BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABO51527.1 dred0 ABO51527.1 GIB00494CH01 "hypothetical protein"
         (210 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

P115_MYCHR RecName: Full=Protein P115;                                 39   5e-05
EZRA_STAES RecName: Full=Septation ring formation regulator ezrA;      37   2e-04
EZRA_STAEQ RecName: Full=Septation ring formation regulator ezrA;      37   2e-04
MU132_SCHPO RecName: Full=Meiotically up-regulated gene 132 prot...    35   6e-04

>P115_MYCHR RecName: Full=Protein P115;
          Length = 979

 Score = 38.5 bits (88), Expect = 5e-05
 Identities = 23/120 (19%), Positives = 59/120 (49%), Gaps = 16/120 (13%)

Query: 35  KVQEIYNQQNDDKIDDKSMEYIIKEKKDYLINHRQITVHKDYFVYLSIMVAGSYFDEELR 94
           K++++  Q +D   +    ++++++ +  L  H ++T+            A   +  +L 
Sbjct: 705 KLRKLNTQHSDSITEQNRAKFLVEQNQKRLSEHYKLTLE----------AASEQYSLDLD 754

Query: 95  AKEGKPYYIPEKEELLKYKDVN------YFEVNKEYEELLQFLKKMFWRKSKAEDVAREI 148
            ++ + +    K+EL +  +VN      + EVN+ Y+E  Q+++++   KSK E+   ++
Sbjct: 755 IEQARHFVDSLKKELKELGNVNLEAITEFEEVNQRYQEKKQYIEELTTAKSKIEEAISDL 814


>EZRA_STAES RecName: Full=Septation ring formation regulator ezrA;
          Length = 564

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/141 (21%), Positives = 66/141 (46%), Gaps = 12/141 (8%)

Query: 14  MDKVMDYIQALTNLYGVVHKDKVQEIYNQQNDDKIDDKSMEYIIKE-----KKDYLINHR 68
           +D++ D I+     Y V  K++V+E  +   DD    K M Y ++      +++Y IN  
Sbjct: 291 LDEMYDLIE-----YEVKAKNEVEETKDIITDDLFKAKDMNYTLQTEIEYVRENYYINES 345

Query: 69  QITVHKDYFVYLSIMVAGSYFDEELRAKEGKPYYIPEKEELLKYKDVNYFEVNKEYEELL 128
                + +   +  ++  S +D+ L+          E ++ L+Y + +   +NKE ++L 
Sbjct: 346 DAQSVRQFENEIQSLI--SVYDDILKETSKSAVRYSEVQDNLQYLEDHVSVINKEQDKLQ 403

Query: 129 QFLKKMFWRKSKAEDVAREIQ 149
             L ++   +++AED    +Q
Sbjct: 404 NHLIQLREDEAEAEDNLLRVQ 424


>EZRA_STAEQ RecName: Full=Septation ring formation regulator ezrA;
          Length = 564

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/141 (21%), Positives = 66/141 (46%), Gaps = 12/141 (8%)

Query: 14  MDKVMDYIQALTNLYGVVHKDKVQEIYNQQNDDKIDDKSMEYIIKE-----KKDYLINHR 68
           +D++ D I+     Y V  K++V+E  +   DD    K M Y ++      +++Y IN  
Sbjct: 291 LDEMYDLIE-----YEVKAKNEVEETKDIITDDLFKAKDMNYTLQTEIEYVRENYYINES 345

Query: 69  QITVHKDYFVYLSIMVAGSYFDEELRAKEGKPYYIPEKEELLKYKDVNYFEVNKEYEELL 128
                + +   +  ++  S +D+ L+          E ++ L+Y + +   +NKE ++L 
Sbjct: 346 DAQSVRQFENEIQSLI--SVYDDILKETSKSAVRYSEVQDNLQYLEDHVSVINKEQDKLQ 403

Query: 129 QFLKKMFWRKSKAEDVAREIQ 149
             L ++   +++AED    +Q
Sbjct: 404 NHLIQLREDEAEAEDNLLRVQ 424


>MU132_SCHPO RecName: Full=Meiotically up-regulated gene 132
           protein;
          Length = 430

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 100 PYYIPEKEELLKYKDVNYFEVNKEYEELLQFLKKMFWRKSKAEDVARE-IQMHCESFRAM 158
           P  IPE+   ++  D + F+  K   ELL FL ++F      E    +  + HC  +R  
Sbjct: 319 PSIIPEEIFFMRKFDSSLFKDIKNIHELLGFLGRLFMDLQDCEKFHHDYTEYHC--YRIG 376

Query: 159 ENLHLLFEEKKIRFKN--AKQADELMRLIRNLANNTR 193
           + L+  +EE+ +R K+   K AD     I+ L  NTR
Sbjct: 377 KPLYQNYEEEALRKKSQGVKDAD----FIKPLVTNTR 409


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,528,531,566
Number of extensions: 388223319
Number of successful extensions: 1051478
Number of sequences better than 1.0e-03: 17233
Number of HSP's gapped: 1028864
Number of HSP's successfully gapped: 23247
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)