RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABO49938.1 dred0 ABO49938.1 GIB00494CH01 "glycosyl transferase,
family 2"
         (640 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2cg3A [x.x.x] SDSA1                                                    74   1e-15
2cfuA [x.x.x] SDSA1                                                    70   2e-14
2bedA [x.x.x] PROTEIN                                                  65   5e-13
1dceA [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB GERANYLGERANYLTRAN...    64   2e-12
2cfzA [x.x.x] SDSA1                                                    63   3e-12
3ckqA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         62   5e-12
2cg2A [x.x.x] SDSA1                                                    62   5e-12
3cv0A [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5              62   6e-12
3ck7D [x.x.x] SUSD                                                     61   7e-12
3bcvA [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN                     61   9e-12
2d0jA [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-               60   2e-11
2c0mA [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR                  60   3e-11
2ae7A [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1                         58   8e-11
2bo7A [x.x.x] MANNOSYLGLYCERATE SYNTHASE                               57   1e-10
3e26A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         57   2e-10
2d7iA [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10         57   2e-10
3draA [x.x.x] PROTEIN                                                  56   2e-10
2c0nA [x.x.x] A197                                                     56   3e-10
2dm9A [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E                            56   4e-10
3c3oA [x.x.x] PROGRAMMED CELL DEATH 6-INTERACTING PROTEIN              55   4e-10
3ckjA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         55   8e-10
3e25A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         55   8e-10
3cvlA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5              53   2e-09
3ckbB [x.x.x] SUSD                                                     52   4e-09
2bo4A [x.x.x] MANNOSYLGLYCERATE SYNTHASE                               51   8e-09
2dl1A [x.x.x] SPARTIN                                                  51   8e-09
2agdA [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1                         51   9e-09
2d0jD [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-               51   1e-08
3dstA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          51   1e-08
3e4bA [x.x.x] ALGK                                                     50   1e-08
3e33A [a.118.6 (1d8dA)] PROTEIN                                        50   1e-08
3cvqA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5              50   1e-08
2c2lA [x.x.x] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN            50   2e-08
3cvpA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5              50   2e-08
3cvnA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR                   49   4e-08
3dsuA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          48   6e-08
3dswA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          48   7e-08
3dsvA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          47   1e-07
3beeB [x.x.x] PUTATIVE YFRE PROTEIN                                    46   4e-07
3beeA [x.x.x] PUTATIVE YFRE PROTEIN                                    45   5e-07
2c63A [x.x.x] 14-3-3 PROTEIN ETA                                       45   8e-07
3ck7A [x.x.x] SUSD                                                     45   8e-07
3c72A [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          44   1e-06
2dbaA [x.x.x] SMOOTH MUSCLE CELL ASSOCIATED PROTEIN-1, ISOFORM         44   1e-06
2b05A [x.x.x] 14-3-3 PROTEIN GAMMA                                     44   1e-06
1a37A [a.118.7] 14-3-3 PROTEIN ZETA                                    44   1e-06
1a38A [a.118.7] 14-3-3 PROTEIN ZETA                                    43   2e-06
2btpA [x.x.x] 14-3-3 PROTEIN TAU                                       43   2e-06
2e2eA [x.x.x] FORMATE-DEPENDENT NITRITE REDUCTASE COMPLEX NRFG         43   3e-06
2b05F [x.x.x] 14-3-3 PROTEIN GAMMA                                     42   6e-06
3dssA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          42   6e-06
2bugA [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5                   41   9e-06
3ck7B [x.x.x] SUSD                                                     41   1e-05
3ceqA [x.x.x] KINESIN LIGHT CHAIN 2                                    41   1e-05
2avpA [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN                          40   2e-05
2d4cD [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2                       40   2e-05
3edtH [x.x.x] KINESIN LIGHT CHAIN 2                                    40   2e-05
2axvA [x.x.x] PRGX                                                     40   2e-05
3dsxA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA          40   2e-05
1e96B [a.118.8] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,        39   3e-05
2c08A [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2                       39   3e-05
2axuL [x.x.x] PRGX                                                     39   5e-05
3e6yB [x.x.x] 14-3-3-LIKE PROTEIN C                                    39   5e-05
2crbA [x.x.x] NUCLEAR RECEPTOR BINDING FACTOR 2                        38   6e-05
2axuE [x.x.x] PRGX                                                     38   6e-05
2e0zC [x.x.x] VIRUS-LIKE PARTICLE                                      38   8e-05
2c23A [x.x.x] 14-3-3 BETA/ALPHA                                        38   9e-05
3efzD [x.x.x] 14-3-3 PROTEIN                                           37   1e-04
2c0lA [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR                  37   2e-04
2bq0B [x.x.x] 14-3-3 BETA/ALPHA                                        37   2e-04
2axzB [x.x.x] PRGX                                                     36   2e-04
2b05E [x.x.x] 14-3-3 PROTEIN GAMMA                                     36   3e-04
2aw6B [x.x.x] PRGX                                                     36   3e-04
2bq0A [x.x.x] 14-3-3 BETA/ALPHA                                        35   5e-04
2axuB [x.x.x] PRGX                                                     35   5e-04
3efzC [x.x.x] 14-3-3 PROTEIN                                           35   6e-04
2c1nA [x.x.x] 14-3-3 PROTEIN ZETA/DELTA                                35   8e-04

>2cg3A [x.x.x] SDSA1
          Length = 617

 Score = 73.7 bits (179), Expect = 1e-15
 Identities = 18/182 (9%), Positives = 40/182 (21%), Gaps = 17/182 (9%)

Query: 172 HYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAA 231
                +                    V +    +L  + G          +       A 
Sbjct: 353 IGQVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATL-DPLSPEDSAG 411

Query: 232 NNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKH 291
              +       + L     A ++ G+    ++V+ + +   P+          +L QL +
Sbjct: 412 RYVEYG---GAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGY 468

Query: 292 YHKAVELFLQAVAL-PEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD 350
             +        ++   E                       A+        L  YL    D
Sbjct: 469 QAENAGWRNSYLSAAYELRHGV------------PRDQGSADALAADTGLLFDYLGVRLD 516

Query: 351 NP 352
             
Sbjct: 517 AG 518



 Score = 61.8 bits (148), Expect = 5e-12
 Identities = 17/202 (8%), Positives = 28/202 (13%), Gaps = 35/202 (17%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
                +              G            Y    Y    EV+ +            
Sbjct: 397 NPATLDPLSPEDSAGRYVEYGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPD----N 452

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
                    A    G  A+        L               S   L      +  +L 
Sbjct: 453 RAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDQGSADALAADTGLLFDYLG 512

Query: 302 AVALP-------------------------------EQPPQYASFAGVRGFRSLYHLGEI 330
                                                     +  AG         L  +
Sbjct: 513 VRLDAGAAEGKALSINLRLPDIGENYLLELKNSHLNNLRGVQSEDAGQTVSIDRADLNRL 572

Query: 331 AEVFLNYEEALRYYLESLRDNP 352
               ++    +         NP
Sbjct: 573 LLKEVSAVRLVFEGKLKSSGNP 594



 Score = 56.4 bits (134), Expect = 2e-10
 Identities = 12/71 (16%), Positives = 20/71 (28%), Gaps = 1/71 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
             +  G Y   VE++   + A   N  A  L A+   +LG   E        +       
Sbjct: 428 ASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELR 487

Query: 617 RYYISQSKLYE 627
                     +
Sbjct: 488 HGVPRDQGSAD 498



 Score = 54.9 bits (130), Expect = 7e-10
 Identities = 16/188 (8%), Positives = 28/188 (14%), Gaps = 13/188 (6%)

Query: 252 YHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQ 311
                   +  D    G       A L+ Y G                            
Sbjct: 361 RLPPSLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGR---YVEYG 417

Query: 312 YASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENP 371
            A          L      +     Y   +      +   P  + A E     L+     
Sbjct: 418 GAER--------LLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQ 469

Query: 372 EYTRECLEKV--LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSF 429
                         +                 A    L     +     ++       + 
Sbjct: 470 AENAGWRNSYLSAAYELRHGVPRDQGSADALAADTGLLFDYLGVRLDAGAAEGKALSINL 529

Query: 430 CLIQERRF 437
            L      
Sbjct: 530 RLPDIGEN 537



 Score = 52.6 bits (124), Expect = 3e-09
 Identities = 17/239 (7%), Positives = 40/239 (16%), Gaps = 33/239 (13%)

Query: 383 DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALR 442
             +       L                      +    AE L  ++        +   + 
Sbjct: 381 HNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYGGAERLLEQARASYARGEYRWVVE 440

Query: 443 ILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQE 502
           ++N           A+  Q       G + +         +    E    + R    +  
Sbjct: 441 VVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAY-ELRHGVPRDQGSADA 499

Query: 503 KRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEH 562
                                       + L               G  +   +RL    
Sbjct: 500 LAAD------------------------TGLLFDYLGVRLDAGAAEGKALSINLRLPDIG 535

Query: 563 GYYEKTVELLQEYIEANQN--------GEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
             Y   ++                         L     +    +      +     +P
Sbjct: 536 ENYLLELKNSHLNNLRGVQSEDAGQTVSIDRADLNRLLLKEVSAVRLVFEGKLKSSGNP 594



 Score = 51.4 bits (121), Expect = 7e-09
 Identities = 16/177 (9%), Positives = 37/177 (20%), Gaps = 2/177 (1%)

Query: 291 HYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD 350
             H  + L             + S +         +LG         +            
Sbjct: 355 QVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYV 414

Query: 351 NPGFQPALERIIKILKPRENPEYTRECLEKVL--DFSSPQATLILSNIFFQQGAYKLTLE 408
             G    L    +    R    +  E + +++  +  +  A  + ++   Q G       
Sbjct: 415 EYGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAG 474

Query: 409 FLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCF 465
           +    +         + R              L        D+        +  L  
Sbjct: 475 WRNSYLSAAYELRHGVPRDQGSADALAADTGLLFDYLGVRLDAGAAEGKALSINLRL 531



 Score = 50.6 bits (119), Expect = 1e-08
 Identities = 6/71 (8%), Positives = 12/71 (16%), Gaps = 1/71 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
                   +                 E     A      G++          +  +P   
Sbjct: 394 YDGNPATLDPLSPEDSAGRYVEYGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNR 453

Query: 617 RYYISQSKLYE 627
                Q+   E
Sbjct: 454 AARELQADALE 464


>2cfuA [x.x.x] SDSA1
          Length = 627

 Score = 69.6 bits (168), Expect = 2e-14
 Identities = 22/232 (9%), Positives = 42/232 (18%), Gaps = 10/232 (4%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
                  +        VE  G            Y    Y    EV+ +            
Sbjct: 405 PATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPD----N 460

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
                    A    G  A+        L               S   L      +     
Sbjct: 461 RAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDQGSADALAAMDTGLLFDYL 520

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
            V L     +  + +     R             N        ++S             +
Sbjct: 521 GVRLDAGAAEGKALSIN--LRLPDIGENYLLELKNSHLNNLRGVQSEDAGQTVSIDRADL 578

Query: 362 IKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERL 413
            ++L    +        +      +P     L  +    G +    + +   
Sbjct: 579 NRLLLKEVSAVRLVFEGKLKSS-GNPLLLGQLFGML---GDFDFWFDIVTPA 626



 Score = 51.9 bits (122), Expect = 5e-09
 Identities = 8/82 (9%), Positives = 15/82 (18%), Gaps = 1/82 (1%)

Query: 552 MLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIE 610
                    + GY  +       Y+ A  +          +   L             + 
Sbjct: 464 RELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDQGSADALAAMDTGLLFDYLGVR 523

Query: 611 LDPSQPRYYISQSKLYEDRSEK 632
           LD            L      +
Sbjct: 524 LDAGAAEGKALSINLRLPDIGE 545



 Score = 51.5 bits (121), Expect = 7e-09
 Identities = 19/240 (7%), Positives = 44/240 (18%), Gaps = 22/240 (9%)

Query: 395 NIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIY 454
                     L+ E            AE L  ++        +   + ++N         
Sbjct: 401 YDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPDN 460

Query: 455 PLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGK 514
             A+  Q       G + +         +    E    + R    +         +    
Sbjct: 461 RAARELQADALEQLGYQAENAGWRNSYLSAAY-ELRHGVPRDQGSADALAAMDTGLLFDY 519

Query: 515 DAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQE 574
             V L             L                   L  I   +        +  L+ 
Sbjct: 520 LGVRLDAGAAEGKALSINL------------------RLPDIGENYLLELKNSHLNNLRG 561

Query: 575 YIEANQNGEAHFLLA---ETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRSE 631
               +         A       +    +      +     +P            ++   +
Sbjct: 562 VQSEDAGQTVSIDRADLNRLLLKEVSAVRLVFEGKLKSSGNPLLLGQLFGMLGDFDFWFD 621


>2bedA [x.x.x] PROTEIN
          Length = 313

 Score = 65.1 bits (157), Expect = 5e-13
 Identities = 31/338 (9%), Positives = 84/338 (24%), Gaps = 33/338 (9%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
           L L      L+                    +  +   E+                 +  
Sbjct: 3   LSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDV-----------YDYFR 51

Query: 329 EIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL---DFS 385
            + +     E A +   +++  N            +L+  +            +      
Sbjct: 52  AVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPK 111

Query: 386 SPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILN 445
           + Q       +          LEF+  ++     +      + + + + R +   L+ ++
Sbjct: 112 NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVD 171

Query: 446 EYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRK 505
           +   +          +               L +E+                  + E  K
Sbjct: 172 QLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREV----------------QYTLEMIK 215

Query: 506 YVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEHGYY 565
            V       + +  +L   G   Y + L ++ +L             L  I         
Sbjct: 216 LVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSP-YLIAFLVDIYEDMLENQC 274

Query: 566 EKTVELLQEYIEAN-QNGEAHF-LLAETHRELGDFIEA 601
           +   ++L + +E      +    +  E  R +G  +++
Sbjct: 275 DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQS 312



 Score = 64.3 bits (155), Expect = 9e-13
 Identities = 22/228 (9%), Positives = 67/228 (29%), Gaps = 14/228 (6%)

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
             L R           P          +     + D++ Y    L + +   +A +L   
Sbjct: 10  YVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRD 69

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESL-RDNPGFQPALER 360
           A+ L                   +    +        +    Y+ ++  + P        
Sbjct: 70  AIELNAANYTV-----------WHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHH 118

Query: 361 IIKILKPRENPEYTRECLEKV--LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGN 418
              +++  ++P    E +  +   D  +  A      +  +   +   L+++++L++   
Sbjct: 119 RRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDV 178

