27  FRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRSLGLTDFGHYLNLLESNQHSGEWQAFI 86

Query: 62  DYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIAN 121
           + LT N++ FFR+   F  L         +  G  ++WSAA S G EPY+IA+ L +   
Sbjct: 87  NSLTTNLTAFFREAHHFPLLADHAR----RRSGEYRVWSAAASTGEEPYSIAMTLADTLG 142

Query: 122 GK--RHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFT----VEQGRYFISNKI 175
               R ++ A+D+D  +L+ A SG Y  + ++N++  +L +YF       +G   +  ++
Sbjct: 143 TAPGRWKVFASDIDTEVLEKARSGIYRHEELKNLTPQQLQRYFMRGTGPHEGLVRVRQEL 202

Query: 176 KSKVNFKQHNLLADTY--PKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGG 233
            + V+F   NLLA  Y  P  +D I CRNV IYF +  Q ++  RF   L P G LF G 
Sbjct: 203 ANYVDFAPLNLLAKQYTVPGPFDAIFCRNVMIYFDQTTQQEILRRFVPLLKPDGLLFAGH 262

Query: 234 SETIFNYAEIGF 245
           SE  F++ E  F
Sbjct: 263 SEN-FSHLERRF 273


>CHER_VIBPA RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 275

 Score =  127 bits (319), Expect = 1e-31
 Identities = 87/246 (35%), Positives = 131/246 (53%), Gaps = 15/246 (6%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEF-- 60
           DF RF E      G+ L   K+  ++ RL  L+T+ +          + + +N       
Sbjct: 13  DFSRFLES---QCGIVLGDSKQYLVRSRLSPLVTKFKLASLSDLLRDVVAGRNRELRIAA 69

Query: 61  LDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIA 120
           +D +T N + +FRD   F  L  K+LPE+  N+  +KIWSAA S+G EPY+IA+ + E  
Sbjct: 70  VDAMTTNETLWFRDTYPFTVLADKLLPEVAANKRPIKIWSAASSSGQEPYSIAMTILETQ 129

Query: 121 NGK-----RHQIDATDLDNTILQAAASGSY-GADLVRNISKDRLAKYF-TVEQGRYFISN 173
             K        I ATD+  ++L+   +G Y    L R +S +R   +F     GR  + +
Sbjct: 130 QRKPGLLPSVSITATDISASMLEMCRAGVYDNLALGRGLSPERRRTFFEDAGDGRMKVKD 189

Query: 174 KIKSKVNFKQHNLLADTYP--KGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFI 231
            +K  VNF+  NL+ D+Y     +D+I CRNV IYF+ E + KV  + A SLNPGGYL +
Sbjct: 190 NVKRLVNFRPQNLM-DSYALMGKFDIIFCRNVLIYFSPEMKSKVLNQMASSLNPGGYLLL 248

Query: 232 GGSETI 237
           G SE++
Sbjct: 249 GASESL 254


>CHER_SALTY RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 288

 Score =  126 bits (317), Expect = 2e-31
 Identities = 85/248 (34%), Positives = 128/248 (51%), Gaps = 18/248 (7%)

Query: 4   FDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNA--WHEFL 61
           F R  + IYQ  G+ L  +K + +  RL   L      D+  + + L +N+N+  W  F+
Sbjct: 27  FRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSAEWQAFI 86

Query: 62  DYLTINVSEFFRDIKMFQTLETKVLPELLQNR-GNLKIWSAACSNGCEPYTIAIILEE-- 118
           + LT N++ FFR+   F      +L E  + R G  ++WSAA S G EPY+IAI L +  
Sbjct: 87  NALTTNLTAFFREAHHFP-----ILAEHARRRHGEYRVWSAAASTGEEPYSIAITLADAL 141

Query: 119 -IANGKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFT----VEQGRYFISN 173
            +A G R ++ A+D+D  +L+ A SG Y    ++ +S  +L +YF       +G   +  
Sbjct: 142 GMAPG-RWKVFASDIDTEVLEKARSGIYRLSELKTLSPQQLQRYFMRGTGPHEGLVRVRQ 200

