# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_10894.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABO49466.1  [L=263]
Description: dred0 ABO49466.1 GIB00494CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
     0.0079   18.8   0.0       0.15   14.6   0.0    2.6  2  PF03622  IBV 3B protein
  ------ inclusion threshold ------
       0.22   14.0   0.0       0.36   13.3   0.0    1.5  1  PF03748  Flagellar basal body-associated protein FliL
       0.68   12.2   0.0        1.3   11.3   0.0    1.5  1  PF07214  Protein of unknown function (DUF1418)
        1.2   11.1   0.0        2.6   10.0   0.0    1.5  1  PF10003  Integral membrane protein (DUF2244)
        1.4   11.0   0.9        6.5    8.9   0.1    2.1  2  PF02825  WWE domain
        1.4   11.4   0.7        3.4   10.2   0.3    1.8  1  PF08138  Sex peptide (SP) family
        2.1    9.0   0.5        5.8    7.5   0.0    1.7  1  PF02460  Patched family
        3.5   10.4   0.1        7.9    9.2   0.0    1.7  1  PF01751  Toprim domain
        4.3    9.1   0.0        6.8    8.5   0.0    1.3  1  PF04951  D-aminopeptidase
        5.2    9.6   0.0         10    8.6   0.0    1.4  1  PF10177  Uncharacterised conserved protein (DUF2371)
          8    8.5   0.1         15    7.6   0.1    1.4  1  PF04276  Protein of unknown function (DUF443)
        9.1    7.4   0.3         17    6.5   0.0    1.5  1  PF09972  Predicted membrane protein (DUF2207)
         10    7.7   0.0         17    7.0   0.0    1.3  1  PF03918  Cytochrome C biogenesis protein
         10    8.7   0.1      1e+02    5.4   0.0    2.3  2  PF03004  Plant transposase (Ptta/En/Spm family)
         11    7.7   0.3         16    7.1   0.2    1.2  1  PF10322  Serpentine type 7TM GPCR chemoreceptor Sru
         20    7.0   0.0         21    6.9   0.0    1.3  1  PF00335  Tetraspanin family
         20    8.2   0.1         39    7.3   0.0    1.4  1  PF04277  Oxaloacetate decarboxylase, gamma chain
         21    6.5   0.0         41    5.5   0.0    1.4  1  PF04054  CCR4-Not complex component, Not1
         23    7.6   0.0         51    6.5   0.0    1.5  1  PF11625  Protein of unknown function (DUF3253)
         24    8.2   0.2         37    7.6   0.2    1.3  1  PF00630  Filamin/ABP280 repeat
         24    7.6   0.1         38    7.0   0.0    1.3  1  PF10541  Nuclear envelope localisation domain
         29    6.9   2.4         34    6.6   0.2    2.1  1  PF11176  Protein of unknown function (DUF2962)
         29    7.3   0.1         81    5.8   0.1    1.7  1  PF04369  Lactococcin-like family
         30    6.8   0.0         51    6.1   0.0    1.3  1  PF11807  Domain of unknown function (DUF3328)
         30    5.4   1.5         42    4.9   0.1    1.8  1  PF00423  Hemagglutinin-neuraminidase
         31    6.6   0.0         41    6.1   0.0    1.2  1  PF03006  Haemolysin-III related
         31    6.9   0.1         71    5.7   0.1    1.6  1  PF01873  Domain found in IF2B/IF5
         40    6.7   0.1    1.9e+02    4.5   0.0    2.0  1  PF01486  K-box region
         49    6.2   4.9        7.8    8.8   0.1    2.0  1  PF10333  GPI-Mannosyltransferase II co-activator
         52    5.9   1.3    5.6e+02    2.6   0.0    2.4  2  PF08776  VASP tetramerisation domain
         55    5.9   0.0    1.3e+02    4.6   0.0    1.6  1  PF00208  Glutamate/Leucine/Phenylalanine/Valine dehydrogenas
         56    5.7   0.1         97    4.9   0.0    1.3  1  PF03208  PRA1 family protein
         58    6.0   0.4    1.3e+02    4.9   0.3    1.6  1  PF06781  Uncharacterised protein family (UPF0233)
         61    6.1   0.3    1.3e+02    5.0   0.2    1.6  1  PF05814  Baculovirus protein of unknown function (DUF843)
         68    5.9   0.0    1.8e+02    4.5   0.0    1.7  1  PF01227  GTP cyclohydrolase I
         72    5.0   0.0      1e+02    4.6   0.0    1.2  1  PF06213  Cobalamin biosynthesis protein CobT
         90    4.1   0.1    1.2e+02    3.7   0.1    1.1  1  PF00999  Sodium/hydrogen exchanger family
         92    4.1   0.2    1.2e+02    3.7   0.2    1.1  1  PF05170  AsmA family
         99    4.5   0.0    1.5e+02    3.9   0.0    1.3  1  PF07212  Hyaluronidase protein (HylP)
    1.1e+02    4.3   0.0    3.2e+02    2.8   0.0    1.7  1  PF03140  Plant protein of unknown function
    1.1e+02    4.0   0.0    1.4e+02    3.7   0.0    1.1  1  PF07690  Major Facilitator Superfamily
    1.1e+02    4.9   0.4    2.4e+02    3.9   0.3    1.5  1  PF07664  Ferrous iron transport protein B C terminus
    1.2e+02    5.2   0.6    2.4e+02    4.3   0.4    1.4  1  PF06716  Protein of unknown function (DUF1201)
    1.8e+02    4.3   0.1    2.9e+02    3.6   0.1    1.3  1  PF06687  SUR7/PalI family
    1.9e+02    3.9   5.0      4e+02    2.8   3.5    1.5  1  PF12606  Tumour necrosis factor receptor superfamily member 
    2.2e+02    3.7   1.5    3.7e+02    3.0   1.0    1.3  1  PF02687  Predicted permease
    2.5e+02    3.5   0.8    4.5e+02    2.7   0.5    1.4  1  PF02077  SURF4 family
    2.6e+02    4.3   0.3    5.3e+02    3.3   0.2    1.4  1  PF00029  Connexin
    2.7e+02    4.4   0.1    6.4e+02    3.2   0.1    1.6  1  PF06480  FtsH Extracellular
    2.7e+02    2.2   0.1    4.5e+02    1.5   0.0    1.2  1  PF06011  Transient receptor potential (TRP) ion channel
    2.9e+02    4.4   0.1    7.4e+02    3.1   0.0    1.7  1  PF06954  Resistin
    4.6e+02    2.8   0.1      1e+03    1.7   0.1    1.6  1  PF06324  Pigment-dispersing hormone (PDH)
    4.7e+02    2.8   1.1    6.8e+02    2.2   0.1    1.7  1  PF05529  B-cell receptor-associated protein 31-like
    5.1e+02    3.3   4.4    8.4e+02    2.6   3.1    1.3  1  PF07811  TadE-like protein
    6.5e+02    2.8   0.0    1.2e+03    2.0   0.0    1.4  1  PF10535  Pyrrolo-quinoline quinone coenzyme C-terminus
    9.5e+02    2.8   4.9    2.6e+02    4.6   0.4    2.1  1  PF11337  Protein of unknown function (DUF3139)
    9.8e+02    1.9   2.5    2.2e+03    0.8   1.7    1.6  1  PF08333  Protein of unknown function (DUF1725)
    1.4e+03    2.2   1.4    4.6e+03    0.5   1.0    1.8  1  PF10587  Eukaryotic elongation factor 1 beta central acidic 
    1.5e+03    2.0   0.0    3.3e+03    0.9   0.0    1.4  1  PF09056  Prokaryotic phospholipase A2
    2.1e+03    0.9   3.0    3.7e+03    0.1   2.1    1.3  1  PF04024  PspC domain
    2.5e+03    0.6   4.4    5.2e+03   -0.4   3.0    1.5  1  PF10717  Occlusion-derived virus envelope protein ODV-E18
    3.2e+03    0.4   5.4    5.7e+03   -0.4   3.7    1.5  1  PF00737  Photosystem II 10 kDa phosphoprotein
    3.2e+03    0.7   3.9    5.8e+03   -0.1   2.7    1.4  1  PF11146  Protein of unknown function (DUF2905)
    3.5e+03    0.7   6.4    6.6e+03   -0.2   4.5    1.5  1  PF08194  DIM protein
    3.8e+03    0.7   6.4    5.5e+03    0.2   3.7    1.9  1  PF00672  HAMP domain