Query: 419 SSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFW 466
            +  +  ++ F +     + +   +  E      +  L   N+    +
Sbjct: 179 RNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNY 226



 Score = 62.8 bits (151), Expect = 3e-12
 Identities = 24/308 (7%), Positives = 72/308 (23%), Gaps = 19/308 (6%)

Query: 322 RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV 381
                  E A++    +      +  +  +  F+   +    +L+  E  E   +     
Sbjct: 11  VLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDA 70

Query: 382 --LDFSSPQATLILSNIFFQQGAYKLTLEFLER-LIRMGNSSAEILFRKSFCLIQERRFL 438
             L+ ++         +                 +I     + ++   +   +   +   
Sbjct: 71  IELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPS 130

Query: 439 EALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLL 498
           + L  + +          A  ++                V ++   +             
Sbjct: 131 QELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDV------------ 178

Query: 499 RSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRL 558
             +    +  R F+  +        V        L  ++ +            +L    L
Sbjct: 179 --RNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGL 236

Query: 559 YHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRY 618
                   + ++L      ++    A  +              +     A+EL     + 
Sbjct: 237 SRYPNLLNQLLDLQPS--HSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKE 294

Query: 619 YISQSKLY 626
             +  K Y
Sbjct: 295 KDTIRKEY 302



 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 4/47 (8%), Positives = 6/47 (12%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
                +   AE                  I         Y     + 
Sbjct: 8   PTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVL 54


>1dceA [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB
           GERANYLGERANYLTRANSFERASE ALPHA
          Length = 566

 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 28/265 (10%), Positives = 58/265 (21%), Gaps = 15/265 (5%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
           +         E+         Q           +    + +     +G      L++  Q
Sbjct: 1   HGRLKVKTSEEQAEAKRLEREQKLK-------LYQSATQAVFQKRQAGELDESVLELTSQ 53

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAV-ALPEQPPQYASFAGVRGFRSLYH 326
            L   P++A L       L  L+      E        L              G      
Sbjct: 54  ILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRC 113

Query: 327 LGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI-----IKILKPRENPEYTRECLEKV 381
                    N+   L      L  +       +          + P E   +T   +   
Sbjct: 114 WLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLIT-- 171

Query: 382 LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
            +FS+  +    S +  Q      +         +     E++    F    ++      
Sbjct: 172 RNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYH 231

Query: 442 RILNEYTADSYIYPLAKFNQILCFW 466
           R L        +      ++     
Sbjct: 232 RWLLGRAEPHDVLCCVHVSREEACL 256



 Score = 37.7 bits (86), Expect = 9e-05
 Identities = 7/63 (11%), Positives = 12/63 (19%), Gaps = 1/63 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
                   E  +EL  + + AN           E  + L      +              
Sbjct: 37  KRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLE 96

Query: 617 RYY 619
              
Sbjct: 97  SCL 99


>2cfzA [x.x.x] SDSA1
          Length = 630

 Score = 62.6 bits (150), Expect = 3e-12
 Identities = 20/239 (8%), Positives = 47/239 (19%), Gaps = 38/239 (15%)

Query: 172 HYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAA 231
           +        +       +        VE  G            Y    Y    EV+ +  
Sbjct: 398 NRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLV 457

Query: 232 NNTDSSTIYF------------------------------PKLLRYIVLAYHSGGQPAKA 261
                +                                     +     +  +       
Sbjct: 458 FAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDQGSADALAAMDTG 517

Query: 262 LDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGF 321
           L     G++L    A+         L     +  +EL    +         +  AG    
Sbjct: 518 LLFDYLGVRLDAGAAEGKALSINLRLPDIGENYLLELKNSHLNN--LRGVQSEDAGQTVS 575

Query: 322 RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEK 380
                L  +    ++    +         NP     L  ++       + ++  + +  
Sbjct: 576 IDRADLNRLLLKEVSAVRLVFEGKLKSSGNPLLLGQLFGMLG------DFDFWFDIVTP 628



 Score = 54.1 bits (128), Expect = 1e-09
 Identities = 33/280 (11%), Positives = 63/280 (22%), Gaps = 20/280 (7%)

Query: 324 LYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV-- 381
             H        L+ E   R Y  S+  N               P      + E       
Sbjct: 365 QVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYV 424

Query: 382 LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
                 +  L  +   + +G Y+  +E + RL+     +      ++  L Q     E  
Sbjct: 425 EYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENA 484

Query: 442 RILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQ 501
              N Y + +Y                               L+     E     +    
Sbjct: 485 GWRNSYLSAAYELRHGVPRDQGSADALAAMDTGLLFDYLGVRLDA-GAAEGKALSINLRL 543

Query: 502 EKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHE 561
                 + + L               L      + E+       + +     D+ RL  +
Sbjct: 544 PDIGENYLLELKN-----------SHLNNLRGVQSEDAG-----QTVSIDRADLNRLLLK 587

Query: 562 HGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIE 600
                + V   +     N       F +        D + 
Sbjct: 588 EVSAVRLVFEGKLKSSGNPLLLGQLFGMLGDFDFWFDIVT 627



 Score = 41.4 bits (95), Expect = 7e-06
 Identities = 4/69 (5%), Positives = 11/69 (15%), Gaps = 1/69 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
                  E         +  N +     +L             +                
Sbjct: 372 LPPSLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAE 431

Query: 618 YYISQSKLY 626
             + Q++  
Sbjct: 432 RLLEQARAS 440



 Score = 39.5 bits (90), Expect = 3e-05
 Identities = 8/69 (11%), Positives = 14/69 (20%), Gaps = 1/69 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
             + GY  +       Y+ A  +          +   L             + LD     
Sbjct: 474 LEQLGYQAENAGWRNSYLSAAYELRHGVPRDQGSADALAAMDTGLLFDYLGVRLDAGAAE 533

Query: 618 YYISQSKLY 626
                  L 
Sbjct: 534 GKALSINLR 542



 Score = 34.9 bits (78), Expect = 7e-04
 Identities = 8/135 (5%), Positives = 23/135 (17%), Gaps = 11/135 (8%)

Query: 173 YGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVL----- 227
                   D     +  L      +  + G    K                 E+      
Sbjct: 501 VPRDQGSADALAAMDTGLLFDYLGVRLDAGAAEGKALSINLRLPDIGENYLLELKNSHLN 560

Query: 228 IQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLL 287
                 ++ +          +           + +   +      P      +       
Sbjct: 561 NLRGVQSEDAGQTVSIDRADLNRLLLKEVSAVRLVFEGKLKSSGNPLLLGQLFG------ 614

Query: 288 QLKHYHKAVELFLQA 302
            L  +    ++   A
Sbjct: 615 MLGDFDFWFDIVTPA 629


>3ckqA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 302

 Score = 61.9 bits (149), Expect = 5e-12
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 12/132 (9%)

Query: 4   RISLCMIVKNEEGNIRRCLASVTGVVN----EIIVVDTGSTDNTCKIAREMGARIYS--- 56
            IS+ +   +EE  I   + S++ +V+    E+IV+D+GSTD+T   A   GAR+ S   
Sbjct: 35  TISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSREQ 94

Query: 57  ----FEWNNNFSDARNFSLAKATGDWILFLDADEELAGESR-EVLVKYVADEQVEGYFIK 111
                       +A   SLA + GD ++F+D+D           LV  +           
Sbjct: 95  ALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVKS 154

Query: 112 IINYLGKEGWTE 123
                     TE
Sbjct: 155 FYRRPLGGRVTE 166


>2cg2A [x.x.x] SDSA1
          Length = 629

 Score = 61.8 bits (148), Expect = 5e-12
 Identities = 19/235 (8%), Positives = 54/235 (22%), Gaps = 8/235 (3%)

Query: 108 YFIKIINYLGKEGWTETCPDLVFRLFKNRSQYRFRGAIHEQIADVILEKNKQATYRIAED 167
                              +++F +               +    +       T  +A  
Sbjct: 300 ALGWSKYINQALHRFGRQAEVMFAVHNWPRWGNAEIVEVLEKQRDLYGYLHDQTLHLANQ 359

Query: 168 IIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVL 227
            + I   +   ++     +          +  N    L +Y    +   A     + E  
Sbjct: 360 GVTIGQVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATLDPLSPEDS 419

Query: 228 IQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLL 287
                          + L     A ++ G+    ++V+ + +   P+          +L 
Sbjct: 420 AGRYVEYMG----GAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALE 475

Query: 288 QLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALR 342
           QL +  +        ++   +        G     +         +  +Y     
Sbjct: 476 QLGYQAENAGWRNSYLSAAYELRHGVPRDG----SADALAAMDTGLLFDYLGVRL 526



 Score = 56.8 bits (135), Expect = 2e-10
 Identities = 15/188 (7%), Positives = 38/188 (20%), Gaps = 15/188 (7%)

Query: 195 KEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHS 254
              + N G  + + H  + L  +            + ++   + +             + 
Sbjct: 353 TLHLANQGVTIGQVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNR----YLGYYDGNP 408

Query: 255 GGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYAS 314
                 + +        +   A+       +      Y   VE+  + V      P    
Sbjct: 409 ATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAE---PDNR- 464

Query: 315 FAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYT 374
                   +     +  E      E   +    L      +  + R              
Sbjct: 465 -------AARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDGSADALAAMDTGL 517

Query: 375 RECLEKVL 382
                 V 
Sbjct: 518 LFDYLGVR 525



 Score = 52.2 bits (123), Expect = 4e-09
 Identities = 13/131 (9%), Positives = 20/131 (15%), Gaps = 4/131 (3%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
                  +        VE  G            Y    Y    EV+ +            
Sbjct: 408 PATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPD----N 463

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
                    A    G  A+        L             G +          +  +L 
Sbjct: 464 RAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDGSADALAAMDTGLLFDYLG 523

Query: 302 AVALPEQPPQY 312
                      
Sbjct: 524 VRLDAGAAEGK 534



 Score = 52.2 bits (123), Expect = 4e-09
 Identities = 12/71 (16%), Positives = 19/71 (26%), Gaps = 1/71 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
             +  G Y   VE++   + A   N  A  L A+   +LG   E        +       
Sbjct: 439 ASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELR 498

Query: 617 RYYISQSKLYE 627
                      
Sbjct: 499 HGVPRDGSADA 509



 Score = 46.0 bits (107), Expect = 3e-07
 Identities = 8/69 (11%), Positives = 15/69 (21%)

Query: 559 YHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRY 618
                      +    Y+E     E     A      G++          +  +P     
Sbjct: 407 NPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAA 466

Query: 619 YISQSKLYE 627
              Q+   E
Sbjct: 467 RELQADALE 475



 Score = 45.3 bits (105), Expect = 5e-07
 Identities = 5/64 (7%), Positives = 10/64 (15%), Gaps = 1/64 (1%)

Query: 557 RLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQ 615
               + GY  +       Y+ A  +                        Y        + 
Sbjct: 472 DALEQLGYQAENAGWRNSYLSAAYELRHGVPRDGSADALAAMDTGLLFDYLGVRLDAGAA 531

Query: 616 PRYY 619
               
Sbjct: 532 EGKA 535



 Score = 37.2 bits (84), Expect = 1e-04
 Identities = 15/171 (8%), Positives = 29/171 (16%), Gaps = 7/171 (4%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPA 259
            P N   +      L +     E A       +            +     A        
Sbjct: 460 EPDNRAARELQADALEQLGYQAENAGWRNSYLSAAYE----LRHGVPRDGSADALAAMDT 515

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVR 319
             L                     L L  +   +                   +  AG  
Sbjct: 516 GLLFDYLGVRLDAGAAEGKALSINLRLPDIGENYLLELKNSHL---NNLRGVQSEDAGQT 572

Query: 320 GFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPREN 370
                  L  +    ++    +         NP     L  ++       +
Sbjct: 573 VSIDRADLNRLLLKEVSAVRLVFEGKLKSSGNPLLLGQLFGMLGDFDFWFD 623


>3cv0A [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
          Length = 300

 Score = 61.6 bits (148), Expect = 6e-12
 Identities = 24/297 (8%), Positives = 63/297 (21%), Gaps = 13/297 (4%)

Query: 336 NYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFS--SPQATLIL 393
           +  +    Y     +   +          +    N        E V   +    +A   L
Sbjct: 2   HMLQNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSL 61

Query: 394 SNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYI 453
                +     L +  L     +      +    +     E     AL  L  +      
Sbjct: 62  GLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQ 121

Query: 454 YPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHR-IFL 512
           Y    F      + + +     +L       +       +  L          + R + L
Sbjct: 122 YEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVEL 181

Query: 513 GKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKC---------LGDRMLDIIRLYHEHG 563
             D   L   +   L   +      + ++R              +     ++ +      
Sbjct: 182 RPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAK 241

Query: 564 YYEKTVELLQEYIEANQN-GEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
              + + +      + +               +      +  Y   +E    +    
Sbjct: 242 QLVRAIYMQVGGTTSREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQ 298



 Score = 51.5 bits (122), Expect = 7e-09
 Identities = 34/277 (12%), Positives = 70/277 (25%), Gaps = 37/277 (13%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAA---EVLIQAANNTDSSTIYFPKLLRYIVLAYHSGG 256
               +      G+ + +     EAA   E + QAA           +  R + L      
Sbjct: 17  PYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPE-------REEAWRSLGLTQAENE 69

Query: 257 QPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAV-ELFLQAVALPEQPPQYASF 315
           +   A+  +     L P    +H    +S     + + A+  L    ++ P+    +   
Sbjct: 70  KDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLFFFA 129

Query: 316 AGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTR 375
           A          L    E+  N  +           +  +  A   + + ++ R +     
Sbjct: 130 APNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLW 189

Query: 376 ECLEKVL-------------------DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRM 416
             L   L                   +    +    ++  +     Y L  + L R I M
Sbjct: 190 NKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYM 249

Query: 417 GNSSAE-------ILFRKSFCLIQERRFLEALRILNE 446
                        +       L    R         +
Sbjct: 250 QVGGTTSREATRSMWDFFRMLLNVMNRPDLVELTYAQ 286



 Score = 48.9 bits (115), Expect = 4e-08
 Identities = 25/215 (11%), Positives = 48/215 (22%), Gaps = 14/215 (6%)

Query: 256 GQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASF 315
           G   +              Y +     GLS+L+L +  +A   F    A+ +  P+    
Sbjct: 1   GHMLQNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAF---EAVCQAAPERE-- 55

Query: 316 AGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTR 375
                  +   LG           A+     +   +P        +        N     
Sbjct: 56  ------EAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHN---AN 106

