hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_10897.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABO49715.1
Accession:      [none]
Description:    dred0 ABO49715.1 GIB00494CH01 "methyl-accepting chemotaxis sensory transducer"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0053558  Methyl-accepting chemotaxis protein (MCP) si   221.0      1e-66   1
0053501  Methyl-accepting chemotaxis protein (MCP) si   172.2    7.2e-53   2
0048676  Sensory domain-like                             48.2    2.5e-14   2
0051947  Sensory domain-like                             48.9    4.4e-13   1
0048581  Sensory domain-like                             24.2    1.6e-05   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0051947    1/1      53   196 ..     1   145 []    48.9  4.4e-13
0048581    1/2      57   197 ..     1   136 []    14.5   0.0091
0048676    1/2      57   192 ..     1   131 []    33.1  1.7e-09
0048581    2/2     203   240 ..    53    89 ..     9.7      0.2
0048676    2/2     203   267 ..    52   131 .]    15.1  0.00096
0053501    1/2     321   387 ..     1    67 [.     1.0      9.2
0053558    1/1     326   620 ..     1   305 []   221.0    1e-66
0053501    2/2     391   621 ..     1   227 []   171.1  1.5e-52

Alignments of top-scoring domains:
0051947: domain 1 of 1, from 53 to 196: score 48.9, E = 4.4e-13
                   *->kkleellerlellekllselllllkkl.....laedldellllllfl
                       ++++ l ++e ++++l     ++k l  +++ ++++  ++l+ll  
  ABO49715.1    53    GEMVASLIIREEIQHFLDSKGEIVKNLslaqeFQSQDKKQILKLLLS 99   

                   ld..pfllrvYildedGlqispnivkddsnwlldpsylgknwswRPYFle
                    +++++++ +Y + + G+   +      +   l++++   ++++R +++e
  ABO49715.1   100 AQnqSEFQNIYFVTGSGEITIA------PVKQLPKDF---DPRQRVWYQE 140  

                   aivkmrsrgklilsdpyldlatgelcvtfsyplrde.....gvlvvDidl
                   a+    ++g  + +dpy+d atg+ c t++ +++d++   +gvl +Di l
  ABO49715.1   141 AV----KKGTMVCTDPYIDQATGKPCMTVALAVKDSegrfvGVLGADIKL 186  

                   ssleelvgeilelledelgeralavarllannplvieallsgdpsdalqalaeelrk
                       +l+++e  + +l+    + +n ++ + ++s d  +++  l+ +++ 
  ABO49715.1    57    ASLIIREEIQHFLDSKGEIVKNLSLAQEFQSQDK-KQILKLLLSAQN 102  

                   atgadfivvtdrdgirlahsdpe..riGkplsgedikkal.nGeeyvsea
                   +++++ i+++  +g + + + ++  +  +p ++ ++++a+++G  + +  
  ABO49715.1   103 QSEFQNIYFVTGSGEITIAPVKQlpKDFDPRQRVWYQEAVkKGTMVCTDP 152  

                   lgtlg...pslrafvPiyddngkviGvvsvGislssvdellldilleqlidellqralavarllaaspaviealeagdrealqelleelrkl
                       + +i+e+ q++l     + ++  +++ ++++d  ++++ll +++++
  ABO49715.1    57    ASLIIREEIQHFLDSKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQ 103  

                   tgadyivvtdangirlahpdper..iGdrlsggdvvealltgesyvgiae
                   +++  i+++  +g +   p++++ +  d+ ++  + ea+++g  +    +
  ABO49715.1   104 SEFQNIYFVTGSGEITIAPVKQLpkDFDPRQRVWYQEAVKKGTMVCTDPY 153  