Domain and alignment annotation for each model:
>> PF03622  IBV 3B protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   14.6   0.0    0.0001      0.15      21      50 ..      60      87 ..      47      97 .. 0.86
   2 ?    1.0   0.0       1.8   2.8e+03      14      44 ..     113     143 ..     101     147 .. 0.76

  Alignments for each domain:
  == domain 1    score: 14.6 bits;  conditional E-value: 0.0001
     PF03622 21 nLqhissvlntevfDPfevCyYrgGsywel 50
                n qhis  +ntev +P    yY gG+y  l
  ABO49466.1 60 NYQHISELINTEVVEP--GIYYTGGKYLGL 87
                78**************..58*******876 PP

  == domain 2    score: 1.0 bits;  conditional E-value: 1.8
     PF03622  14 viqqisfnLqhissvlntevfDPfevCyYrg 44 
                 +  qi + +q i s + t+     e   Y++
  ABO49466.1 113 IQNQIKYPVQYITSTIVTDTDREVEKIQYHA 143
                 44699*******9998887666666666655 PP

>> PF03748  Flagellar basal body-associated protein FliL
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.3   0.0   0.00023      0.36       3      38 ..       6      48 ..       1     134 [. 0.72

  Alignments for each domain:
  == domain 1    score: 13.3 bits;  conditional E-value: 0.00023
     PF03748  3 kliiilllllllvvgggggvffllsgkqeaeq.........aaaa 38
                +l+++ +++lll++++++++++l  gk++  q         +  +
  ABO49466.1  6 LLLVVFIFILLLLGAAMVMIWYLNRGKDKSVQnsiefshesE--E 48
                367777777777777777777777777776667887765322..2 PP

>> PF07214  Protein of unknown function (DUF1418)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.3   0.0   0.00082       1.3      45      71 ..       6      32 ..       1      60 [. 0.77