Query: 376 ECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQER 435
             L  +  +   Q        F     Y+     L   + M  + A++            
Sbjct: 107 AALASLRAWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSN 166

Query: 436 RFLEALRILNEYTADSYIYPLAKFNQILCFWVQGK 470
            +  A   L                         +
Sbjct: 167 NYDSAAANLRRAVELRPDDAQLWNKLGATLANGNR 201



 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 20/145 (13%), Positives = 45/145 (31%), Gaps = 7/145 (4%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
           +     LY      ++A   ++ A           +L   +     +G +P +ALD   +
Sbjct: 155 HASLGVLYNLSNNYDSAAANLRRAVELRP---DDAQLWNKLGATLANGNRPQEALDAYNR 211

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHL 327
            L + P Y  + Y   +S   +  Y  A +  ++A+ +                      
Sbjct: 212 ALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTSREATR----SMWDFF 267

Query: 328 GEIAEVFLNYEEALRYYLESLRDNP 352
             +  V    +     Y +++    
Sbjct: 268 RMLLNVMNRPDLVELTYAQNVEPFA 292



 Score = 39.6 bits (91), Expect = 3e-05
 Identities = 11/50 (22%), Positives = 17/50 (34%)

Query: 578 ANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYE 627
           A +  EA   L  T  E      A     +A  LDP     + + +  + 
Sbjct: 51  APEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHT 100



 Score = 37.3 bits (85), Expect = 1e-04
 Identities = 17/111 (15%), Positives = 38/111 (34%), Gaps = 3/111 (2%)

Query: 172 HYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQA- 230
            +  L + +   ++    L    + +  NPG   + Y+  V      +Y  AA+ L++A 
Sbjct: 188 LWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAI 247

Query: 231 --ANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLH 279
                  +S      +  +  +  +   +P        Q ++ F     L 
Sbjct: 248 YMQVGGTTSREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQ 298


>3ck7D [x.x.x] SUSD
          Length = 498

 Score = 61.5 bits (147), Expect = 7e-12
 Identities = 17/322 (5%), Positives = 49/322 (15%), Gaps = 42/322 (13%)

Query: 214 LYRAERYGEAAEVLIQAAN-NTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLF 272
             +   + +   +L       +      F      +                    +   
Sbjct: 3   FDQQGVFVKGYAMLGVTDEGESGFYRTTF--NCNELPTDECLWAWQKNQDIPQLTSISWS 60

Query: 273 PNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAE 332
           P+     +        +  Y+  ++             +             +       
Sbjct: 61  PSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRA---------EIRFLRALHYW 111

Query: 333 VFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLI 392
            FL+      +      D P  +   E    I       E       +     + +A   
Sbjct: 112 YFLDLFGKAPFKEHFSNDLPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKAANW 171

Query: 393 L------------------------------SNIFFQQGAYKLTLEFLERLIRMGNSSAE 422
           L                              S         +L +   +           
Sbjct: 172 LLRARLYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEIIL 231

Query: 423 ILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIR 482
            + +              +                         +  K       V  + 
Sbjct: 232 PIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLP 291

Query: 483 TLEPAEDTESILRLLLRSQEKR 504
                          + + +  
Sbjct: 292 ADVEIPTKGLDTDEQIDAFDAE 313



 Score = 52.6 bits (124), Expect = 3e-09
 Identities = 23/340 (6%), Positives = 57/340 (16%), Gaps = 45/340 (13%)

Query: 285 SLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYY 344
           S  Q   + K   +            +                          +      
Sbjct: 2   SFDQQGVFVKGYAMLGVTDEGESGFYRTTFNCNELPT-DECLWA-------WQKNQDIPQ 53

Query: 345 LESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYK 404
           L S+  +P                                SS +   +   + +    Y 
Sbjct: 54  LTSISWSP--------------------------------SSQRTEWVYVRLGYDITQYN 81

Query: 405 LTLEFLERL--IRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQI 462
             L+  E +         AEI F ++                  ++ D  +         
Sbjct: 82  FFLDQTEGMTDAETLRQRAEIRFLRALHYWYFLDLFGKAPFKEHFSNDLPVEKKGTELYT 141

Query: 463 LCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLD 522
                  +        ++       +    +LR  L            +   +     + 
Sbjct: 142 YIQNELNEIEADMYEPRQAPFGRADKAANWLLRARLYLNAGVYTGQTDYAKAEEYASKVI 201

Query: 523 IVGRLLYLSELTRVEELFSRV--DPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEAN- 579
                L  +                + +   +         +G     V   +       
Sbjct: 202 GSAYKLCTNYSELFMADNDENENAMQEIILPIRQDGVKTRNYGGSTYLVCGTRVAGMPRM 261

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
                   +      +  F                  +  
Sbjct: 262 GTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVEIPTKGL 301



 Score = 38.4 bits (87), Expect = 6e-05
 Identities = 11/73 (15%), Positives = 18/73 (24%), Gaps = 4/73 (5%)

Query: 559 YHEHGYYEKTVELLQEYIEAN----QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPS 614
           + + G + K   +L    E      +       L             D     +I   PS
Sbjct: 3   FDQQGVFVKGYAMLGVTDEGESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPS 62

Query: 615 QPRYYISQSKLYE 627
             R      +L  
Sbjct: 63  SQRTEWVYVRLGY 75


>3bcvA [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN
          Length = 192

 Score = 61.1 bits (147), Expect = 9e-12
 Identities = 32/177 (18%), Positives = 65/177 (36%), Gaps = 7/177 (3%)

Query: 1   MGNRISLCMIVKNEEGNIRRCLASV---TGVVNEIIVVDTGSTDNTCKIAREMGA---RI 54
           +  ++S+ + + N E  + +C+ ++   T    EII++D  S DN  KI  +  A    I
Sbjct: 1   LIPKVSVIVPIYNVEKYLDQCVQALLAQTLSDIEIILIDDESPDNCPKICDDYAAQYPNI 60

Query: 55  YSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIIN 114
                 N    A N  L  ATG+++ F D+D+ +  +    + +    + V  + +    
Sbjct: 61  KVIHKKNAGLGACNSGLDVATGEYVAFCDSDDYVDSDYTYNVAQKYTCDAVFTFKLYKNK 120

Query: 115 YLGKEGWTETCP-DLVFRLFKNRSQYRFRGAIHEQIADVILEKNKQATYRIAEDIII 170
                   +    D   R  +              + +    +        +ED+I 
Sbjct: 121 NEIHTLLKDLIASDPYAREERAIQVSAKVVLYRRNLIEKKHLRFVSERILPSEDLIF 177


>2d0jA [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
          Length = 242

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 10/127 (7%), Positives = 24/127 (18%), Gaps = 20/127 (15%)

Query: 4   RISLCMIVKNEEGNIRRCLASVTGVVN----EIIVVDTGSTDNTCKIAREMGA------- 52
            I       +                       I+V+  +  +         A       
Sbjct: 4   TIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAAARSELVSRFLARAGLPSTHL 63

Query: 53  ---------RIYSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADE 103
                       + + N   +  R     +     +LF   D+          ++     
Sbjct: 64  HVPTPRRGLPRATEQRNAGLAWLRQRHQHQRAQPGVLFFADDDNTYSLELFQEMRTTRKV 123

Query: 104 QVEGYFI 110
            V    +
Sbjct: 124 SVWPVGL 130


>2c0mA [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
          Length = 297

 Score = 59.5 bits (143), Expect = 3e-11
 Identities = 30/257 (11%), Positives = 65/257 (25%), Gaps = 6/257 (2%)

Query: 382 LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
                            Q+G     +   E  ++      E          +  + L A+
Sbjct: 10  NPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAI 69

Query: 442 RILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQ 501
             L            A     + F  +  +R+   ++++     PA         L    
Sbjct: 70  SALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEV 129

Query: 502 EKRKYVHRIFLGKDAVTLLLDIVGRLLYLSE-LTRVEELFSRV---DPKCLGDRMLDIIR 557
           ++                +   +G L  LS    +  + F+      P         +  
Sbjct: 130 KELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDY-LLWNKLGA 188

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
                   E+ V   +  +E       + + L  +   LG   EA  H+  A+ +     
Sbjct: 189 TLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR 248

Query: 617 RYYISQSKLYEDRSEKI 633
                   + E+    +
Sbjct: 249 GPRGEGGAMSENIWSTL 265



 Score = 57.6 bits (138), Expect = 1e-10
 Identities = 21/251 (8%), Positives = 46/251 (18%), Gaps = 20/251 (7%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL 300
                    L     G    A+ +    +Q  P + +   Y G +  + +    A+    
Sbjct: 14  DHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALR 73

Query: 301 QAVALPEQPPQYASFAGVRGF------------------RSLYHLGEIAEVFLNYEEALR 342
           + + L            V                        Y      +      + L 
Sbjct: 74  RCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELF 133

Query: 343 YYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL--DFSSPQATLILSNIFFQQ 400
                L            +  +       +   +C    L    +       L       
Sbjct: 134 LAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANG 193

Query: 401 GAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFN 460
              +  +    R + +        +      I      EA+    E           +  
Sbjct: 194 NQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGE 253

Query: 461 QILCFWVQGKK 471
                      
Sbjct: 254 GGAMSENIWST 264



 Score = 52.6 bits (125), Expect = 3e-09
 Identities = 32/213 (15%), Positives = 68/213 (31%), Gaps = 16/213 (7%)

Query: 154 LEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVE 213
               +QA   + + +            D    + + L +    +     +  ++   GV 
Sbjct: 96  ESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVL 155

Query: 214 LYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFP 273
              +  Y +A +    A +   +       L   +     +G Q  +A+   R+ L+L P
Sbjct: 156 FNLSGEYDKAVDCFTAALSVRPN----DYLLWNKLGATLANGNQSEEAVAAYRRALELQP 211

Query: 274 NYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQYASFAGVRGFRSLYHLGEIAE 332
            Y    Y  G+S + L  + +AVE FL+A+ +  +                  ++     
Sbjct: 212 GYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGG-----AMSENIWS--- 263

Query: 333 VFLNYEEALRYYLESLRDNPGFQPALERIIKIL 365
                  AL    +S          L  ++ + 
Sbjct: 264 ---TLRLALSMLGQSDAYGAADARDLSTLLTMF 293



 Score = 52.2 bits (124), Expect = 4e-09
 Identities = 29/293 (9%), Positives = 69/293 (23%), Gaps = 9/293 (3%)

Query: 342 RYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL--DFSSPQATLILSNIFFQ 399
           + Y     +     P             +        E  +  D    +A   L     +
Sbjct: 2   KGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAE 61

Query: 400 QGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKF 459
                L +  L R + +   +   L   +     E    +A  IL ++   +  Y     
Sbjct: 62  NEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVT 121

Query: 460 NQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIF-LGKDAVT 518
              L   V+        L       +       +  L     +          +  +   
Sbjct: 122 PDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYL 181

Query: 519 LLLDIVGRLLYLSELTRVEELFSRV---DPKCLGDRMLDIIRLYHEHGYYEKTVELLQEY 575
           L   +   L   ++       + R     P  +     ++       G + + VE   E 
Sbjct: 182 LWNKLGATLANGNQSEEAVAAYRRALELQPGYI-RSRYNLGISCINLGAHREAVEHFLEA 240

Query: 576 IEAN-QNGEAHFLLAETHRELGDFIE-ADHHYRYAIELDPSQPRYYISQSKLY 626
           +    ++             +   +  A      +     +  R   +   ++
Sbjct: 241 LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMF 293



 Score = 50.7 bits (120), Expect = 1e-08
 Identities = 26/222 (11%), Positives = 48/222 (21%), Gaps = 14/222 (6%)

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSL 324
            +   +         +  GL  LQ      AV LF  AV    +  +             
Sbjct: 4   YQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEA-----------W 52

Query: 325 YHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDF 384
            +LG           A+      L   P  Q AL  +              E L    D+
Sbjct: 53  QYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILR---DW 109

Query: 385 SSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRIL 444
                                 L      +   +   ++             + +A+   
Sbjct: 110 LRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCF 169

Query: 445 NEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP 486
               +      L             +  +  +  +    L+P
Sbjct: 170 TAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQP 211


>2ae7A [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
          Length = 272

 Score = 57.9 bits (138), Expect = 8e-11
 Identities = 21/226 (9%), Positives = 63/226 (27%), Gaps = 24/226 (10%)

Query: 4   RISLCMIVKNEEGNIRRCLASV------TGVVNEIIVVDTGSTDNTCKIAREMGARIYSF 57
           ++++ +  +N + +++  L  +        +   I V++                     
Sbjct: 51  KVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFN------------- 97

Query: 58  EWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADE---QVEGYFIKIIN 114
                 +     +L        +F D D     +                ++ +   +  
Sbjct: 98  -RAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPY 156

Query: 115 YLGKEGWTETCPDLVFRLFKNRSQYRFRGAIHEQIADVILEKNKQATYRIAEDIIIIHYG 174
                G +         +    + Y   G   + I + ++ +    +   A      H  
Sbjct: 157 VQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIR 216

Query: 175 YLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERY 220
           +   + ++ + +  +     KE + + G   L Y    ++ R   Y
Sbjct: 217 HSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVL-DVQRYPLY 261


>2bo7A [x.x.x] MANNOSYLGLYCERATE SYNTHASE
          Length = 375

 Score = 57.5 bits (137), Expect = 1e-10
 Identities = 21/195 (10%), Positives = 40/195 (20%), Gaps = 28/195 (14%)

Query: 6   SLCMIVKNEEGNIRRCLASV--TGVVNEIIVVDTGSTDNTCKIAREMGA----------- 52
            +    K+E   +      V         ++      D T +                  
Sbjct: 2   LVVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTPVS 61

Query: 53  -------RIYSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQV 105
                          +  + A  + L +   + I F DAD    G       +  AD   
Sbjct: 62  VRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADFGY 121

Query: 106 EGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR--------FRGAIHEQIADVILEKN 157
                           T       F L    ++                E  A +  ++ 
Sbjct: 122 GLVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQPLGGELLMRREVAAMLYEDER 181

Query: 158 KQATYRIAEDIIIIH 172
            +       D +   
Sbjct: 182 VRRRSDWGIDTLYTF 196


>3e26A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 274

 Score = 56.9 bits (136), Expect = 2e-10
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 12/118 (10%)

Query: 4   RISLCMIVKNEEGNIRRCLASVTGVVN----EIIVVDTGSTDNTCKIAREMGAR------ 53
            IS+ +   NEE  I   + S++ +V+    E+IV+D+GSTD+T   A   GAR      
Sbjct: 22  TISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQ 81

