hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_10890.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABO49033.1
Accession:      [none]
Description:    dred0 ABO49033.1 GIB00494CH01 "arginine decarboxylase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0041180  Pyruvoyl-dependent histidine and arginine de   147.0    1.6e-44   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0041180    1/1       4   154 ..     1   159 []   147.0  1.6e-44

Alignments of top-scoring domains:
0041180: domain 1 of 1, from 4 to 154: score 147.0, E = 1.6e-44
                   *->elllgtliPkkvfltsGvGegetelaafdlAlldAgienfnLvrvss
                             +Pkk+f+t+++ eg+++l afd+All+A i+n+nL+rvss
  ABO49033.1     4    -------TPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSS 43   

                   ilPpgaeivgldklppGeilfvvmariasnepgelisaavgvAipkdkng
                   ilPpg++  +   lppG+++++++++i+sn+pge+isa+vgv+i  + + 
  ABO49033.1    44 ILPPGCQEDPGMVLPPGSLVPTAYGYIVSNVPGEIISACVGVGINSN-DS 92   

                   lGliseyhgygskedveelaremlkkmlelrglelveilvlaesvtvekl
                   +G+i+e++g +ske++e+ ++ m+k+++e+rg+el+ i+++ ++++vek+
  ABO49033.1    93 FGVIMEFSGKCSKEEAEQNITNMVKEAFETRGMELKDIKIASAEHKVEKI 142  

                   glalaavvllvf