  Alignments for each domain:
  == domain 1    score: 11.3 bits;  conditional E-value: 0.00082
     PF07214 45 ailmiflGvvlmlPaavvlvwrvaqll 71
                 +l++f+ ++l+l aa+v++w + ++ 
  ABO49466.1  6 LLLVVFIFILLLLGAAMVMIWYLNRGK 32
                57889****************998765 PP

>> PF10003  Integral membrane protein (DUF2244)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.0   0.0    0.0017       2.6      35      94 ..       7      68 ..       3      87 .. 0.81

  Alignments for each domain:
  == domain 1    score: 10.0 bits;  conditional E-value: 0.0017
     PF10003 35 awpvlpFaglellalalafrlsar..rardrEeitltpeellvirkgprgreqewefnpawv 94
                + +v++F +l l a ++++++ +r  + + +  i++++e + v+++ ++++++ ++  ++ +
  ABO49466.1  7 LLVVFIFILLLLGAAMVMIWYLNRgkDKSVQNSIEFSHESEEVLEITHKKPDKNYQHISELI 68
                568999999999999999999988334567899******************99998766555 PP

>> PF02825  WWE domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0       2.3   3.6e+03      14      38 ..      34      58 ..      19      69 .. 0.70
   2 ?    8.9   0.1    0.0042       6.5      34      64 ..     141     172 ..     133     177 .. 0.84

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 2.3
                S--SSEEE--HHHHHHHHHHHHTT- CS
     PF02825 14 dsngkWrpYspavsehIenayaake 38
                 s + ++++s++ +e +e  +++ +
  ABO49466.1 34 KSVQNSIEFSHESEEVLEITHKKPD 58
                4556778888888888888887755 PP

  == domain 2    score: 8.9 bits;  conditional E-value: 0.0042
                 HHTT--ECC.CCTTSTTEEEETTTTEEEES-- CS
     PF02825  34 yaakertle.vdifgrpytidfksmtqlreet 64 
                 y a+++t   v++  ++y+  +++m+q+r++ 
  ABO49466.1 141 YHAGKTTNHkVSLYCKQYIMELENMKQERRAM 172
                 77777755559******************986 PP

>> PF08138  Sex peptide (SP) family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.2   0.3    0.0022       3.4       4      32 ..       7      36 ..       1      43 [. 0.67

  Alignments for each domain:
  == domain 1    score: 10.2 bits;  conditional E-value: 0.0022
     PF08138  4 pillll.lvllvGlalsvewplnkrkdkss 32
                ++++++ ++ll+G a+ + w ln+ kdks+
  ABO49466.1  7 LLVVFIfILLLLGAAMVMIWYLNRGKDKSV 36
                33333313459***********99988764 PP

>> PF02460  Patched family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0037       5.8     361     423 ..       6      69 ..       1      79 [. 0.75

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0037
     PF02460 361 avlfdfiYqitffaavlaivakaeaegrevllkriak.eesaqriesessrksdkskeaeelks 423
                  +l+ fi+ + +++a++++    ++ +++++++ i+  +es++ +e ++ +++++ ++ +el+ 
  ABO49466.1   6 LLLVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFsHESEEVLEITHKKPDKNYQHISELIN 69 
                 57889*****************************887245556677777666555555555544 PP

>> PF01751  Toprim domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.2   0.0    0.0051       7.9      63      87 ..     127     151 ..      63     163 .. 0.78

  Alignments for each domain:
  == domain 1    score: 9.2 bits;  conditional E-value: 0.0051
                 EEE--SS----HHHHHHHHHCTH-H CS
     PF01751  63 iiatDpDreGekiawellellkpkn 87 
                  i tD Dre eki +++ +  ++k 
  ABO49466.1 127 TIVTDTDREVEKIQYHAGKTTNHKV 151
                 599**************99888775 PP

>> PF04951  D-aminopeptidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0    0.0044       6.8     147     234 ..     174     262 ..     165     263 .] 0.91

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.0044
                 S----EE---HHHHHHHHTTST.T-EE---EEEEETTEEEE--TTT---HHHHHHHHHHHSGGG-------SS-EEEEE-S----HHHH CS
     PF04951 147 gvpvvlvsGDdvlaeevkellp.evetvvvkealgryaakslspekaeeeireavkeavekakeakplklekpvelelefknsalAdla 234
                 +v  + +sGDd+l +  +++   + +++ ++e++ + a++ ++p  + ee+ +a ++ ++ +k +kp ++++ +   ++f+ +  Ad+a
  ABO49466.1 174 KVSWLVISGDDKLGAPGNPVQRiKERMALLQETFRSRAGIIMTPLTSTEEVVDAFQQIMQPEKLVKPSEVARLCMHPIKFNIKEIADIA 262
                 5777899********9999998889999*****************************************99999999999988888876 PP

>> PF10177  Uncharacterised conserved protein (DUF2371)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.0    0.0066        10      42      85 ..       8      51 ..       3      77 .. 0.76

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0066
     PF10177 42 vlilGvlvllvGiamavlGYwpksaeatspaatnlsssesselr 85
                ++++  ++ll+G+am ++ Y ++ +++  +++++ s+++++ l+
  ABO49466.1  8 LVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFSHESEEVLE 51
                566778999**************888888888887776665544 PP

>> PF04276  Protein of unknown function (DUF443)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.1    0.0096        15      87     123 ..       4      44 ..       1      60 [. 0.71