Query: 54  -IYSFEWNNNFSDARNFSLAKATGDWILFLDADEE-LAGESREVLVKYVADEQVEGYF 109
            +          +A   SLA  +GD ++F+D+D           LV  +   +     
Sbjct: 82  ALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLV 139


>2d7iA [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10
          Length = 536

 Score = 56.6 bits (134), Expect = 2e-10
 Identities = 25/130 (19%), Positives = 38/130 (29%), Gaps = 12/130 (9%)

Query: 4   RISLCMIVKNEEGNIRRCLASV------TGVVNEIIVVDTGSTDNTCKIAREMGAR---- 53
             S+ +   NE  +                +V EI++VD  S     K   E        
Sbjct: 79  NTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPS 138

Query: 54  --IYSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIK 111
             I   +        R    + ATGD I FLD+  E        L+  +A  +       
Sbjct: 139 VRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPM 198

Query: 112 IINYLGKEGW 121
           I      +  
Sbjct: 199 IDVIDHDDFR 208


>3draA [x.x.x] PROTEIN
          Length = 302

 Score = 56.3 bits (134), Expect = 2e-10
 Identities = 24/305 (7%), Positives = 77/305 (25%), Gaps = 13/305 (4%)

Query: 328 GEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSP 387
            + +++           +  +  +  ++  +  ++ ++K  E  E      E  ++  + 
Sbjct: 4   YDYSDITPVDINTEEPQICQILYDEDYKQIMGLLLALMKAEEYSERALHITELGINELAS 63

Query: 388 QATLI----LSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRI 443
             T+                   L++ E +      + +I   +   + Q          
Sbjct: 64  HYTIWIYRFNILKNLPNRNLYDELDWCEEIALDNEKNYQIWNYRQLIIGQIMELNNNDFD 123

Query: 444 LNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEK 503
                        +       +  +        L  + + L   +           +   
Sbjct: 124 PYREFDILEAMLSSDPKNHHVWSYRKWLVDTFDLHNDAKELSFVDKVIDTDL--KNNSAW 181

Query: 504 RKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEHG 563
                 +F  K      L     +       + + +    +P      +    R      
Sbjct: 182 SHRFFLLFSKK-----HLATDNTIDEELNYVKDKIVKCPQNPSTWNYLLGIHERFDRSIT 236

Query: 564 YYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHY-RYAIELDPSQPRYYIS 621
             E+      +  +    +  A   LA+ + +   + E+   Y     + +P +  ++  
Sbjct: 237 QLEEFSLQFVDLEKDQVTSSFALETLAKIYTQQKKYNESRTVYDLLKSKYNPIRSNFWDY 296

Query: 622 QSKLY 626
           Q    
Sbjct: 297 QISKL 301



 Score = 46.7 bits (109), Expect = 2e-07
 Identities = 9/127 (7%), Positives = 24/127 (18%), Gaps = 9/127 (7%)

Query: 258 PAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAG 317
                +     +    +Y  +       +   ++  +A+ +    +              
Sbjct: 13  DINTEEPQICQILYDEDYKQIMGLLLALMKAEEYSERALHITELGINELASHYT------ 66

Query: 318 VRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTREC 377
                             N  + L +  E   DN            I+            
Sbjct: 67  ---IWIYRFNILKNLPNRNLYDELDWCEEIALDNEKNYQIWNYRQLIIGQIMELNNNDFD 123

Query: 378 LEKVLDF 384
             +  D 
Sbjct: 124 PYREFDI 130



 Score = 42.5 bits (98), Expect = 4e-06
 Identities = 12/162 (7%), Positives = 40/162 (24%), Gaps = 17/162 (10%)

Query: 218 ERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYAD 277
                  E  I      +     + +++  ++    +     +AL +   G+    ++  
Sbjct: 11  PVDINTEEPQICQILYDED----YKQIMGLLLALMKAEEYSERALHITELGINELASHYT 66

Query: 278 LHYYGGLSLLQ--LKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFL 335
           +  Y    L     ++ +  ++   +     E+  Q              +   I    +
Sbjct: 67  IWIYRFNILKNLPNRNLYDELDWCEEIALDNEKNYQI-----------WNYRQLIIGQIM 115

Query: 336 NYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTREC 377
                                +  +   +   R+    T + 
Sbjct: 116 ELNNNDFDPYREFDILEAMLSSDPKNHHVWSYRKWLVDTFDL 157


>2c0nA [x.x.x] A197
          Length = 187

 Score = 55.9 bits (133), Expect = 3e-10
 Identities = 9/82 (10%), Positives = 18/82 (21%), Gaps = 3/82 (3%)

Query: 31  EIIVVDTGSTDNTCKIAREMGA---RIYSFEWNNNFSDARNFSLAKATGDWILFLDADEE 87
            +  + +GS                 I S   +            +   D + FLD D  
Sbjct: 2   TLFFIPSGSVRLPLIDFLVKNDIEYVILSRRNHVAVQREIALDFLEKDYDTLAFLDEDVV 61

Query: 88  LAGESREVLVKYVADEQVEGYF 109
                 + +     +       
Sbjct: 62  PIEIDFQKVEAKFNEGYDVVCG 83


>2dm9A [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E
          Length = 118

 Score = 55.6 bits (133), Expect = 4e-10
 Identities = 12/107 (11%), Positives = 26/107 (24%), Gaps = 11/107 (10%)

Query: 21  CLASV---TGVVNEIIVVDTGSTDNTCKIAREMGAR------IYSFEWNNNFSDARNFSL 71
            ++SV        E +  D         +   +         + S E       +R   +
Sbjct: 2   IISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEI 61

Query: 72  AKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGK 118
               GD  + L    +  G             +++  F   +     
Sbjct: 62  KSELGDVSIELGETVDTMGGVIVETEDGR--IRIDNTFEARMERFEG 106


>3c3oA [x.x.x] PROGRAMMED CELL DEATH 6-INTERACTING PROTEIN
          Length = 357

 Score = 55.4 bits (132), Expect = 4e-10
 Identities = 21/235 (8%), Positives = 52/235 (22%), Gaps = 14/235 (5%)

Query: 191 HIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVL 250
                                      +    +A       + +  +       L  I+L
Sbjct: 136 EQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDT----VGTLSLIML 191

Query: 251 AYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPP 310
           A        KA     +   +         Y G +  Q ++     +     +A      
Sbjct: 192 AQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIM 251

Query: 311 QYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPREN 370
           Q           + YH   +A+    + E +     +           +  + +    + 
Sbjct: 252 QA---------NAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDK 302

Query: 371 PEYTRECLEKVLDFSSPQATLILSNI-FFQQGAYKLTLEFLERLIRMGNSSAEIL 424
                   +K  DF        L ++    +     +      + +      E +
Sbjct: 303 INRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM 357



 Score = 48.5 bits (114), Expect = 5e-08
 Identities = 34/307 (11%), Positives = 75/307 (24%), Gaps = 26/307 (8%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPA 259
            P    ++  Y        +Y  AAE L +             + L     A  +  +  
Sbjct: 18  KPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRR------AAVGRPLDKHEGALETLLRYY 71

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVE-------------LFLQAVALP 306
             +  I        N   L +    +  +   +  +V+             LF  A    
Sbjct: 72  DQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALAS 131

Query: 307 EQPPQYASFAGVRGFRSLYHLGEIAEVFL---NYEEALRYYLESLRDNPGFQPALERIIK 363
           +   +           +  H    +  FL       +      ++  +P     L  I+ 
Sbjct: 132 QIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIML 191

Query: 364 ILKPRENPEYTRECLEKVL--DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGN--S 419
                           K       + QA     + F Q        + +  ++   +   
Sbjct: 192 AQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIM 251

Query: 420 SAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQ 479
            A   + +S    Q+++F E +  L                 +       K  +  +  +
Sbjct: 252 QANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAK 311

Query: 480 EIRTLEP 486
           +      
Sbjct: 312 KDNDFIY 318



 Score = 47.3 bits (111), Expect = 1e-07
 Identities = 32/376 (8%), Positives = 85/376 (22%), Gaps = 54/376 (14%)

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLS-----LLQLKHYHKAVELFLQAVA 304
               +     +      +  +             L      L  L  Y+  +        
Sbjct: 23  FIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFP 82

Query: 305 LPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKI 364
             E                 +   +  +    +  +++  L SL             +  
Sbjct: 83  FSENQICL-----------TFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALAS 131

Query: 365 LKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEIL 424
               E      E L+         +       F       L+    E  + +   +   L
Sbjct: 132 QIAAEQNLDNDEGLKIAAKHYQFAS-----GAFLHIKETVLSALSREPTVDISPDTVGTL 186

Query: 425 FRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTL 484
                   QE  FL+A R   +    + +   A       F     K  +   V  +   
Sbjct: 187 SLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAA 246

Query: 485 EPAEDT-ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRV 543
           +       +     + +++++K+   I   + A  L                        
Sbjct: 247 KHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAEL------------------------ 282

Query: 544 DPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADH 603
                  R  + + +        + +   ++  +       +       ++L    +A  
Sbjct: 283 IKTVA-SRYDEYVNVKDFSDKINRALAAAKKDNDFI-----YHDRVPDLKDLDPIGKAT- 335

Query: 604 HYRYAIELDPSQPRYY 619
               +  ++    + +
Sbjct: 336 -LVKSTPVNVPISQKF 350



 Score = 46.9 bits (110), Expect = 2e-07
 Identities = 9/184 (4%), Positives = 40/184 (21%), Gaps = 21/184 (11%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
           Q+    +      K+ +          ++G    + +      + +              
Sbjct: 195 QEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIM--Q 252

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
                +  +      +  + +  ++   +L    A  +             ++A+    +
Sbjct: 253 ANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKK 312

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
                                  +      +      +A    ++S   N         +
Sbjct: 313 DNDF-----------------IYHDRVPDLKDLDPIGKAT--LVKSTPVNVPISQKFTDL 353

Query: 362 IKIL 365
            + +
Sbjct: 354 FEKM 357



 Score = 43.9 bits (102), Expect = 1e-06
 Identities = 27/323 (8%), Positives = 61/323 (18%), Gaps = 34/323 (10%)

Query: 324 LYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLD 383
                   E    Y  A     +  R                      +     LE +L 
Sbjct: 25  QQTYPSGGEEQAQYCRAAEELSKLRRAAV---------------GRPLDKHEGALETLLR 69

Query: 384 FSS--PQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
           +                Q        +  ++    G S    L    +          AL
Sbjct: 70  YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAAL 129

Query: 442 RILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPA-----EDTESILRL 496
                   +       K       +  G    ++  V    + EP      +   ++  +
Sbjct: 130 ASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLI 189

Query: 497 LLRSQEKRKYV-------HRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRV----DP 545
           +L   ++  ++           + K A                   + +    V      
Sbjct: 190 MLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHC 249

Query: 546 KCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHH 604
               +       L  +   + + +  LQ   E        +               A   
Sbjct: 250 IMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAA 309

Query: 605 YRYAIELDPSQPRYYISQSKLYE 627
            +   +         +       
Sbjct: 310 AKKDNDFIYHDRVPDLKDLDPIG 332


>3ckjA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 300

 Score = 54.6 bits (130), Expect = 8e-10
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 11/96 (11%)

Query: 4   RISLCMIVKNEEGNIRRCLASVT----GVVNEIIVVDTGSTDNTCKIAREMGARIYS--- 56
            IS+ +   +EE  I   + S++    G+V+E+IV+D+GSTD+T   A   GAR+ S   
Sbjct: 35  TISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSREQ 94

Query: 57  ----FEWNNNFSDARNFSLAKATGDWILFLDADEEL 88
                       +A   SLA + GD ++F+D+D   
Sbjct: 95  ALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLIN 130


>3e25A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 270

 Score = 54.6 bits (130), Expect = 8e-10
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 11/96 (11%)

Query: 4   RISLCMIVKNEEGNIRRCLASVTGV----VNEIIVVDTGSTDNTCKIAREMGAR------ 53
            IS+ +   NEE  I   + S++ +    V+E+IV+D+GSTD+T   A   GAR      
Sbjct: 21  TISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQ 80

Query: 54  -IYSFEWNNNFSDARNFSLAKATGDWILFLDADEEL 88
            +          +A   SLA  +GD ++F+D+D   
Sbjct: 81  ALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLIN 116


>3cvlA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
          Length = 294

 Score = 53.0 bits (126), Expect = 2e-09
 Identities = 31/293 (10%), Positives = 70/293 (23%), Gaps = 42/293 (14%)

Query: 217 AERYGEAAEVLIQAANNTDSSTIY---------FPKLLRYIVLAYHSGGQPAKALDVIRQ 267
            E   E    +++ AN  +++  +           +  R + L      +   A+  +  
Sbjct: 14  HENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNH 73

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGF---RSL 324
              L P    +H    +S     + +                   A+ A +R +   +  
Sbjct: 74  ARMLDPKDIAVHAALAVSHTNEHNAN-------------------AALASLRAWLLSQPQ 114

Query: 325 YHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV--L 382
           Y           Y E       +L  NP        +  +     N +     L +   L
Sbjct: 115 YEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVEL 174

Query: 383 DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALR 442
                Q    L          +  L+   R + +      +++  +       ++  A +
Sbjct: 175 RPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAK 234

Query: 443 ILNEYTADSYIYPLAKF---------NQILCFWVQGKKRKVRSLVQEIRTLEP 486
            L                           +   V  +   V     +      
Sbjct: 235 QLVRAIYMQVGGTTPASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFA 287



 Score = 53.0 bits (126), Expect = 2e-09
 Identities = 19/117 (16%), Positives = 39/117 (33%), Gaps = 2/117 (1%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL 300
             +L   +     +G +P +ALD   + L + P Y  + Y   +S   +  Y  A +  +
Sbjct: 178 DAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLV 237

Query: 301 QAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPA 357
           +A+ +       AS    R          +  V    +     Y +++         
Sbjct: 238 RAIYMQVGGTTPASREATRSM--WDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGL 292



 Score = 38.0 bits (87), Expect = 8e-05
 Identities = 23/247 (9%), Positives = 49/247 (19%), Gaps = 13/247 (5%)

Query: 386 SPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILN 445
             +A   L     +     L +  L     +      +    +     E     AL  L 
Sbjct: 47  REEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLR 106

Query: 446 EYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRK 505
            +      Y    F      + + +     +L       +       +  L         
Sbjct: 107 AWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAA 166

Query: 506 YVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDR---MLDIIRLYHEH 562
            + R    +     L + +G  L      +                   M ++   Y   
Sbjct: 167 NLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNM 226