Query: 174 KIKSKVNFKQHNLLADTY--PKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFI 231
           ++ + V F   NLL   Y  P  +D I CRNV IYF +  Q+ +  RF   L P G LF 
Sbjct: 201 ELANYVEFSSVNLLEKQYNVPGPFDAIFCRNVMIYFDKTTQEDILRRFVPLLKPDGLLFA 260

Query: 232 GGSETIFN 239
           G SE   N
Sbjct: 261 GHSENFSN 268


>CHER3_VIBCH RecName: Full=Chemotaxis protein methyltransferase 3;  
                 EC=2.1.1.80;
          Length = 276

 Score =  126 bits (316), Expect = 2e-31
 Identities = 81/244 (33%), Positives = 128/244 (52%), Gaps = 9/244 (3%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           DF   +  +++T G+ L   K   +  RL   + RK    +  F   + S++     F++
Sbjct: 15  DFKFIQWFMHKTVGIYLPDSKRTMVYGRLSRQMRRKGLRRFTQFRELIESDEQERIHFIN 74

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQNR-GNLKIWSAACSNGCEPYTIAIILEEIAN 121
            LT N +EFFR+   F+ +E  ++PE  + R G L+ WSA CS G EPYT+  +L+    
Sbjct: 75  TLTTNKTEFFRESHHFEFIEKVLVPEWSKERVGQLRFWSAGCSTGEEPYTLVSVLDHAGV 134

Query: 122 GK---RHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTV----EQGRYFISNK 174
                  +I ATDLD  +L+ A+ G Y  +   +I +  L + F      +QG   I   
Sbjct: 135 MNFCPDIKIWATDLDTAVLEKASLGIYPIESQSSIPERYLRRCFVRGVKDQQGNMKIKQS 194

Query: 175 IKSKVNFKQHNLLAD-TYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGG 233
           ++  ++F Q NL+ +  + +  DLI CRNV IYF R  Q+++  RF Q L PGG L +G 
Sbjct: 195 LQRYIDFHQLNLIQEWPFKQKLDLILCRNVMIYFDRPTQEQLIERFHQQLKPGGVLMLGH 254

Query: 234 SETI 237
           SE++
Sbjct: 255 SESV 258


>CHER_RHIEC RecName: Full=Probable chemotaxis protein
           methyltransferase;         EC=2.1.1.80;
          Length = 268

 Score =  124 bits (311), Expect = 9e-31
 Identities = 90/257 (35%), Positives = 138/257 (53%), Gaps = 13/257 (5%)

Query: 11  IYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAW--HEFLDYLTINV 68
           IY   G+ L+  K + +  RL   +       ++ +   + S   A    E L +LT N 
Sbjct: 2   IYSDAGIFLNETKASLVYSRLSKHIRNLGLSGFREYCELVASPAGAAARREMLSHLTTNF 61

Query: 69  SEFFRDIKMFQTLETKVLPELLQNR---GNLKIWSAACSNGCEPYTIAI-ILEEIANGKR 124
           + FFR+   F+ L   VLPELLQ     G ++IWSAA S+G EPY+IA+ +L  + N   
Sbjct: 62  TRFFRENHHFEHLRDHVLPELLQRARSGGRVRIWSAASSDGQEPYSIALTVLSLMPNVAD 121

Query: 125 H--QIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFT-VE-QGR--YFISNKIKSK 178
           +  +I ATD+D  IL  A +G+Y    +  +S     ++F+ VE QGR  + + +++K  
Sbjct: 122 YDFKILATDIDPKILAIARAGAYDESALETVSPAMRKQWFSEVEVQGRRKFQVDDRVKRL 181

Query: 179 VNFKQHNLLADTYPKG-YDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETI 237
           + + + NL+A    KG +D+I CRNV IYF    Q K+  RFA  L  GG+L+IG SE +
Sbjct: 182 ITYNELNLMAQWPFKGKFDVIFCRNVVIYFDEPTQMKIWQRFAGLLPEGGHLYIGHSERV 241

