RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABO48707.1 dred0 ABO48707.1 GIB00494CH01 "metal dependent
phosphohydrolase"
         (472 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3bjdC [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)                57   1e-10

>3bjdC [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
          Length = 320

 Score = 57.1 bits (137), Expect = 1e-10
 Identities = 37/342 (10%), Positives = 66/342 (19%), Gaps = 98/342 (28%)

Query: 22  VRDL----FLNKIPVDLDFCV---------------TAKVFALAQ--------------- 47
            R+       N    +                     +K+ ALA+               
Sbjct: 2   TRNFSLPQLQNLPIEEARIVADALAVHATSRQIDSAASKLAALAEAGLKGDRQAYAAYQQ 61

Query: 48  -TLTQQYQGSLVTLDDQREMLRVVTNSWHLDFSP--LRDEILEKDLFARDFTLNAMALPV 104
                     + T   +R + R +        +    R    E      +  + A +   
Sbjct: 62  LLYVLSLSDDVATAQTRRWLARAIYRVEERFPAADLSRALSEEDFQKRLEQEIAAQSR-- 119

Query: 105 SMGINKYNWQNQIQDPTXXXXXXXXXXXRAASSSSIQQDPLRSLRGIRFAAT--YNLAII 162
                         +             RA     ++    R+ R  R AA    NL  +
Sbjct: 120 --------------ERHPSQYVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDV 165

Query: 163 PETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHFWQYLLPGQLRMA 222
            E   L R     + +   +     L       I                  L  + R  
Sbjct: 166 DEAAALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEADFQA-VSTPEEIAYLNNRARAF 224

Query: 223 QTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVLKL 282
           +          V       Y    V+                                  
Sbjct: 225 RH-------AEVGWGLAVFYITELVV--------------------------------NH 245

Query: 283 AALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLK 324
             L   + +       ED    +  H     P A+     + 
Sbjct: 246 EKLYRALLQAGL---SEDQAEYYKVHISLVPPRAKREWQLIA 284


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0434    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 19,909,549
Number of extensions: 1247606
Number of successful extensions: 15591
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7654
Number of HSP's successfully gapped: 454
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)