Query: 563 GYYEKTVELLQEYIEAN-QNGEAHFL---------LAETHRELGDFIEADHHYRYAIELD 612
             Y+   + L   I                            +      +  Y   +E  
Sbjct: 227 SQYDLAAKQLVRAIYMQVGGTTPASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPF 286

Query: 613 PSQPRYY 619
             +    
Sbjct: 287 AKEFGLQ 293



 Score = 36.5 bits (83), Expect = 2e-04
 Identities = 10/47 (21%), Positives = 16/47 (34%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
           +  EA   L  T  E      A     +A  LDP     + + +  +
Sbjct: 46  EREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSH 92



 Score = 36.5 bits (83), Expect = 2e-04
 Identities = 16/95 (16%), Positives = 30/95 (31%), Gaps = 5/95 (5%)

Query: 190 LHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIV 249
           L    + +  NPG   + Y+  V      +Y  AA+ L++A       T    +     +
Sbjct: 199 LDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPASREATRSM 258

Query: 250 L-----AYHSGGQPAKALDVIRQGLQLFPNYADLH 279
                   +   +P        Q ++ F     L 
Sbjct: 259 WDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQ 293


>3ckbB [x.x.x] SUSD
          Length = 501

 Score = 52.2 bits (123), Expect = 4e-09
 Identities = 19/381 (4%), Positives = 61/381 (16%), Gaps = 44/381 (11%)

Query: 252 YHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQ 311
                      D   +G   F                           L +++      +
Sbjct: 9   VKGYAMLGVTGDGQDEGESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPSSQR 68

Query: 312 YASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD--NPGFQPALERIIKILKPRE 369
                        +    +      Y   L                              
Sbjct: 69  T-----------EWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRALHYWYFL 117

Query: 370 NPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSF 429
           +        E   +    +               +  L  +E  +     +      K+ 
Sbjct: 118 DLFGKAPFKEHFSNDLPVEKK-----GTELYTYIQNELNEIEADMYEPRQAPFGRADKAA 172

Query: 430 CLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAED 489
             +   R      +    T  +     A       + +     ++     +       E 
Sbjct: 173 NWLLRARLYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEI 232

Query: 490 TESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLG 549
              I +  ++++      + +   + A    +        +                   
Sbjct: 233 ILPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFAR---------------- 276

Query: 550 DRMLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYA 608
                          +   +E +           +      +      +          A
Sbjct: 277 ---------AAMVQKFFSNLEDVPMLPADVEIPTKGLDTDEQIDAFDAEHGIRTEDMIKA 327

Query: 609 IELDPSQPRYYISQSKLYEDR 629
              D +     +   +     
Sbjct: 328 AGDDRALLYSGVGGGRRKIQT 348



 Score = 48.7 bits (114), Expect = 5e-08
 Identities = 22/281 (7%), Positives = 56/281 (19%), Gaps = 18/281 (6%)

Query: 102 DEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYRFRGAIHEQIADVILEKNKQAT 161
            ++ E  F++ ++Y          P           + +          ++   +     
Sbjct: 100 RQRAEIRFLRALHYWYFLDLFGKAPFKEHFSNDLPVEKKGTELYTYIQNELNEIEADMYE 159

Query: 162 YRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYG 221
            R A             +            +   +              G        Y 
Sbjct: 160 PRQAPFGRADKAANWLLRARLYLN----AGVYTGQTDYAKAEEYASKVIGSAYKLCTNYS 215

Query: 222 EAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYY 281
           E          N           +R   +   + G     +   R          +    
Sbjct: 216 ELFMADNDENENAMQ---EIILPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSC 272

Query: 282 GGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEAL 341
                  ++ +   +E      A  E P +            L    +I      +    
Sbjct: 273 IFARAAMVQKFFSNLEDVPMLPADVEIPTKG-----------LDTDEQIDAFDAEHGIRT 321

Query: 342 RYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL 382
              +++  D+     +     +     +      + L  V 
Sbjct: 322 EDMIKAAGDDRALLYSGVGGGRRKIQTDAISGFTDGLSIVK 362


>2bo4A [x.x.x] MANNOSYLGLYCERATE SYNTHASE
          Length = 380

 Score = 51.2 bits (121), Expect = 8e-09
 Identities = 19/155 (12%), Positives = 33/155 (21%), Gaps = 20/155 (12%)

Query: 6   SLCMIVKNEEGNIRRCLASV--TGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEW---- 59
            +    K+E   +      V         ++      D T +        I         
Sbjct: 2   LVVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTPVS 61

Query: 60  --------------NNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQV 105
                          +  + A  + L +   + I F DAD    G       +  AD   
Sbjct: 62  VRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADFGY 121

Query: 106 EGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR 140
                           T       F L    ++  
Sbjct: 122 GLVRHYFPRASTDAMITWMITRTGFALLWPHTELS 156


>2dl1A [x.x.x] SPARTIN
          Length = 116

 Score = 51.2 bits (122), Expect = 8e-09
 Identities = 16/117 (13%), Positives = 35/117 (29%), Gaps = 7/117 (5%)

Query: 255 GGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYAS 314
           G   +       + ++     A L    GL+  +L    +A   + Q +    +    +S
Sbjct: 1   GSSGSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISS 60

Query: 315 FAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENP 371
                      H G   E     ++ ++  L+++R                  +E P
Sbjct: 61  KES-------EHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVP 110



 Score = 40.0 bits (93), Expect = 2e-05
 Identities = 10/71 (14%), Positives = 18/71 (25%), Gaps = 1/71 (1%)

Query: 565 YEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQS 623
                    + I    +             ELG   EA ++Y+  I            +S
Sbjct: 4   GSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKES 63

Query: 624 KLYEDRSEKIK 634
           +      E  +
Sbjct: 64  EHTGPGWESAR 74



 Score = 34.6 bits (79), Expect = 8e-04
 Identities = 10/67 (14%), Positives = 19/67 (28%), Gaps = 4/67 (5%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQ----LKHYHKAV 296
              L     L     GQ  +A +  +QG+        +               +   + +
Sbjct: 21  KAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKM 80

Query: 297 ELFLQAV 303
           +  LQ V
Sbjct: 81  KETLQNV 87


>2agdA [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
          Length = 273

 Score = 51.0 bits (120), Expect = 9e-09
 Identities = 15/219 (6%), Positives = 49/219 (22%), Gaps = 20/219 (9%)

Query: 4   RISLCMIVKNEEGNIRRCLASV------TGVVNEIIVVDTGSTDNTCKIAREMGARIYSF 57
           ++++ +  +N + +++  L  +        +   I V++        +            
Sbjct: 52  KVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGF---- 107

Query: 58  EWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLG 117
                       +L        +F D D     +                      +   
Sbjct: 108 ----------QEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPY 157

Query: 118 KEGWTETCPDLVFRLFKNRSQYRFRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLD 177
            + +         +                +  D+      +       + ++    ++ 
Sbjct: 158 VQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIR 217

Query: 178 SQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYR 216
              D+K++ N           E   +  L       L  
Sbjct: 218 HSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDV 256


>2d0jD [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
          Length = 241

 Score = 50.9 bits (120), Expect = 1e-08
 Identities = 10/132 (7%), Positives = 24/132 (18%), Gaps = 20/132 (15%)

Query: 4   RISLCMIVKNEEGNIRRCLASVTGVVN----EIIVVDTGSTDNTCKIAREMGA------- 52
            I       +                       I+V+  +  +         A       
Sbjct: 3   TIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAAARSELVSRFLARAGLPSTHL 62

Query: 53  ---------RIYSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADE 103
                       + + N   +  R     +     +LF   D+          ++     
Sbjct: 63  HVPTPRRGLPRATEQRNAGLAWLRQRHQHQRAQPGVLFFADDDNTYSLELFQEMRTTRKV 122

Query: 104 QVEGYFIKIINY 115
            V    +     
Sbjct: 123 SVWPVGLVGGRR 134


>3dstA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 311

 Score = 50.8 bits (120), Expect = 1e-08
 Identities = 27/214 (12%), Positives = 56/214 (26%), Gaps = 18/214 (8%)

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
               + +     +G      L++  Q L   P++A L       L  L+      E    
Sbjct: 16  QSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAAL 75

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFL--NYEEALRYYLESLRDNPGFQPALE 359
             A              + + + +H   +       N+   L      L  +       +
Sbjct: 76  VKAELGFLES-CLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWD 134

Query: 360 RIIKI-----LKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQ--------QGAYKLT 406
               +     + P E   +T   +    +FS+  +    S +  Q        +      
Sbjct: 135 YRRFVAAQAAVAPAEELAFTDSLIT--RNFSNYSSWHYRSCLLPQLHPQPRLPENVLLKE 192

Query: 407 LEFLERLIRMGNSSAEILFRKSFCLIQERRFLEA 440
           LE ++       +     F   + L       E 
Sbjct: 193 LELVQNAFFTDPNDQSAWFYHRWLLGAGSGRCEL 226



 Score = 48.5 bits (114), Expect = 5e-08
 Identities = 41/318 (12%), Positives = 76/318 (23%), Gaps = 29/318 (9%)

Query: 338 EEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFS--SPQATLILSN 395
           E       + L+       A + + +  +  E  E   E   ++L  +            
Sbjct: 2   EAKRLEREQKLKLYQS---ATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRRE 58

Query: 396 IFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYP 455
           +       K   E    +          L                L  L E      +  
Sbjct: 59  VLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELEL 118

Query: 456 LAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKD 515
            A+F +             R  V     + PAE+    L        +    +  +  + 
Sbjct: 119 CARFLEADERNFHCWDY--RRFVAAQAAVAPAEE----LAFTDSLITRNFSNYSSWHYRS 172

Query: 516 AVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDI----------------IRLY 559
            +   L    RL   + L +  EL          D+                    +   
Sbjct: 173 CLLPQLHPQPRLP-ENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKS 231

Query: 560 HEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRY 618
                  ++ + LQE    N        LL      L    E   ++     +DP +  Y
Sbjct: 232 TVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAY 291

Query: 619 YISQSKLYEDRSEKIKGE 636
                  +   +  +K E
Sbjct: 292 LDDLRSKFLLENSVLKME 309



 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 6/57 (10%), Positives = 11/57 (19%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVE 297
               +  ++ A        + L        + P  A          L      K   
Sbjct: 254 CLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEY 310



 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 32/308 (10%), Positives = 59/308 (19%), Gaps = 60/308 (19%)

Query: 190 LHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYI- 248
           L +  + +  NP    L       L   E      E                    +   
Sbjct: 36  LELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYG 95

Query: 249 -------VLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQ--------LKHYH 293
                  +L+       A+ L++  + L+          Y      Q        L    
Sbjct: 96  TWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTD 155

Query: 294 KAVELFLQ--------AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYL 345
             +             +  LP+  PQ                           + L    
Sbjct: 156 SLITRNFSNYSSWHYRSCLLPQLHPQPRLPEN------------------VLLKELELVQ 197

Query: 346 ESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKL 405
            +   +P  Q A      +L               VL         +             
Sbjct: 198 NAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKSTVLQSELESCKEL------------- 244

Query: 406 TLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCF 465
                + L          +      L       E L+  +   A   +      +    F
Sbjct: 245 -----QELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKF 299

Query: 466 WVQGKKRK 473
            ++    K
Sbjct: 300 LLENSVLK 307


>3e4bA [x.x.x] ALGK
          Length = 395

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 37/423 (8%), Positives = 95/423 (22%), Gaps = 47/423 (11%)

Query: 211 GVELYRAERYGEAAEVLIQAANNTDSSTIYF---PKLLRYIVLAYHSGGQPAKALDVIRQ 267
             E  +      A +   Q A    S           L  ++ A  +  +  +A  ++++
Sbjct: 5   ANEALKRGDTVTAQQNYQQLAELGYSEAQVGLAAQARLGRLLAAKATEAEHHEAESLLKK 64

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHL 327
                    +      +  LQ  H    V    Q           A  A          L
Sbjct: 65  AFA--NGEGNTLIPLAMLYLQYPHSFPNVNAQQQISQWQAAGYPEAGLA-------QVLL 115

Query: 328 GEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSP 387
                 +  + + +    ++             +  + + ++ PE   E L+++    S 
Sbjct: 116 YRTQGTYDQHLDDVERICKA--ALNTTDICYVELATVYQKKQQPEQQAELLKQMEAGVSR 173

Query: 388 ---------QATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFL 438
                        +L +        K     LE++     +S   L +  +   +     
Sbjct: 174 GTVTAQRVDSVARVLGDATLGTPDEKTAQALLEKIAPGYPASWVSLAQLLYDFPELGDVE 233

Query: 439 EALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP-AEDTESILRLL 497
           + ++ L+   A           ++             +     + +         + ++ 
Sbjct: 234 QMMKYLDNGRAADQPRAELLLGKLYYEGKWVPADAKAAEAHFEKAVGREVAADYYLGQIY 293

Query: 498 LRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIR 557
            R    +                      L +L    R  +  +      L        +
Sbjct: 294 RRGYLGKV----------------YPQKALDHLLTAARNGQNSADFAIAQL------FSQ 331

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
                          Q     +           E         E     +  +    +  
Sbjct: 332 GKGTKPDPLNAYVFSQLAKAQDTPEANDLATQLEAPLTPAQRAEGQRLVQQELAARGTLL 391

Query: 617 RYY 619
           + +
Sbjct: 392 QLH 394



 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 22/143 (15%), Positives = 40/143 (27%), Gaps = 3/143 (2%)

Query: 172 HYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAA 231
              Y + +    D K    H  +    E   +Y L   Y           +A + L+ AA
Sbjct: 255 GKLYYEGKWVPADAKAAEAHFEKAVGREVAADYYLGQIYRRGYLGKVYPQKALDHLLTAA 314

Query: 232 NNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKH 291
            N  +S  +   + +       +   P  A    +         A+       + L    
Sbjct: 315 RNGQNSADFA--IAQLFSQGKGTKPDPLNAYVFSQLAKAQDTPEANDLATQLEAPLTPAQ 372

Query: 292 YHKAVELFLQAVAL-PEQPPQYA 313
             +   L  Q +A        +A
Sbjct: 373 RAEGQRLVQQELAARGTLLQLHA 395


>3e33A [a.118.6 (1d8dA)] PROTEIN
          Length = 323

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 28/341 (8%), Positives = 86/341 (25%), Gaps = 32/341 (9%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
           L L      L+                    +  +       ++             +  
Sbjct: 2   LSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQI---IYSEKFR--------DVYDYFR 50