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0096
     PF04276  87 lekliviiiviivlllvlilrlilnkk.lkkkiynel...k 123
                 ++ l+v++i+i+ ll+  ++++++ ++ + k+++n +   +
  ABO49466.1   4 MTLLLVVFIFILLLLGAAMVMIWYLNRgKDKSVQNSIefsH 44 
                 67789999***999999988887655505556666555533 PP

>> PF09972  Predicted membrane protein (DUF2207)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.011        17     227     263 ..       5      41 ..       2      51 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.011
     PF09972 227 llillplllvlllllilillliwlkkgrepkkgveii 263
                  l+l++++++llll  +++++++l +g++++ ++ i+
  ABO49466.1   5 TLLLVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIE 41 
                 566777888888888899************9998654 PP

>> PF03918  Cytochrome C biogenesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0     0.011        17      98     136 ..       2      43 ..       1      55 [. 0.58

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.011
     PF03918  98 kpstllLWlgPllllllgllvl.llvlrrrrrkkae..eels 136
                 k  tllL ++ ++llllg++++ +++l+r ++k+ +   e+s
  ABO49466.1   2 KEMTLLLVVFIFILLLLGAAMVmIWYLNRGKDKSVQnsIEFS 43 
                 667888888888888887665405555555444433343333 PP

>> PF03004  Plant transposase (Ptta/En/Spm family)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.068     1e+02      59      75 ..      45      61 ..      21      72 .. 0.77
   2 ?    0.3   0.0       2.5   3.9e+03      62     124 ..     201     234 ..     192     243 .. 0.54

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.068
     PF03004 59 draevfieTHtkkDGty 75
                   ev++ TH+k+D++y
  ABO49466.1 45 ESEEVLEITHKKPDKNY 61
                5579***********96 PP

  == domain 2    score: 0.3 bits;  conditional E-value: 2.5
     PF03004  62 evfieTHtkkDGtyvde..kaeeiaekvkerlqereseseseasaesdgssredkneiflqvvgk 124
                 ++++eT + + G ++++   +ee+++ +++++q                               +
  ABO49466.1 201 ALLQETFRSRAGIIMTPltSTEEVVDAFQQIMQ-------------------------------P 234
                 445555555555544431134566666666655...............................3 PP

>> PF10322  Serpentine type 7TM GPCR chemoreceptor Sru
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.2      0.01        16     197     248 ..       3      53 ..       1      56 [. 0.86

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.01
     PF10322 197 siilllnsvfwlllililnvllfvklrkaklklsserkskkskkaevsLtlT 248
                 +++lll+ ++++ll l + +++++ l++ k   s ++  + s+ +e +L +T
  ABO49466.1   3 EMTLLLVVFIFILLLLGAAMVMIWYLNRGK-DKSVQNSIEFSHESEEVLEIT 53 
                 56678888899999999**********999.67777899**********999 PP

>> PF00335  Tetraspanin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.014        21      79     111 ..       7      39 ..       1     158 [. 0.73

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.014
     PF00335  79 ailllllflaelalailafvlrsqleaslksgl 111
                  +++++++l++l++a +++ + ++ +++ +++ 
  ABO49466.1   7 LLVVFIFILLLLGAAMVMIWYLNRGKDKSVQNS 39 
                 334444444444444444444444443333332 PP

>> PF04277  Oxaloacetate decarboxylase, gamma chain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.0     0.025        39      13      41 ..       8      36 ..       5      70 .. 0.80

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.025
     PF04277 13 giVFvfLilLiliisllskvikkaapeek 41
                ++VF+f +lL  +  ++ +  ++ + +  
  ABO49466.1  8 LVVFIFILLLLGAAMVMIWYLNRGKDKSV 36
                79*****************9888866554 PP

>> PF04054  CCR4-Not complex component, Not1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.026        41     269     293 ..      96     120 ..      92     130 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.026
     PF04054 269 kLakeldsegrylllnaianqLRYp 293
                 +++++++ e+r  +l ai nq++Yp
  ABO49466.1  96 SILSDGEIEAREDMLIAIQNQIKYP 120
                 678899******************9 PP

>> PF11625  Protein of unknown function (DUF3253)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.033        51       9      34 ..     222     247 ..     216     257 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.033
                 HHHHHHHHHHS-TT--B-HHHHHHHH CS
     PF11625   9 eaailallaargpgksiCPsevAral 34 
                 e+ + a+ +  +p+k + PsevAr  
  ABO49466.1 222 EEVVDAFQQIMQPEKLVKPSEVARLC 247
                 5667777778899***********86 PP

>> PF00630  Filamin/ABP280 repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.2     0.024        37      56      92 ..      62     157 ..      29     164 .. 0.69

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.024
                 ...............................................................C--EEEE-----EEEEE--S----EEEEEEE-- CS
     PF00630  56 e...........................................................eksvkanvsdnedgtytvsYtpeepgkyrvsvkldg 92 
                 +                                                           ++ +++ v+d++  + +++Y + +  +++vs+ +++
  ABO49466.1  62 QhiselintevvepgiyytggkylglariegtnfsilsdgeiearedmliaiqnqikypvQYITSTIVTDTDREVEKIQYHAGKTTNHKVSLYCKQ 157
                 3555555566666666666666677777777777777777777777777777655544433446667*************************9986 PP

