RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABO49099.1 dred0 ABO49099.1 GIB00494CH01 "conserved
hypothetical protein"
         (128 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3bywA [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE                     32   9e-04

>3bywA [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
          Length = 155

 Score = 32.2 bits (72), Expect = 9e-04
 Identities = 4/87 (4%), Positives = 10/87 (11%), Gaps = 3/87 (3%)

Query: 36  TMDGQGKLFCLAGVGGKIGSFV--EKAKDGSKVIVIDGCNLHCARKILENADIPINTHIV 93
            +     L           +       +     + I                       +
Sbjct: 37  KLRKDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELAQLPADATI 96

Query: 94  LTDLGVAKNNNLINEQTVIHENKVKIL 120
                         E        V+  
Sbjct: 97  AI-SATEDETTAGIEGDDSTTETVERD 122


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.314    0.135    0.364 

Gapped
Lambda     K      H
   0.267   0.0463    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 11,520,023
Number of extensions: 638062
Number of successful extensions: 7569
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2944
Number of HSP's successfully gapped: 96
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.5 bits)