Query: 329 EIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQ 388
            + +     E A +   +++  N            +L+  +            +    P+
Sbjct: 51  AVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPK 110

Query: 389 ATLILSN---IFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILN 445
              +  +   +          LEF+  ++     +      + + + + R +   L+ ++
Sbjct: 111 NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVD 170

Query: 446 EYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRK 505
           +   +          +               L +E++             + L    +  
Sbjct: 171 QLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEM--------IKLVPHNESA 222

Query: 506 YVHR-IFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEH-- 562
           + +    L    ++   +++ +LL L        L        L D   D++    ++  
Sbjct: 223 WNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLI-----AFLVDIYEDMLENQCDNKE 277

Query: 563 GYYEKTVELLQEYIEANQ--NGEAHFLLAETHRELGDFIEA 601
               K +EL +   +       E    +  + +        
Sbjct: 278 DILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRESD 318



 Score = 41.6 bits (96), Expect = 7e-06
 Identities = 29/271 (10%), Positives = 83/271 (30%), Gaps = 19/271 (7%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL 300
              L R           P          +     + D++ Y    L + +   +A +L  
Sbjct: 8   TYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTR 67

Query: 301 QAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALER 360
            A+ L                   +    +  +  + +E + Y +  + + P        
Sbjct: 68  DAIELNAANYTV----------WHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHH 117

Query: 361 IIKILKPRENPEYTRECLEKV--LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGN 418
              +++  ++P    E +  +   D  +  A      +  +   +   L+++++L++   
Sbjct: 118 RRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDV 177

Query: 419 SSAEILFRKSFCLI------QERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKR 472
            +  +  ++ F +               ++   E          A          +G  R
Sbjct: 178 RNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSR 237

Query: 473 KVRSLVQEIRTLEPAEDTESILRLLLRSQEK 503
              +L+ ++  L+P+  +  ++  L+   E 
Sbjct: 238 Y-PNLLNQLLDLQPSHSSPYLIAFLVDIYED 267


>3cvqA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
          Length = 289

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 32/352 (9%), Positives = 68/352 (19%), Gaps = 71/352 (20%)

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSL 324
                     Y +     GLS+L+L +  +A   F        +  +             
Sbjct: 4   YPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEA-----------W 52

Query: 325 YHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDF 384
             LG           A+     +   +P                                
Sbjct: 53  RSLGLTQAENEKDGLAIIALNHARALDPADIAVHAA------------------------ 88

Query: 385 SSPQATLILSNIFFQQGAYKLTLEFLER-LIRMGNSSAEILFRKSFCLIQERRFLEALRI 443
                   L+     +      L  L   L+            + F       + E   +
Sbjct: 89  --------LAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNEDFFFAAPNEYRECRTL 140

Query: 444 LNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEK 503
           L+     +        +  + + +        + ++    L P               + 
Sbjct: 141 LHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRP------------DDAQL 188

Query: 504 RKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEHG 563
              +       +     LD   R L +                     M ++   Y    
Sbjct: 189 WNKLGATLANGNRPQEALDAYNRALDI--------------NPGYVRVMYNMAVSYSNMS 234

Query: 564 YYEKTVELLQEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDPS 614
            Y+   + L   I                   +      +  Y   +E    
Sbjct: 235 QYDLAAKQLVRAIYMQVATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAK 286



 Score = 48.8 bits (115), Expect = 4e-08
 Identities = 30/272 (11%), Positives = 62/272 (22%), Gaps = 26/272 (9%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL 300
           + +      L+       A+A        Q  P   +     GL+  + +    A+    
Sbjct: 14  YHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALN 73

Query: 301 QAVALPEQPPQY---------------ASFAGVRGF---------RSLYHLGEIAEVFLN 336
            A AL                      A+ A +R +             +          
Sbjct: 74  HARALDPADIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNEDFFFAAPNE 133

Query: 337 YEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV--LDFSSPQATLILS 394
           Y E       +L  NP        +  +     N +     L +   L     Q    L 
Sbjct: 134 YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLG 193

Query: 395 NIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIY 454
                    +  L+   R + +      +++  +       ++  A + L          
Sbjct: 194 ATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVAT 253

Query: 455 PLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP 486
                   +   V  +   V     +      
Sbjct: 254 RSMWDFFRMLLNVMNRPDLVELTYAQNVEPFA 285



 Score = 41.9 bits (97), Expect = 5e-06
 Identities = 33/250 (13%), Positives = 67/250 (26%), Gaps = 18/250 (7%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPA 259
            P         G+     E+ G A   L  A     +       +   + +++ +     
Sbjct: 45  EPEREEAWRSLGLTQAENEKDGLAIIALNHARALDPA----DIAVHAALAVSHTNEHNAN 100

Query: 260 KALDVIRQGLQLFPNY-ADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGV 318
            AL  +R  L   P Y                 Y +   L   A+ +     Q       
Sbjct: 101 AALASLRAWLLSQPQYEQLGSVNEDFFFAAPNEYRECRTLLHAALEMNPNDAQ------- 153

Query: 319 RGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECL 378
                   LG +  +  NY+ A      ++   P       ++   L     P+   +  
Sbjct: 154 ----LHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAY 209

Query: 379 EKV--LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERR 436
            +   ++    +    ++  +     Y L  + L R I M  ++  +       L    R
Sbjct: 210 NRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVATRSMWDFFRMLLNVMNR 269

Query: 437 FLEALRILNE 446
                    +
Sbjct: 270 PDLVELTYAQ 279



 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 10/50 (20%), Positives = 18/50 (36%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDR 629
           +  EA   L  T  E      A     +A  LDP+    + + +  + + 
Sbjct: 47  EREEAWRSLGLTQAENEKDGLAIIALNHARALDPADIAVHAALAVSHTNE 96


>2c2lA [x.x.x] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
          Length = 281

 Score = 49.8 bits (117), Expect = 2e-08
 Identities = 31/168 (18%), Positives = 52/168 (30%), Gaps = 15/168 (8%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
              G  L+   +Y EAA    +A                   L Y    QP +AL   R+
Sbjct: 8   KEQGNRLFVGRKYPEAAACYGRAITRNPL----VAVYYTNRALCYLKMQQPEQALADCRR 63

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHL 327
            L+L       H++ G   L+++ Y +A+    +A +L ++                   
Sbjct: 64  ALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLN-----------FGDD 112

Query: 328 GEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTR 375
              A      +         +         L R+I   + RE  E  R
Sbjct: 113 IPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQR 160



 Score = 39.8 bits (91), Expect = 2e-05
 Identities = 6/63 (9%), Positives = 14/63 (22%), Gaps = 1/63 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
              E   Y++ +  LQ      +           +   +      +      I  +    
Sbjct: 81  CQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH 140

Query: 617 RYY 619
            Y 
Sbjct: 141 SYL 143


>3cvpA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
          Length = 279

 Score = 49.6 bits (117), Expect = 2e-08
 Identities = 32/295 (10%), Positives = 70/295 (23%), Gaps = 39/295 (13%)

Query: 211 GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQ 270
                    Y                      + L  + LA  +  + A A + +    Q
Sbjct: 2   DYPFEANNPYMYHEN--------------PMEEGLSMLKLA--NLAEAALAFEAV---CQ 42

Query: 271 LFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQY--------------ASF 315
             P   +     GL+  + +    A+     A  L P+    +              A+ 
Sbjct: 43  AAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAAL 102

Query: 316 AGVRGF--RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEY 373
           A +R +      +          Y E       +L  NP        +  +     N + 
Sbjct: 103 ASLRAWLLSQPQYEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDS 162

Query: 374 TRECLEKVLDF--SSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCL 431
               L + ++      Q    L          +  L+   R + +      +++  +   
Sbjct: 163 AAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSY 222

Query: 432 IQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP 486
               ++  A + L                  +   V  +   V     +      
Sbjct: 223 SNMSQYDLAAKQLVRAIYMQVTRS-MWDFFRMLLNVMNRPDLVELTYAQNVEPFA 276



 Score = 41.2 bits (95), Expect = 9e-06
 Identities = 30/282 (10%), Positives = 54/282 (19%), Gaps = 19/282 (6%)

Query: 336 NYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFS--SPQATLIL 393
            Y                     E  + +LK   N        E V   +    +A   L
Sbjct: 10  PYMYHENPM--------------EEGLSMLK-LANLAEAALAFEAVCQAAPEREEAWRSL 54

Query: 394 SNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYI 453
                +     L +  L     +      +    +     E     AL  L  +      
Sbjct: 55  GLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQ 114

Query: 454 YPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLG 513
           Y    F     +            +        A                      + L 
Sbjct: 115 YEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELR 174

Query: 514 KDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDI--IRLYHEHGYYEKTVEL 571
            D   L   +   L   +      + ++R      G   +       Y     Y+   + 
Sbjct: 175 PDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ 234

Query: 572 LQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
           L   I                  +      +  Y   +E   
Sbjct: 235 LVRAIYMQVTRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFA 276



 Score = 37.3 bits (85), Expect = 1e-04
 Identities = 13/82 (15%), Positives = 21/82 (25%), Gaps = 20/82 (24%)

Query: 558 LYHEHGYYEKTVELLQEYIE--------------------ANQNGEAHFLLAETHRELGD 597
            +  +  Y      ++E +                     A +  EA   L  T  E   
Sbjct: 4   PFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEK 63

Query: 598 FIEADHHYRYAIELDPSQPRYY 619
              A     +A  LDP     +
Sbjct: 64  DGLAIIALNHARMLDPKDIAVH 85


>3cvnA [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR
          Length = 300

 Score = 48.9 bits (115), Expect = 4e-08
 Identities = 16/122 (13%), Positives = 38/122 (31%), Gaps = 4/122 (3%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL 300
             +L   +     +G +P +ALD   + L + P Y  + Y   +S   +  Y  A +  +
Sbjct: 183 DAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLV 242

Query: 301 QAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALER 360
           +A+ +                        +  V    +     Y +++            
Sbjct: 243 RAIYMQVGGEASREATR----SMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSM 298

Query: 361 II 362
           ++
Sbjct: 299 LL 300



 Score = 45.4 bits (106), Expect = 5e-07
 Identities = 35/297 (11%), Positives = 71/297 (23%), Gaps = 26/297 (8%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAA---EVLIQAANNTDSSTIYFPKLLRYIVLAYHSGG 256
               +      G+ + +     EAA   E + QAA           +  R + L      
Sbjct: 10  PYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPE-------REEAWRSLGLTQAENE 62

Query: 257 QPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFA 316
           +   A+  +     L P    +H    +S     + + A+   L+A  L +   +     
Sbjct: 63  KDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALA-SLRAWLLSQPQYEQLGS- 120

Query: 317 GVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRE 376
                       E  E       AL         N     A   ++  L    +      
Sbjct: 121 --VNLFFFAAPNEYRECRTLLHAALEMN-----PNDAQLHASLGVLYNLSNNYDSAAANL 173

Query: 377 CLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERR 436
                L     Q    L          +  L+   R + +      +++  +       +
Sbjct: 174 RRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQ 233

Query: 437 FLEA-------LRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP 486
           +  A       + +     A             +   V  +   V     +      
Sbjct: 234 YDLAAKQLVRAIYMQVGGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFA 290



 Score = 39.6 bits (91), Expect = 3e-05
 Identities = 31/328 (9%), Positives = 69/328 (21%), Gaps = 37/328 (11%)

Query: 268 GLQLF----PNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRS 323
                      Y +     GLS+L+L +  +A    L   A+ +  P+           +
Sbjct: 2   DYPFEANNPYMYHENPMEEGLSMLKLANLAEAA---LAFEAVCQAAPERE--------EA 50

Query: 324 LYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL- 382
              LG           A+     +   +P        +        N       L   L 
Sbjct: 51  WRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLL 110

Query: 383 -DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
                 Q   +    F     Y+     L   + M  + A++             +  A 
Sbjct: 111 SQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAA 170

Query: 442 RILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQ 501
             L                         + ++          + P      +  + +   
Sbjct: 171 ANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINP-GYVRVMYNMAVSYS 229

Query: 502 EKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHE 561
              +Y         A+ + +                        +           L + 
Sbjct: 230 NMSQYDLAAKQLVRAIYMQVGGEA------------------SREATRSMWDFFRMLLNV 271

Query: 562 HGYYEKTVELLQEYIEAN-QNGEAHFLL 588
               +       + +E   +      +L
Sbjct: 272 MNRPDLVELTYAQNVEPFAKEFGLQSML 299



 Score = 39.2 bits (90), Expect = 3e-05
 Identities = 10/47 (21%), Positives = 16/47 (34%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
           +  EA   L  T  E      A     +A  LDP     + + +  +
Sbjct: 46  EREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSH 92



 Score = 36.9 bits (84), Expect = 2e-04
 Identities = 25/251 (9%), Positives = 50/251 (19%), Gaps = 18/251 (7%)

Query: 386 SPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILN 445
             +A   L     +     L +  L     +      +    +     E     AL  L 
Sbjct: 47  REEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLR 106

Query: 446 EYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRT---------LEPAEDTESILRL 496
            +      Y       +  F    + R+ R+L+                           
Sbjct: 107 AWLLSQPQYEQLGSVNLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNY 166

Query: 497 LLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDII 556
              +   R+ V            L   +       E          ++P      M ++ 
Sbjct: 167 DSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY-VRVMYNMA 225

Query: 557 RLYHEHGYYEKTVELLQEYIEANQ--------NGEAHFLLAETHRELGDFIEADHHYRYA 608
             Y     Y+   + L   I                          +      +  Y   
Sbjct: 226 VSYSNMSQYDLAAKQLVRAIYMQVGGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQN 285

Query: 609 IELDPSQPRYY 619
           +E    +    
Sbjct: 286 VEPFAKEFGLQ 296



 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 16/102 (15%), Positives = 35/102 (34%), Gaps = 3/102 (2%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQA---ANNTDSST 238
             ++    L    + +  NPG   + Y+  V      +Y  AA+ L++A       ++S 
Sbjct: 196 NGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGEASR 255

Query: 239 IYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY 280
                +  +  +  +   +P        Q ++ F     L  
Sbjct: 256 EATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQS 297


>3dsuA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 306

 Score = 48.5 bits (114), Expect = 6e-08
 Identities = 21/204 (10%), Positives = 49/204 (24%), Gaps = 10/204 (4%)

Query: 240 YFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELF 299
            +    + +     +G      L++  Q L   P++A L       L  L+      E  
Sbjct: 11  LYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESA 70

Query: 300 LQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLN-YEEALRYYLESLRDNPGFQPAL 358
               A                    +    ++ +    +   L      L  +       
Sbjct: 71  ALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCW 130