Query: 238 FNYAEIGFEKVSPCFYR 254
              A+  F+ +    YR
Sbjct: 242 SGEAKHVFDNIGITTYR 258


>CHER1_VIBCH RecName: Full=Chemotaxis protein methyltransferase 1;  
                 EC=2.1.1.80;
          Length = 275

 Score =  120 bits (301), Expect = 1e-29
 Identities = 83/245 (33%), Positives = 129/245 (52%), Gaps = 13/245 (5%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEF-- 60
           DF RF E      G+ L   K+  ++ RL  L+T+ +          + + +N       
Sbjct: 13  DFCRFLES---QCGIVLGDSKQYLVRSRLSPLVTKFKXXXXXXXXRDVVTGRNRDLRVAA 69

Query: 61  LDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIA 120
           +D +T N + +FRD   F  L  K+LPE+  N+  +KIWSAA S+G EPY++A+ + E+ 
Sbjct: 70  VDAMTTNETLWFRDSYPFTVLADKLLPEMAANKRPIKIWSAASSSGQEPYSMAMTILEVQ 129

Query: 121 NGK-----RHQIDATDLDNTILQAAASGSY-GADLVRNISKDRLAKYF-TVEQGRYFISN 173
             +        I ATD+  ++L    +G Y    L R +S +R   +F     GR  + +
Sbjct: 130 QKRPGLLPSVSITATDISASMLDMCRAGIYDNLALGRGLSPERRRVFFEDAGDGRMKVKD 189

Query: 174 KIKSKVNFKQHNLLADTYPKG-YDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIG 232
            +K  VNF+  NL+      G +D+I CRNV IYF+ + + KV  + A SLNPGGYL +G
Sbjct: 190 NVKRLVNFRPQNLMESYSLLGKFDIIFCRNVLIYFSPDMKSKVLNQMAASLNPGGYLLLG 249

Query: 233 GSETI 237
            SE++
Sbjct: 250 ASESL 254


>CHER_VIBAN RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 275

 Score =  120 bits (300), Expect = 2e-29
 Identities = 83/245 (33%), Positives = 127/245 (51%), Gaps = 13/245 (5%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEF-- 60
           DF RF E      G+ L   K+  ++ RL  L+ + +          + + +N       
Sbjct: 13  DFSRFLES---QCGIVLGDSKQYLVRSRLSPLVAKFKLTSLSDLLRDVVTGRNRELRVAA 69

Query: 61  LDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIA 120
           +D +T N + +FRD   F  L  ++LPE+  N+  +KIWSAA S+G EPY++A+ + E  
Sbjct: 70  VDAMTTNETLWFRDAYPFTVLAERLLPEVAANKRPIKIWSAASSSGQEPYSMAMTVLETQ 129

Query: 121 NGKRHQ-----IDATDLDNTILQAAASGSY-GADLVRNISKDRLAKYF-TVEQGRYFISN 173
             K        I ATD+  ++L    +G Y    L R +S +R   +F     GR  I +
Sbjct: 130 QRKPGMLPSVAITATDISASMLDMCKAGIYDNLALGRGLSPERRKIFFEDAGDGRMKIKD 189

Query: 174 KIKSKVNFKQHNLLADTYPKG-YDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIG 232
            +K  VNF+  NL+      G +D+I CRNV IYF+ + + KV  + A SLNPGGYL +G
Sbjct: 190 NVKRLVNFRPQNLMESYALLGKFDIIFCRNVLIYFSPDMKSKVLNQMASSLNPGGYLLLG 249

Query: 233 GSETI 237
            SE++
Sbjct: 250 ASESL 254


>YH19_RHOCA RecName: Full=Uncharacterized 104.1 kDa protein in hypE
           3'region;AltName: Full=ORF19;
          Length = 952

 Score =  115 bits (287), Expect = 6e-28
 Identities = 68/223 (30%), Positives = 109/223 (48%), Gaps = 7/223 (3%)