>> PF10541  Nuclear envelope localisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0     0.025        38       9      28 ..       5      24 ..       1      54 [. 0.78

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.025
     PF10541  9 raalplqllLllllglacLl 28
                ++ l++++++llllg+a+ +
  ABO49466.1  5 TLLLVVFIFILLLLGAAMVM 24
                67889999999999999876 PP

>> PF11176  Protein of unknown function (DUF2962)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.2     0.022        34      51      95 ..     121     171 ..     101     176 .. 0.71

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.022
     PF11176  51 vaffqeavke......kekkpfseeevkelierylkrndeeleqlkserrk 95 
                 v+++ +++ +      ++ +    +++++ +  y+k+   ele++k+err 
  ABO49466.1 121 VQYITSTIVTdtdrevEKIQYHAGKTTNHKVSLYCKQYIMELENMKQERRA 171
                 66666666655554433333334456778899*****************96 PP

>> PF04369  Lactococcin-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.1     0.053        81       5      15 ..      93     103 ..      91     107 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.053
     PF04369   5 lNFnIvSDeEL 15 
                 +NF I+SD E+
  ABO49466.1  93 TNFSILSDGEI 103
                 8*******996 PP

>> PF11807  Domain of unknown function (DUF3328)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.033        51      13      64 ..       8      58 ..       2      72 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.033
     PF11807 13 llllvlllllllllllllasllsssrkkaakespsspspaldavkyenktfk 64
                l++++++llll  +++++++l + + k++++ s    + +++++++++k+ +
  ABO49466.1  8 LVVFIFILLLLGAAMVMIWYLNRGKDKSVQN-SIEFSHESEEVLEITHKKPD 58
                4678888999999999999999999999999.88888888888888777644 PP

>> PF00423  Hemagglutinin-neuraminidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.027        42      28      75 ..      99     146 ..      85     182 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.027
                 ----------------------------....---------------- CS
     PF00423  28 stgeiqnisktllsisesiksqvkdvksliseeltpklkiIgdevglt 75 
                 s gei+ + ++l++i+++ik  v+ ++s i  ++   ++ I+++ g t
  ABO49466.1  99 SDGEIEAREDMLIAIQNQIKYPVQYITSTIVTDTDREVEKIQYHAGKT 146
                 467888899********************************9998766 PP

>> PF03006  Haemolysin-III related
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.027        41     106     181 ..       4      81 ..       1      97 [. 0.72

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.027
     PF03006 106 lgllylvliwilavlGilvkllpvfsrkefrvlravlfllmgllgvipilhlilileslgeaa.....lvllvlggvlyll 181
                 + ll++v+i il +lG ++ +++ ++r + + +++++ +      v+ i+h  +  ++ +         + +v  g+ y+ 
  ABO49466.1   4 MTLLLVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFSHESEEVLEITH-KKPDKNYQ--HiseliNTEVVEPGIYYTG 81 
                 66789999*********************9***999999998888888888.33322222..2335633333334444444 PP

>> PF01873  Domain found in IF2B/IF5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.1     0.046        71      38      92 ..     107     161 ..      88     168 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.046
                 HHHHHHHHTSHHHHHHHHHHH---E-EEB-.--EEEE---SSSHHHHHHHHHHTH CS
     PF01873  38 sdiakalnRdpeyllkyllaelgtagsldgkdrlvvkgkfeekkledvldkyikk 92 
                 +d+  a++ + +y ++y+   + t +  ++++     gk +++k+    ++yi +
  ABO49466.1 107 EDMLIAIQNQIKYPVQYITSTIVTDTDREVEKIQYHAGKTTNHKVSLYCKQYIME 161
                 56667889999******************99999999999999999999988865 PP

>> PF01486  K-box region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.12   1.9e+02      21      50 ..     193     222 ..     185     225 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.12
     PF01486  21 lakLkkeienLqreqRhllGedLesLslke 50 
                 ++++k+++  Lq++ R + G  +++L+  e
  ABO49466.1 193 VQRIKERMALLQETFRSRAGIIMTPLTSTE 222
                 789*****************9999998765 PP

>> PF10333  GPI-Mannosyltransferase II co-activator
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.1    0.0051       7.8      35      89 ..     125     181 ..     103     187 .. 0.67

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.0051
     PF10333  35 sssyvsklssislknveikkiv.ttdieseektyv.elaelkkdetyqvkisWtaid 89 
                 +s++v+  ++ + k    + ++ + ++++  k y+ el+++k++   + k+sW  i 
  ABO49466.1 125 TSTIVTDTDREVEKIQYHAGKTtNHKVSLYCKQYImELENMKQERRAMAKVSWLVIS 181
                 44444444443333222222222668999999***9*****************8876 PP

>> PF08776  VASP tetramerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1      0.92   1.4e+03       4      11 ..     161     168 ..     159     169 .. 0.89
   2 ?    2.6   0.0      0.36   5.6e+02      25      34 ..     222     231 ..     221     235 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.92
     PF08776   4 dldRmKQE 11 
                 +l+ mKQE
  ABO49466.1 161 ELENMKQE 168
                 899****9 PP