Query: 359 ERIIKI-----LKPRENPEYTRECLEK----VLDFSSPQATLILSNIFFQQGAYKLTLEF 409
           +    +     + P E   +T   + +       +      L   +    +      LE 
Sbjct: 131 DYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPRLPENVLLKELEL 190

Query: 410 LERLIRMGNSSAEILFRKSFCLIQ 433
           ++       +     F   + L  
Sbjct: 191 VQNAFFTDPNDQSAWFYHRWLLGA 214



 Score = 41.5 bits (96), Expect = 7e-06
 Identities = 19/165 (11%), Positives = 44/165 (26%), Gaps = 19/165 (11%)

Query: 223 AAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYG 282
           A    +   N ++ S+ ++   L   +          K L++++      PN     +Y 
Sbjct: 149 AFTDSLITRNFSNYSSWHYRSCLLPQLHPRLPENVLLKELELVQNAFFTDPNDQSAWFYH 208

Query: 283 GLSLLQLKHYH-----------KAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIA 331
              L                    +E   +   L  +              ++  L    
Sbjct: 209 RWLLGAGSGRCELSVEKSTVLQSELESCKELQELEPENKWCL--------LTIILLMRAL 260

Query: 332 EVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRE 376
           +  L  +E L+Y+      +P     L+ +        +      
Sbjct: 261 DPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEY 305



 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 10/73 (13%), Positives = 19/73 (26%), Gaps = 4/73 (5%)

Query: 559 YHEHGYYEKTVELLQEYIEANQN----GEAHFLLAETHRELGDFIEADHHYRYAIELDPS 614
             +    +  +E  +E  E             LL      L    E   ++     +DP 
Sbjct: 223 VEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPM 282

Query: 615 QPRYYISQSKLYE 627
           +  Y       + 
Sbjct: 283 RAAYLDDLRSKFL 295



 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 3/55 (5%), Positives = 14/55 (25%), Gaps = 1/55 (1%)

Query: 573 QEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
            E  +  +    A   + +  +               +  +P     +  + ++ 
Sbjct: 3   LEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVL 57


>3dswA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 313

 Score = 48.1 bits (113), Expect = 7e-08
 Identities = 34/296 (11%), Positives = 73/296 (24%), Gaps = 32/296 (10%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL 300
           +    + +     +G      L++  Q L   P++A L       L  L+      E   
Sbjct: 17  YQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAA 76

Query: 301 QAVALPEQPPQ-YASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALE 359
              A                G               N+   L      L  +       +
Sbjct: 77  LVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWD 136

Query: 360 RIIKI-----LKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQ--------QGAYKLT 406
               +     + P E   +T   +    +FS+  +    S +  Q        +      
Sbjct: 137 YRRFVAAQAAVAPAEELAFTDSLIT--RNFSNYSSWHYRSCLLPQLHPQPRLPENVLLKE 194

Query: 407 LEFLERLIRMGNSSAEILFRK--------------SFCLIQERRFLEALRILNEYTADSY 452
           LE ++       +     F                       +  LE+ + L E   ++ 
Sbjct: 195 LELVQNAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKSTVLQSELESCKELQELEPENK 254

Query: 453 IYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP--AEDTESILRLLLRSQEKRKY 506
              L     +        +++       ++ ++P  A   + +    L      K 
Sbjct: 255 WCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKM 310



 Score = 41.2 bits (95), Expect = 9e-06
 Identities = 12/81 (14%), Positives = 21/81 (25%), Gaps = 1/81 (1%)

Query: 548 LGDRMLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYR 606
              R    +          ++ + LQE    N        LL      L    E   ++ 
Sbjct: 222 GSGRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFS 281

Query: 607 YAIELDPSQPRYYISQSKLYE 627
               +DP +  Y       + 
Sbjct: 282 TLKAVDPMRAAYLDDLRSKFL 302



 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 2/47 (4%), Positives = 12/47 (25%)

Query: 583 EAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDR 629
            A   + +  +               +  +P     +  + ++ +  
Sbjct: 19  SATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHL 65


>3dsvA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 315

 Score = 47.4 bits (111), Expect = 1e-07
 Identities = 14/94 (14%), Positives = 25/94 (26%), Gaps = 4/94 (4%)

Query: 547 CLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNG----EAHFLLAETHRELGDFIEAD 602
            LG           +    +  +E  +E  E             LL      L    E  
Sbjct: 221 LLGAGSGRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETL 280

Query: 603 HHYRYAIELDPSQPRYYISQSKLYEDRSEKIKGE 636
            ++     +DP +  Y       +   +  +K E
Sbjct: 281 QYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKME 314



 Score = 44.3 bits (103), Expect = 1e-06
 Identities = 34/332 (10%), Positives = 81/332 (24%), Gaps = 32/332 (9%)

Query: 287 LQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLE 346
           +  +          Q + L +               +   + +  +     E  L    +
Sbjct: 1   MHGRLKEAKRLEREQKLKLYQS--------------ATQAVFQKRQAGELDESVLELTSQ 46

Query: 347 SLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLT 406
            L  NP F        ++L+  E  +   E    V        + +  N       +   
Sbjct: 47  ILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRC 106

Query: 407 LEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYP---LAKFNQIL 463
              L RL     +    L  +   L  + R            A + + P   LA  + ++
Sbjct: 107 -WLLSRLPEPNWARELELCAR--FLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLI 163

Query: 464 CFWVQGKKRKVR--SLVQEIRTLE--PAEDTESILRLLLRSQEKRKYV--HRIFLGKDAV 517
                          L+ ++      P       L L+  +            +      
Sbjct: 164 TRNFSNYSSWHYRSCLLPQLHPQPRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLG 223

Query: 518 TLLLDIVGRLLYLSELTRVEELFSRV-----DPKCLGDRMLDIIRLYHEHGYYEKTVELL 572
                    +   + L    E    +     + K     ++ ++R      Y ++T++  
Sbjct: 224 AGSGRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYF 283

Query: 573 QEYIEAN-QNGEAHFLLAETHRELGDFIEADH 603
                 +         L          ++ ++
Sbjct: 284 STLKAVDPMRAAYLDDLRSKFLLENSVLKMEY 315



 Score = 42.7 bits (99), Expect = 3e-06
 Identities = 7/88 (7%), Positives = 19/88 (21%), Gaps = 1/88 (1%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
               + + ++       E   +     +    +    +  ++ A        + L     
Sbjct: 227 GRCELSVEKSTVLQSELE-SCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFST 285

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKA 295
              + P  A          L      K 
Sbjct: 286 LKAVDPMRAAYLDDLRSKFLLENSVLKM 313



 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 11/97 (11%), Positives = 25/97 (25%), Gaps = 8/97 (8%)

Query: 270 QLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGE 329
                         LS+ +       +E   +   L  +              ++  L  
Sbjct: 217 YHRWLLGAGSGRCELSVEKSTVLQSELESCKELQELEPENKWCL--------LTIILLMR 268

Query: 330 IAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILK 366
             +  L  +E L+Y+      +P     L+ +     
Sbjct: 269 ALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFL 305



 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 4/66 (6%), Positives = 18/66 (27%), Gaps = 2/66 (3%)

Query: 564 YYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQS 623
             E      ++ ++  Q   A   + +  +               +  +P     +  + 
Sbjct: 5   LKEAKRLEREQKLKLYQ--SATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRR 62

Query: 624 KLYEDR 629
           ++ +  
Sbjct: 63  EVLQHL 68



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 27/315 (8%), Positives = 62/315 (19%), Gaps = 66/315 (20%)

Query: 219 RYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADL 278
           R  EA  +  +                + +     +G      L++  Q L   P++A L
Sbjct: 4   RLKEAKRLEREQKLKLY------QSATQAVFQKRQAGELDESVLELTSQILGANPDFATL 57

Query: 279 HYYGGLSLLQL----------KHYHKAVELFLQAVALPEQPPQYASFAGVRGF------- 321
                  L  L                +      + +  +                    
Sbjct: 58  WNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNW 117

Query: 322 ------------------RSLYHLGEIA-EVFLNYEEALRYYLESLRDNPGFQPALERII 362
                                 +   +A +  +   E L +    +  N     +     
Sbjct: 118 ARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYRS 177

Query: 363 KILK--------PRENPE-------------YTRECLEKVLDFSSPQATLILSNIFFQQG 401
            +L         P                     +       +     +        +  
Sbjct: 178 CLLPQLHPQPRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKST 237

Query: 402 AYKLTLEFLERLIRMGNS---SAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAK 458
             +  LE  + L  +          +      L       E L+  +   A   +     
Sbjct: 238 VLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYL 297

Query: 459 FNQILCFWVQGKKRK 473
            +    F ++    K
Sbjct: 298 DDLRSKFLLENSVLK 312



 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 27/263 (10%), Positives = 60/263 (22%), Gaps = 18/263 (6%)

Query: 375 RECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQE 434
           R   E+ L      AT  +          +  LE   +++      A +   +   L   
Sbjct: 10  RLEREQKLK-LYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHL 68

Query: 435 RRFLEALRILNEYTA------------DSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIR 482
                         A                        +L    +    +   L     
Sbjct: 69  ETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFL 128

Query: 483 TLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSR 542
             +         R  + +Q        +      +T          Y S L  + +L  +
Sbjct: 129 EADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYRSCL--LPQLHPQ 186

Query: 543 VDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEAD 602
             P+   + +L  + L     + +   +    +      G        +  +        
Sbjct: 187 --PRLPENVLLKELELVQNAFFTDPNDQ-SAWFYHRWLLGAGSGRCELSVEKSTVLQSEL 243

Query: 603 HHYRYAIELDPSQPRYYISQSKL 625
              +   EL+P      ++   L
Sbjct: 244 ESCKELQELEPENKWCLLTIILL 266


>3beeB [x.x.x] PUTATIVE YFRE PROTEIN
          Length = 89

 Score = 45.7 bits (108), Expect = 4e-07
 Identities = 11/72 (15%), Positives = 25/72 (34%), Gaps = 1/72 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
           Y      ++   LL++ ++    N  A  L+A  H     F EA   +   ++ +     
Sbjct: 16  YLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLD 75

Query: 618 YYISQSKLYEDR 629
                  + + +
Sbjct: 76  RVTIIESINKAK 87



 Score = 40.7 bits (95), Expect = 1e-05
 Identities = 8/56 (14%), Positives = 18/56 (32%)

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
           L Y       +   ++ Q LQL P                  + +A++ ++  +  
Sbjct: 14  LYYLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDS 69



 Score = 36.9 bits (85), Expect = 2e-04
 Identities = 12/77 (15%), Positives = 19/77 (24%), Gaps = 4/77 (5%)

Query: 214 LYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFP 273
               +   E + +L QA         Y    L  I   +    +  +A+D     L    
Sbjct: 16  YLHKQATDEVSLLLEQALQLEP----YNEAALSLIANDHFISFRFQEAIDTWVLLLDSND 71

Query: 274 NYADLHYYGGLSLLQLK 290
              D            K
Sbjct: 72  PNLDRVTIIESINKAKK 88



 Score = 35.0 bits (80), Expect = 6e-04
 Identities = 14/86 (16%), Positives = 27/86 (31%), Gaps = 11/86 (12%)

Query: 284 LSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRY 343
           L  L  +   +   L  QA+ L                  L  +     +   ++EA+  
Sbjct: 14  LYYLHKQATDEVSLLLEQALQLEPYNEAA-----------LSLIANDHFISFRFQEAIDT 62

Query: 344 YLESLRDNPGFQPALERIIKILKPRE 369
           ++  L  N      +  I  I K ++
Sbjct: 63  WVLLLDSNDPNLDRVTIIESINKAKK 88


>3beeA [x.x.x] PUTATIVE YFRE PROTEIN
          Length = 90

 Score = 45.4 bits (107), Expect = 5e-07
 Identities = 11/72 (15%), Positives = 25/72 (34%), Gaps = 1/72 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
           Y      ++   LL++ ++    N  A  L+A  H     F EA   +   ++ +     
Sbjct: 17  YLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLD 76

Query: 618 YYISQSKLYEDR 629
                  + + +
Sbjct: 77  RVTIIESINKAK 88



 Score = 38.5 bits (89), Expect = 6e-05
 Identities = 8/56 (14%), Positives = 18/56 (32%)

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
           L Y       +   ++ Q LQL P                  + +A++ ++  +  
Sbjct: 15  LYYLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDS 70



 Score = 35.8 bits (82), Expect = 4e-04
 Identities = 12/77 (15%), Positives = 19/77 (24%), Gaps = 4/77 (5%)

Query: 214 LYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFP 273
               +   E + +L QA         Y    L  I   +    +  +A+D     L    
Sbjct: 17  YLHKQATDEVSLLLEQALQLEP----YNEAALSLIANDHFISFRFQEAIDTWVLLLDSND 72

Query: 274 NYADLHYYGGLSLLQLK 290
              D            K
Sbjct: 73  PNLDRVTIIESINKAKK 89



 Score = 35.4 bits (81), Expect = 5e-04
 Identities = 14/86 (16%), Positives = 27/86 (31%), Gaps = 11/86 (12%)

Query: 284 LSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRY 343
           L  L  +   +   L  QA+ L                  L  +     +   ++EA+  
Sbjct: 15  LYYLHKQATDEVSLLLEQALQLEPYNEAA-----------LSLIANDHFISFRFQEAIDT 63

Query: 344 YLESLRDNPGFQPALERIIKILKPRE 369
           ++  L  N      +  I  I K ++
Sbjct: 64  WVLLLDSNDPNLDRVTIIESINKAKK 89


>2c63A [x.x.x] 14-3-3 PROTEIN ETA
          Length = 233

 Score = 44.6 bits (104), Expect = 8e-07
 Identities = 12/124 (9%), Positives = 31/124 (25%), Gaps = 6/124 (4%)

Query: 239 IYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLF----PNYADLHYYGGLSLLQLKHYHK 294
               + +   VL+           D   +    +     +Y            +      
Sbjct: 88  EKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEA 147

Query: 295 AVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGF 354
           +   + +A  + ++  Q      +    +L       E+    E+A     ++  D    
Sbjct: 148 SEAAYKEAFEISKEQMQPTHPIRL--GLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAE 205

Query: 355 QPAL 358
              L
Sbjct: 206 LDTL 209



 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 21/195 (10%), Positives = 48/195 (24%), Gaps = 19/195 (9%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAA----NNTDSSTIYFPKLLRYIVLAYHSGGQPAKALD 263
                   +AERY + A  +          ++          + +V A  S  +   +++
Sbjct: 6   LQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIE 65