Query: 22  YKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSEFFRDIKMFQTL 81
           YK   ++RR++  +  +Q PD  ++   LT ++         + I V+ FFRD   F  L
Sbjct: 198 YKPGTVQRRIERRMGVRQVPDLTSYLELLTHDRTELASLRREMLIPVTSFFRDPDSFAEL 257

Query: 82  ETKVLPELLQNRG---NLKIWSAACSNGCEPYTIAIIL----EEIANGKRHQIDATDLDN 134
             KV+  L+        L++W+A C+ G E YT+A++     E        +I ATD++ 
Sbjct: 258 AEKVIDPLVAQAAVGSTLRVWTAGCATGEEAYTLAMLFFDAFERAGRWPTLKIFATDVEP 317

Query: 135 TILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKG 194
                            ++    L ++FT   G+Y I  +I+  + F +HNLL+D     
Sbjct: 318 MNXXXXXXXXXXXXXXXDLPTTFLERFFTTRGGQYTIRPEIRQTIVFARHNLLSDPPFTR 377

Query: 195 YDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETI 237
            DL+ CRN  IYF  EAQ++   R   ++  GGYLF+GGSE +
Sbjct: 378 MDLVTCRNTLIYFRPEAQERALRRMHYAVRTGGYLFLGGSEAL 420


>FRZF_MYXXA RecName: Full=Protein methyltransferase frzF;       
           EC=2.1.1.80;
          Length = 593

 Score =  109 bits (272), Expect = 3e-26
 Identities = 66/187 (35%), Positives = 101/187 (54%), Gaps = 9/187 (4%)

Query: 61  LDYLTINVSEFFRDIKMFQTLETKVLPELL----QNRGNLKIWSAACSNGCEPYTIAIIL 116
           L  +T+  +EFFRD K F+ LE  VLP+L+    +    + IWSA C+ G EPY++A++L
Sbjct: 68  LPLVTVGHTEFFRDAKQFRALEKSVLPDLVSRSRREMRKVSIWSAGCATGEEPYSLAMVL 127

Query: 117 EEI-ANGKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKI 175
            E+ A      + ATDL+   ++AA  G + +    +I++ RL ++F   +  Y     +
Sbjct: 128 AELGALSLEVDLWATDLNLAAVEAAKQGRFTSRRAISINQARLTRFFKPVEEGYEALPAL 187

Query: 176 KSKVNFKQHNLLADTYPK----GYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFI 231
           +  + F   NL    + K      DLI CRNV IYF       +  RF  +L PGG LF+
Sbjct: 188 REYIRFDGQNLAVPVFDKVALSSLDLILCRNVIIYFDLPTIRGLMDRFLAALRPGGLLFL 247

Query: 232 GGSETIF 238
           G SE++F
Sbjct: 248 GYSESLF 254


>CHER2_PSEAE RecName: Full=Chemotaxis protein methyltransferase 2;  
                 EC=2.1.1.80;
          Length = 280

 Score = 90.5 bits (223), Expect = 1e-20
 Identities = 70/249 (28%), Positives = 108/249 (43%), Gaps = 9/249 (3%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           DF + +E++Y+  G+ L   K   +               +  +F +L         F++
Sbjct: 21  DFQQVRERLYRLTGISLAESKAQLVYXXXXXXXXXXXXGSFAEYFTHLDREPGEQQLFVN 80

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANG 122
            LT N++ FFR+   F                 L+IWSAA S G EPY+IAI L E    
Sbjct: 81  ALTTNLTAFFRERHHFPXXXXXXXXXXXXXXP-LRIWSAAASTGEEPYSIAITLVEALGS 139

Query: 123 --KRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFT----VEQGRYFISNKIK 176
                +I A+D+D  +L  A  G Y  + +  +      ++F        G+  +  +++
Sbjct: 140 FDPPVKIVASDIDTGVLDCARQGVYPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELR 199

Query: 177 SKVNFKQHNLL-ADTYPKG-YDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGS 234
             V F+Q NLL AD    G  D I CRNV IYF +  Q ++  R    L P G  F G S
Sbjct: 200 QLVEFRQINLLEADWSIAGELDAIFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHS 259