  == domain 2    score: 2.6 bits;  conditional E-value: 0.36
     PF08776  25 eEiIdAfrqe 34 
                 eE++dAf q 
  ABO49466.1 222 EEVVDAFQQI 231
                 9******995 PP

>> PF00208  Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.086   1.3e+02     185     237 ..      36      91 ..      32      96 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.086
                 HHHHTTS---HHHHHHHHHHHHHHHHHHHHHHHHHHCS-...HHHHHHHHHHHHHH CS
     PF00208 185 lqnsqrlswteeevdeklkkimkeifkavveeakeykve...lvkaaniagferva 237
                 +qns  +s ++eev e ++k+ ++ ++++ e ++++ ve   ++++ + +g+ r++
  ABO49466.1  36 VQNSIEFSHESEEVLEITHKKPDKNYQHISELINTEVVEpgiYYTGGKYLGLARIE 91 
                 7999***************************9999998889888988888888876 PP

>> PF03208  PRA1 family protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.063        97     101     124 ..       5      28 ..       2      51 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.063
     PF03208 101 igllivsvlllfltsavsvllwll 124
                 ++ll+v +++l+l++a++v++w l
  ABO49466.1   5 TLLLVVFIFILLLLGAAMVMIWYL 28 
                 455666666667777777777765 PP

>> PF06781  Uncharacterised protein family (UPF0233)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.3     0.082   1.3e+02      33      57 ..       8      32 ..       2      41 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.082
     PF06781 33 fvalmvalmllGllwlvvfylseee 57
                +v+ ++ l+llG + ++++yl +++
  ABO49466.1  8 LVVFIFILLLLGAAMVMIWYLNRGK 32
                566778899************8876 PP

>> PF05814  Baculovirus protein of unknown function (DUF843)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.2     0.087   1.3e+02      25      47 ..       7      29 ..       1      47 [. 0.63

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.087
     PF05814 25 ellltllllfvlFiillnvyyik 47
                 l++++++l++l   ++ + y +
  ABO49466.1  7 LLVVFIFILLLLGAAMVMIWYLN 29
                34555556666656666666654 PP

>> PF01227  GTP cyclohydrolase I
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.12   1.8e+02      39      68 ..     220     249 ..     199     252 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.12
     PF01227  39 lteqiadalsellkpkgvaVvieAeHlCmt 68 
                  te+++da++++++p+++    e + lCm+
  ABO49466.1 220 STEEVVDAFQQIMQPEKLVKPSEVARLCMH 249
                 589**************9999999999997 PP

>> PF06213  Cobalamin biosynthesis protein CobT
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.066     1e+02     159     200 ..     192     233 ..     151     246 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.066
     PF06213 159 ppssaeklvdllrehiedkagkdldrledavedqaafarvvr 200
                 p + +++ ++ll+e    +ag  +  l  + e+  af ++++
  ABO49466.1 192 PVQRIKERMALLQETFRSRAGIIMTPLTSTEEVVDAFQQIMQ 233
                 44569999*********************************8 PP

>> PF00999  Sodium/hydrogen exchanger family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.1     0.076   1.2e+02     177     208 ..       4      35 ..       1      46 [. 0.79

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.076
                 -------------------------------- CS
     PF00999 177 lglliliflvvalgglllglviglllrlltkf 208
                 + ll+++f++++l++ ++ ++i++l+r   k+
  ABO49466.1   4 MTLLLVVFIFILLLLGAAMVMIWYLNRGKDKS 35 
                 56788999999999999999999999877776 PP

>> PF05170  AsmA family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.2      0.08   1.2e+02       3      37 ..       3      37 ..       1      46 [. 0.80

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.08
     PF05170  3 kalkilliilivlllll.ialialldtnnykptlqq 37
                   ++ll+++i +llll +a++++  +n++k+  +q
  ABO49466.1  3 E-MTLLLVVFIFILLLLgAAMVMIWYLNRGKDKSVQ 37
                4.5678888888888888************998776 PP

>> PF07212  Hyaluronidase protein (HylP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.098   1.5e+02     211     271 ..      80     140 ..      45     145 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.098
     PF07212 211 ttgkllrirnknddkfyvkpdggfyakedsivdgnlklkdpianehaatkkyvdekveklk 271
                 t gk l +   +  +f +  dg + a+ed  +  + ++k p+    ++  +  d +vek++
  ABO49466.1  80 TGGKYLGLARIEGTNFSILSDGEIEAREDMLIAIQNQIKYPVQYITSTIVTDTDREVEKIQ 140
                 779999999999999***************************9998888888999998875 PP

>> PF03140  Plant protein of unknown function
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.21   3.2e+02     309     333 ..     209     233 ..     205     247 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.21
     PF03140 309 rekgvlenllgsdeevaklfnkLck 333
                 +++g+++  l+s eev++ f+++ +
  ABO49466.1 209 SRAGIIMTPLTSTEEVVDAFQQIMQ 233
                 589*******************986 PP

>> PF07690  Major Facilitator Superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.092   1.4e+02     154     188 ..      10      42 ..       5      92 .. 0.70

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.092
     PF07690 154 vFlilailsllaavlvllllprepperkrkspaee 188
                 vF+++ +l+  a+  v+++++ + ++++ ++++e 
  ABO49466.1  10 VFIFILLLLGAAM--VMIWYLNRGKDKSVQNSIEF 42 
                 4555555555554..44777777777777777665 PP