                   gs...ggpslrayaPifdadgkviGvvsvgislesleqlfivvtdrdgirlahsdperiGkpls.gedikkalnGeeyivvtdangirlahpdperiGdrlsggdvvealltgesyvgiaegsg
                      y++v d++g+++ hpd + i+ ++ + ++v+a+l+g+s + ++   g
  ABO49715.1   203    YFYVCDKQGKVIGHPDAKAINGDIMNRAYVKAALAGKSGFDTYADNG 249  

                   gpslrayaPifdadgkviGvvsvgislesleqllveelaasleevaaaaeelaalveeiaelaeeglelveeaveaieel
                       + + + +++ + a  +el  l+++i+e++++ +++++ + ++++++
  ABO49715.1   321    AIAQGNLTYSLTIARKDELGILSDSINEMTNHLKTIIGGVKDSTNRV 367  

                   aelveelveaveelsesseeDltvrldvkskdeigelaralntmvdnlrelisev...........e
                      +lt+ l++ +kde+g+l +++n+m+++l+++i+ v++ ++ ++ + +
  ABO49715.1   326    NLTYSLTIARKDELGILSDSINEMTNHLKTIIGGVkdstnrvtgacN 372  

                   elsegaeeqaasleevaaaleelsatveevaenaeeaaelaeeaselaee
                   +++ ++e+++++ ++ a+ +++++at+e+++++ae+++e++ ++s +a++
  ABO49715.1   373 SMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSAQH 422  

                   glevveeaveaieeiaelveelaevveelsesseeIgeivdvIddIAeqT
                   g+e ++e++ a+e i ++++e++++++e++++s++I+ i+++I++IAeqT
  ABO49715.1   423 GQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKIQHITTIITQIAEQT 472  

                   nLLALNAaIEAARAGEaGrGFAVVAdEVRkLAertaeatkeIselieeiq
                   nLLALNAaIEAARAGE+G+GF VVAdEVRkLAe+t+ at+eI+++ie++ 
  ABO49715.1   473 NLLALNAAIEAARAGEHGKGFTVVADEVRKLAEQTSAATREIHGVIENVY 522  

                   eateeaveaieeslelveegvelveeagealeeivesieeisdlvseiaa
                   +++++ v+ + ++ e+ve g++ v+eage++++i+  iee+++ +++i+ 
  ABO49715.1   523 ASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINIEELVEKMAQITR 572  

                   aaeeqsaaieeiaraveeiaevteenaalaeevaaaaeelselaeellel
                   a+  +sa+i+++                     aaa++e+++++ee +++
  ABO49715.1   573 ATITMSASIQNV---------------------AAASQEQAAIIEEENKM 601  

                   vsrfkllaeelkelvskfklveelaasleevaaaaeelaalveeiaelaeeglelveeaveaieel
                       ++++aa++e+++a+ae+++++v +++ +a++g+e ++e++ a+e +
  ABO49715.1   391    DISNVAATTEQITASAENINEMVGSVSLSAQHGQEEIGEVIGAMEGI 437  

                   aelveelveaveelsesseeigeivdviddiAeqTnLLALNAaiEAARAG
                    ++++e+++a++e++++s++i++i+++i++iAeqTnLLALNAaiEAARAG
  ABO49715.1   438 KSSTNEISRAISEVENQSKKIQHITTIITQIAEQTNLLALNAAIEAARAG 487  

                   eaGrGFaVVAdEVrkLAertaeatkeiselieeiqeeveeavelveeage
                   e+G+GF VVAdEVrkLAe+t+ at+ei+++ie+++++v++ v+ +   +e
  ABO49715.1   488 EHGKGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNE 537  

                   aleeiveaveeisdlveeiaaaaeeqsavieeiseaveeiselaeetaal
                   ++e   + v+e  ++++ i+ ++ee+ + + +i++a+ ++s++++++aa+
  ABO49715.1   538 MVEMGSQRVQEAGEVFKTITINIEELVEKMAQITRATITMSASIQNVAAA 587  

                   aeevaaaaee.......lselaeelkelvsrfkldle