Query: 235 ETIFNYAEI 243
           E   + + +
Sbjct: 260 ENFVHASHL 268


>CHER_CAMJE RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 262

 Score = 89.7 bits (221), Expect = 2e-20
 Identities = 65/238 (27%), Positives = 123/238 (51%), Gaps = 9/238 (3%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           + + F + I +  G+DL   K+N L  +L+  L      ++  F   L SN+    E LD
Sbjct: 11  ELNEFIKIINEMSGIDLTD-KKNILALKLNKFLEGTNTKNFSEFLGKLKSNRQLKQETLD 69

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANG 122
           ++TI  + F R++   Q  E     + L+ R N  I SA CS+G E Y++A++  +    
Sbjct: 70  FVTIGETYFLRELA--QLKEIIYYAKSLEKRVN--ILSAPCSSGEEVYSLALLAAQNFI- 124

Query: 123 KRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIK-SKVNF 181
           K   I   D+++++++ A  G Y    ++ +S+    ++F   + +++  NK +     F
Sbjct: 125 KDMYILGVDINSSVIEKAKLGKYQGRTLQRLSESEKRRFFLESEDKFYTINKNELCTCKF 184

Query: 182 KQHNLLADTYPK--GYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETI 237
           +  N+  + + +   +D+IA RN+ IYF  E++ K+  RF + LN  G L++G ++ I
Sbjct: 185 ELCNVFEEKFSRLGKFDIIASRNMIIYFDHESKLKLMERFHRILNDKGRLYVGNADLI 242


>CHER_CAMJJ RecName: Full=Chemotaxis protein methyltransferase;     
              EC=2.1.1.80;
          Length = 262

 Score = 89.4 bits (220), Expect = 3e-20
 Identities = 65/238 (27%), Positives = 123/238 (51%), Gaps = 9/238 (3%)

Query: 3   DFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLD 62
           + + F + I +  G+DL   K+N L  +L+  L      ++  F   L SN+    E LD
Sbjct: 11  ELNEFIKIINEMSGIDLTD-KKNILALKLNKFLEGTNTKNFSEFLGKLKSNRQLKQETLD 69

Query: 63  YLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANG 122
           ++TI  + F R++   Q  E     + L+ R N  I SA CS+G E Y++A++  +    
Sbjct: 70  FVTIGETYFLRELA--QLKEIIYYAKSLEKRVN--ILSAPCSSGEEVYSLALLAAQNFI- 124

Query: 123 KRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIK-SKVNF 181
           K   I   D+++++++ A  G Y    ++ +S+    ++F   + +++  NK +     F
Sbjct: 125 KDMYILGIDINSSVIEKAKLGKYQGRTLQRLSESEKRRFFLESEDKFYTINKNELCTCKF 184

Query: 182 KQHNLLADTYPK--GYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETI 237
           +  N+  + + +   +D+IA RN+ IYF  E++ K+  RF + LN  G L++G ++ I
Sbjct: 185 ELCNVFEEKFSRLGKFDIIASRNMIIYFDHESKLKLMERFHRILNDKGRLYVGNADLI 242


>Y028_RICPR RecName: Full=Uncharacterized protein RP028;
          Length = 250

 Score = 35.0 bits (79), Expect = 7e-04
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 164 VEQGRYFISNKIKSKVNFKQHNLLA--DTYPKGYDLIACRNVTIYFTREAQDKVNARFAQ 221
           +E G+  IS+     V  K  ++L   ++Y K +D I C  V  + ++E QDK+     +
Sbjct: 80  IEIGKKTISDAKIKNVRLKALSILDLDESYGK-FDYIVCHGVYSWVSKEVQDKILEVLNK 138

Query: 222 SLNPGGYLFI 231
            LNP G  FI
Sbjct: 139 LLNPNGIAFI 148


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.321    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,935,377,309
Number of extensions: 409695471
Number of successful extensions: 1107497
Number of sequences better than 1.0e-03: 27848
Number of HSP's gapped: 1060821
Number of HSP's successfully gapped: 33104
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)