>> PF07664  Ferrous iron transport protein B C terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.3      0.15   2.4e+02       1      22 [.       9      30 ..       7      39 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.15
     PF07664  1 vlfslYllgivvallvglllkk 22
                v+f+ +ll + +a+++ + l++
  ABO49466.1  9 VVFIFILLLLGAAMVMIWYLNR 30
                7899999999999999999995 PP

>> PF06716  Protein of unknown function (DUF1201)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.4      0.15   2.4e+02       9      31 ..       6      28 ..       3      34 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.15
     PF06716  9 lllafGfliclflfclvvfiWfv 31
                lll    +i l+l   +v+iW++
  ABO49466.1  6 LLLVVFIFILLLLGAAMVMIWYL 28
                55555566888999999****96 PP

>> PF06687  SUR7/PalI family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1      0.19   2.9e+02     154     178 ..       4      28 ..       2      45 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.19
     PF06687 154 lnlllsllsflstllaalldtllfv 178
                 ++lll +++f+++ll+a++++  + 
  ABO49466.1   4 MTLLLVVFIFILLLLGAAMVMIWYL 28 
                 5788999999999999999999987 PP

>> PF12606  Tumour necrosis factor receptor superfamily member 19
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   3.5      0.26     4e+02       3      18 ..       5      20 ..       4      29 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.26
     PF12606  3 afllVsiffvmglLgl 18
                + llV ++f++ lLg 
  ABO49466.1  5 TLLLVVFIFILLLLGA 20
                6789999999999985 PP

>> PF02687  Predicted permease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   1.0      0.24   3.7e+02     148     169 ..       6      27 ..       1      32 [. 0.50

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.24
     PF02687 148 illllllilliallasllparr 169
                 +ll++++ +l+ l a+++ ++ 
  ABO49466.1   6 LLLVVFIFILLLLGAAMVMIWY 27 
                 4444444444444444444444 PP

>> PF02077  SURF4 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.5      0.29   4.5e+02      62      84 ..       4      26 ..       1      36 [. 0.85

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.29
     PF02077 62 latllvlvvllglligsllvvlr 84
                +++llv+++++ ll+g+++v++ 
  ABO49466.1  4 MTLLLVVFIFILLLLGAAMVMIW 26
                56789999999*********985 PP

>> PF00029  Connexin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.2      0.35   5.3e+02      23      44 ..       6      27 ..       2      36 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.35
                HHHHHHHHHHHHHHHHHHHH-- CS
     PF00029 23 wltvlfifRilvlavaaekvye 44
                 l v+fif +l+l++a   +++
  ABO49466.1  6 LLLVVFIFILLLLGAAMVMIWY 27
                6899************999997 PP

>> PF06480  FtsH Extracellular
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.41   6.4e+02       2      24 ..      12      34 ..       5      54 .. 0.70

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.41
     PF06480  2 llwlllalvllllllslfggsgt 24
                +++lll+++ ++ +++l+ g  +
  ABO49466.1 12 IFILLLLGAAMVMIWYLNRGKDK 34
                67777777777777777654333 PP

>> PF06011  Transient receptor potential (TRP) ion channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.29   4.5e+02     378     419 ..       8      49 ..       2      56 .. 0.60

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.29
     PF06011 378 vvllallvglllyfafrviilarksvrlkknpaslLytdlkt 419
                  v+++++++ll+ +++ +++l r   +  +n+++  ++++++
  ABO49466.1   8 LVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFSHESEEV 49 
                 455666666666666666666666556666656666666555 PP

>> PF06954  Resistin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.48   7.4e+02       1      39 [.       1      40 [.       1      66 [. 0.67

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.48
     PF06954  1 mkaksllllllvlllqllvpvaee.cslesivekkikeal 39
                mk+++lll++++++l ll +++     l+   +k +++ +
  ABO49466.1  1 MKEMTLLLVVFIFILLLLGAAMVMiWYLNRGKDKSVQNSI 40
                8899999999998888876655431344555555555544 PP

>> PF06324  Pigment-dispersing hormone (PDH)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.1      0.67     1e+03       2       6 ..      65      69 ..      65      70 .. 0.95

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.67
     PF06324  2 SELIN 6 
                SELIN
  ABO49466.1 65 SELIN 69
                9**** PP

>> PF05529  B-cell receptor-associated protein 31-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1      0.44   6.8e+02     109     163 ..      11      65 ..       4      73 .. 0.65

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.44
     PF05529 109 tLfLslvlrrvvtlvselvkleeklealkkqaesatkaakklkeekekklkeeve 163
                  +f+ l+l   + +++ l + ++k+ + + + ++++++  +++++k +k+ + ++
  ABO49466.1  11 FIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFSHESEEVLEITHKKPDKNYQHIS 65 
                 4677777777777777777777777766666666666666556666555555555 PP

>> PF07811  TadE-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   3.1      0.55   8.4e+02       6      21 ..       3      18 ..       3      30 .. 0.56

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.55
     PF07811  6 EFAlvlPvlllllfgi 21
                E+ l+l v++++l+++
  ABO49466.1  3 EMTLLLVVFIFILLLL 18
                7778888888444432 PP

>> PF10535  Pyrrolo-quinoline quinone coenzyme C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.78   1.2e+03       1      11 [.     177     187 ..     177     187 .. 0.96

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.78
                 SS--EE-TT-- CS
     PF10535   1 WgpmsYDpelg 11 
                 W  +s D +lg
  ABO49466.1 177 WLVISGDDKLG 187
                 99*******98 PP

>> PF11337  Protein of unknown function (DUF3139)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.4      0.17   2.6e+02       1      52 [.       1      48 [.       1      80 [. 0.42

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.17
     PF11337  1 MkKkkviliviilivislvvgivlffagkqyerhkalkavdsyleekgiked 52
                Mk    +l v+i i++   +g ++   +  y      k+v++ +e  + +e+
  ABO49466.1  1 MKEMTLLLVVFIFILLL--LGAAMV--MIWYLNRGKDKSVQNSIEFSHESEE 48
                65433333444444433..333333..2233333444555555555554433 PP

>> PF08333  Protein of unknown function (DUF1725)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   1.7       1.4   2.2e+03       8      13 ..     160     165 ..     160     165 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 1.4
     PF08333   8 MELEnI 13 
                 MELEn+
  ABO49466.1 160 MELENM 165
                 *****7 PP

>> PF10587  Eukaryotic elongation factor 1 beta central acidic region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   1.0         3   4.6e+03      12      22 ..     161     171 ..     161     174 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 3
     PF10587  12 EaerireeRLa 22 
                 E+e +++eR a
  ABO49466.1 161 ELENMKQERRA 171
                 8999*****98 PP

>> PF09056  Prokaryotic phospholipase A2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.0       2.1   3.3e+03       6      41 ..     158     193 ..     154     196 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 2.1
                 .HHHHHHHHHHHHGGGGGGG------TTTTS----- CS
     PF09056   6 fsvsleeFvaarnakaepakldwssDgCssspdkpv 41 
                 + ++le+  ++r+a a+ + l+ s D+   +p++pv
  ABO49466.1 158 YIMELENMKQERRAMAKVSWLVISGDDKLGAPGNPV 193
                 55788999999999999999999*9*9999999997 PP

>> PF04024  PspC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   2.1       2.4   3.7e+03      29      49 ..       7      27 ..       3      29 .. 0.69

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 2.4
     PF04024 29 llvRlifvlllliagggliaY 49
                llv +if+llll a++++i Y
  ABO49466.1  7 LLVVFIFILLLLGAAMVMIWY 27
                677788999988554566777 PP

>> PF10717  Occlusion-derived virus envelope protein ODV-E18
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   3.0       3.4   5.2e+03      28      42 ..       4      18 ..       2      26 .. 0.88

  Alignments for each domain:
  == domain 1    score: -0.4 bits;  conditional E-value: 3.4
     PF10717 28 mtiLivlViiiLlil 42
                mt+L v+ i iLl+l
  ABO49466.1  4 MTLLLVVFIFILLLL 18
                999999999999986 PP

>> PF00737  Photosystem II 10 kDa phosphoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   3.7       3.7   5.7e+03      28      45 ..       1      18 [.       1      25 [. 0.82

  Alignments for each domain:
  == domain 1    score: -0.4 bits;  conditional E-value: 3.7
                HHHH---HHHHHHHHHHH CS
     PF00737 28 MgvamalfavFlliiLei 45
                M+ + +l++vF+ i+L +
  ABO49466.1  1 MKEMTLLLVVFIFILLLL 18
                6777899999**999975 PP

>> PF11146  Protein of unknown function (DUF2905)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   2.7       3.7   5.8e+03       2      22 ..       5      25 ..       4      32 .. 0.72

  Alignments for each domain:
  == domain 1    score: -0.1 bits;  conditional E-value: 3.7
     PF11146  2 grlLivlglvllvlglllpll 22
                  lL+v+ ++ll+lg+++ ++
  ABO49466.1  5 TLLLVVFIFILLLLGAAMVMI 25
                567888888899999988765 PP

>> PF08194  DIM protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   4.5       4.3   6.6e+03       1      18 [.       1      21 [.       1      25 [. 0.73

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 4.3
     PF08194  1 MKfLsl...vfvlgLLALana 18
                MK ++l   vf++ LL L +a
  ABO49466.1  1 MKEMTLllvVFIFILLLLGAA 21
                777777666888888888766 PP

>> PF00672  HAMP domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   3.7       3.6   5.5e+03       2      21 ..      11      30 ..       6      31 .. 0.62

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 3.6
                ---TTT-------HHHH--H CS
     PF00672  2 lvvlllalllalvlawllar 21
                ++++ll+l++a+v++w+l r
  ABO49466.1 11 FIFILLLLGAAMVMIWYLNR 30
                35666666666666666655 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (263 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       940  (0.078912); expected 238.2 (0.02)
Passed bias filter:                      670  (0.0562458); expected 238.2 (0.02)
Passed Vit filter:                        70  (0.00587643); expected 11.9 (0.001)
Passed Fwd filter:                        70  (0.00587643); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              65  [number of targets reported over threshold]
# CPU time: 0.26u 0.07s 00:00:00.33 Elapsed: 00:00:01
# Mc/sec: 2183.81
//