Query: 264 -------------VIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPP 310
                         ++   +      +      LSLL         +   ++     +  
Sbjct: 66  QKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMK 125

Query: 311 QYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESL--RDNPGFQPALERIIKILKPR 368
                              +      Y+EA     E +          AL   +   + +
Sbjct: 126 GDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQ 185

Query: 369 ENPEYTRECLEKVLD 383
             PE      ++  D
Sbjct: 186 NAPEQACLLAKQAFD 200



 Score = 34.6 bits (78), Expect = 8e-04
 Identities = 26/214 (12%), Positives = 61/214 (28%), Gaps = 13/214 (6%)

Query: 421 AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQ--GKKRKVRSLV 478
            E L +++    Q  R+ +    +   T  +        N +   +    G +R    ++
Sbjct: 2   REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVI 61

Query: 479 QEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEE 538
             I     A+  E  L  +   +EK +         + V  LLD              + 
Sbjct: 62  SSIEQKTMADGNEKKLEKVKAYREKIEKELETV--CNDVLSLLDKFLIKNCNDFQYESKV 119

Query: 539 LFSRVDPKC------LGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQN---GEAHFLLA 589
            + ++          +         +      Y++  E+ +E ++       G A     
Sbjct: 120 FYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSV 179

Query: 590 ETHRELGDFIEADHHYRYAIELDPSQPRYYISQS 623
             +       +A    + A +   ++       S
Sbjct: 180 FYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDS 213


>3ck7A [x.x.x] SUSD
          Length = 496

 Score = 44.5 bits (103), Expect = 8e-07
 Identities = 20/380 (5%), Positives = 67/380 (17%), Gaps = 28/380 (7%)

Query: 259 AKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGV 318
              L V  +G   F                           L +++      +       
Sbjct: 11  YAMLGVTDEGESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPSSQRT------ 64

Query: 319 RGFRSLYHLGEIAEVFLNYEEALRYYLESLRD--NPGFQPALERIIKILKPRENPEYTRE 376
                 +    +      Y   L                              +      
Sbjct: 65  -----EWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRALHYWYFLDLFGKAP 119

Query: 377 CLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERR 436
             E   +    +               +  L  +E  +     +      K+   +   R
Sbjct: 120 FKEHFSNDLPVEKKG-----TELYTYIQNELNEIEADMYEPRQAPFGRADKAANWLLRAR 174

Query: 437 FLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRL 496
                 +    T  +     A       + +     ++     +       E    I + 
Sbjct: 175 LYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEIILPIRQD 234

Query: 497 LLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLD-- 554
            ++++      + +   + A    +        +     + + F                
Sbjct: 235 GVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVEI 294

Query: 555 -------IIRLYHEHGYYEKTVELLQEYIEANQN-GEAHFLLAETHRELGDFIEADHHYR 606
                    ++      +    E + +    ++    +         +            
Sbjct: 295 PTKGLDTDEQIDAFDAEHGIRTEDMIKAAGDDRALLYSGVGGGRRKIQTDAISGFTDGLS 354

Query: 607 YAIELDPSQPRYYISQSKLY 626
                +       +S +   
Sbjct: 355 IVKWQNYRSDGKPVSHATYP 374



 Score = 41.1 bits (94), Expect = 9e-06
 Identities = 23/305 (7%), Positives = 56/305 (18%), Gaps = 11/305 (3%)

Query: 331 AEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL--DFSSPQ 388
             VF+     L    E              +          +         +    SS +
Sbjct: 4   QGVFVKGYAMLGVTDEGESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPSSQR 63

Query: 389 ATLILSNIFFQQGAYKLTLEFLERLIR--MGNSSAEILFRKSFCLIQERRFLEALRILNE 446
              +   + +    Y   L+  E +         AEI F ++                  
Sbjct: 64  TEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRALHYWYFLDLFGKAPFKEH 123

Query: 447 YTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKY 506
           ++ D  +                       + +  +      D  +   L  R       
Sbjct: 124 FSNDLPVEKKGTELYTYIQNEL--NEIEADMYEPRQAPFGRADKAANWLLRARLYLNAGV 181

Query: 507 VHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLG----DRMLDIIRLYHEH 562
                    A      ++G    L        +    + +         +         +
Sbjct: 182 YTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEIILPIRQDGVKTRNY 241

Query: 563 GYYEKTVELLQEYIEANQN-GEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYIS 621
           G     V   +               +      +  F                  +   +
Sbjct: 242 GGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVEIPTKGLDT 301

Query: 622 QSKLY 626
             ++ 
Sbjct: 302 DEQID 306


>3c72A [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 306

 Score = 44.2 bits (103), Expect = 1e-06
 Identities = 31/180 (17%), Positives = 47/180 (26%), Gaps = 10/180 (5%)

Query: 259 AKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGV 318
           AK L    +  Q    Y              +     +EL  Q +          +    
Sbjct: 1   AKRL----EREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRR- 55

Query: 319 RGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTR--E 376
              + L       E     +  L +    LR NP           +L     P + R  E
Sbjct: 56  EVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELE 115

Query: 377 CLEKVL--DFSSPQATLILSNIFFQQG-AYKLTLEFLERLIRMGNSSAEILFRKSFCLIQ 433
              + L  D  +         +  Q   A    L F + LI    S+      +S  L Q
Sbjct: 116 LCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYRSCLLPQ 175



 Score = 42.7 bits (99), Expect = 3e-06
 Identities = 30/297 (10%), Positives = 71/297 (23%), Gaps = 27/297 (9%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAAEVLIQA-ANNTDSSTIYFPKLLRYIVL-----AYH 253
                        +    E      E+  Q    N D +T++  +      L        
Sbjct: 10  LKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEE 69

Query: 254 SGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQL--KHYHKAVELFLQAVAL-PEQPP 310
           S       L  +   L++ P      ++    L +L   ++ + +EL  + +        
Sbjct: 70  SAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFH 129

Query: 311 QYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPREN 370
            +     V    ++    E+A      +  +     +          L ++     P   
Sbjct: 130 CWDYRRFVAAQAAVAPAEELAF----TDSLITRNFSNYSSWHYRSCLLPQLHPQPLPENV 185

Query: 371 PEYTRECLEKVL-----------DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNS 419
                E ++                              +    +  LE  + L  +   
Sbjct: 186 LLKELELVQNAFFTDPNDQSAWFYHRWLLGAGRCELSVEKSTVLQSELESCKELQELEPE 245

Query: 420 SAE---ILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRK 473
           +      +      L       E L+  +   A   +      +    F ++    K
Sbjct: 246 NKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLK 302



 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 8/102 (7%), Positives = 20/102 (19%), Gaps = 1/102 (0%)

Query: 196 EMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSG 255
                    L      + + ++       E   +     +    +    +  ++ A    
Sbjct: 205 SAWFYHRWLLGAGRCELSVEKSTVLQSELESCKELQEL-EPENKWCLLTIILLMRALDPL 263

Query: 256 GQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVE 297
               + L        + P  A          L      K   
Sbjct: 264 LYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEY 305



 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 12/82 (14%), Positives = 24/82 (29%), Gaps = 4/82 (4%)

Query: 559 YHEHGYYEKTVELLQEYIEANQNGE----AHFLLAETHRELGDFIEADHHYRYAIELDPS 614
             +    +  +E  +E  E     +       LL      L    E   ++     +DP 
Sbjct: 223 VEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPM 282

Query: 615 QPRYYISQSKLYEDRSEKIKGE 636
           +  Y       +   +  +K E
Sbjct: 283 RAAYLDDLRSKFLLENSVLKME 304


>2dbaA [x.x.x] SMOOTH MUSCLE CELL ASSOCIATED PROTEIN-1, ISOFORM
          Length = 148

 Score = 44.2 bits (103), Expect = 1e-06
 Identities = 20/119 (16%), Positives = 36/119 (30%), Gaps = 2/119 (1%)

Query: 199 ENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQP 258
               +       G EL++   YG A       A   D++      L R     +      
Sbjct: 23  PGASSVEQLRKEGNELFKCGDYGGALAAY-TQALGLDATPQDQAVLHRNRAACHLKLEDY 81

Query: 259 AKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQYASFA 316
            KA     + ++         Y    +L +L    +AV    + V+L P+      +  
Sbjct: 82  DKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALR 140



 Score = 41.9 bits (97), Expect = 5e-06
 Identities = 17/126 (13%), Positives = 33/126 (26%), Gaps = 26/126 (20%)

Query: 267 QGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRG------ 320
           +      +  +     G  L +   Y  A+  + QA+ L   P   A     R       
Sbjct: 19  RPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKL 78

Query: 321 --------------------FRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALER 360
                                ++LY   +  E     ++A+      +   P  +   E 
Sbjct: 79  EDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEA 138

Query: 361 IIKILK 366
           +  I  
Sbjct: 139 LRNISG 144


>2b05A [x.x.x] 14-3-3 PROTEIN GAMMA
          Length = 233

 Score = 44.2 bits (103), Expect = 1e-06
 Identities = 16/197 (8%), Positives = 49/197 (24%), Gaps = 10/197 (5%)

Query: 166 EDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAE 225
           +D+        +      +++   L +  K +              +     +   +  E
Sbjct: 20  DDMAAAMKNVTELNEPLSNEERNLLSVAYKNV----VGARRSSWRVISSIEQKTSADGNE 75

Query: 226 VLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLF----PNYADLHYY 281
             I+             + +   VL+           +   +    +     +Y      
Sbjct: 76  KKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAE 135

Query: 282 GGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEAL 341
                 +      + + + +A  + ++  Q      +    +L +     E+    E+A 
Sbjct: 136 VATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRL--GLALNYSVFYYEIQNAPEQAC 193

Query: 342 RYYLESLRDNPGFQPAL 358
                +  D       L
Sbjct: 194 HLAKTAFDDAIAELDTL 210


>1a37A [a.118.7] 14-3-3 PROTEIN ZETA
          Length = 195

 Score = 44.2 bits (103), Expect = 1e-06
 Identities = 10/114 (8%), Positives = 29/114 (25%), Gaps = 8/114 (7%)

Query: 240 YFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELF 299
              + +   VL+         A +     L++  +Y            +     ++ + +
Sbjct: 83  TELRDICNDVLSLLEKFLIPNAAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAY 142

Query: 300 LQAVAL-PEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNP 352
            +A  +   +     +F+        Y        F   E         ++   
Sbjct: 143 QEAFEISKIRLGLALNFS-----VFYYACSLAKTAF--DEAIADDSTLIMQLLR 189



 Score = 42.3 bits (98), Expect = 4e-06
 Identities = 11/77 (14%), Positives = 23/77 (29%), Gaps = 1/77 (1%)

Query: 556 IRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPS 614
           +    E        E    Y++           +A    + G   ++   Y+ A E+   
Sbjct: 92  VLSLLEKFLIPNAAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKI 151

Query: 615 QPRYYISQSKLYEDRSE 631
           +    ++ S  Y   S 
Sbjct: 152 RLGLALNFSVFYYACSL 168



 Score = 34.6 bits (78), Expect = 8e-04
 Identities = 6/68 (8%), Positives = 17/68 (25%), Gaps = 6/68 (8%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHH-----YRYAIEL 611
              + G  +++ +  QE  E +          +  +        A            ++L
Sbjct: 128 GDDKKGIVDQSQQAYQEAFEISKIRLGLALNFSVFYYACSLAKTAFDEAIADDSTLIMQL 187

Query: 612 DPSQPRYY 619
                  +
Sbjct: 188 LRDNLTLW 195


>1a38A [a.118.7] 14-3-3 PROTEIN ZETA
          Length = 216

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 25/206 (12%), Positives = 57/206 (27%), Gaps = 20/206 (9%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
                   +AERY + A  +               +    + +AY +     ++   +  
Sbjct: 7   VQKAKLAEQAERYDDMAACMKSVTEQGAE---LSNEERNLLSVAYKNVVGARRSSWRVVS 63

Query: 268 GLQLFPNYADLHYYGGLSLLQLK----HYHKAVELFLQAVALPEQPPQYASFAGVRGFRS 323
            ++          Y      +L+         +E FL   A   +   +        +R 
Sbjct: 64  SIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRY 123

Query: 324 LYHLGEIAEVFLNYEEALRYYLESLR---------DNPGFQPALERIIKILKPRENPEYT 374
           L  +    +     +++ + Y E+                  AL   +   +   +PE  
Sbjct: 124 LAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKA 183

Query: 375 RECLEKVL----DFSSPQATLILSNI 396
               +         S   +TLI+  +
Sbjct: 184 CSLAKTAFDEAIAESYKDSTLIMQLL 209



 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 6/207 (2%), Positives = 43/207 (20%), Gaps = 16/207 (7%)

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFP-NYADLHYYGGLSLLQLKHYHKAVELFL 300
              L           +       ++   +       +      ++   +    ++    +
Sbjct: 3   KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVV 62

Query: 301 QAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQP---- 356
            ++   ++      +             ++  +   +        ES       +     
Sbjct: 63  SSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYR 122

Query: 357 ALERIIKILKPRENPEYTRECLEKVLD-----------FSSPQATLILSNIFFQQGAYKL 405
            L  +      +   + +++  ++  +                A       +    + + 
Sbjct: 123 YLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEK 182

Query: 406 TLEFLERLIRMGNSSAEILFRKSFCLI 432
                +       + +         L+
Sbjct: 183 ACSLAKTAFDEAIAESYKDSTLIMQLL 209



 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 9/190 (4%), Positives = 34/190 (17%), Gaps = 22/190 (11%)

Query: 276 ADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFL 335
            +          Q + Y                  + ++        +  ++        
Sbjct: 3   KNELVQKAKLAEQAERYDDMAACMKSVTEQ---GAELSNEERNLLSVAYKNVVGARRSSW 59

Query: 336 NYEEALRYYLESLRDNPGFQPALERII--------KILKPRENPEYTRECLEKVLDFSSP 387
               ++    +        +     +          + K         E     L     
Sbjct: 60  RVVSSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGD 119

Query: 388 QATLI--LSNIFFQQGAYKLTLEFLERLIRMGNSS---------AEILFRKSFCLIQERR 436
               +  ++    ++G    + +  +    +                L    F       
Sbjct: 120 YYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNS 179

Query: 437 FLEALRILNE 446
             +A  +   
Sbjct: 180 PEKACSLAKT 189



 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 12/121 (9%), Positives = 24/121 (19%), Gaps = 5/121 (4%)

Query: 172 HYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQA- 230
               L                    +      Y           +     ++ +   +A 
Sbjct: 89  CNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAF 148

Query: 231 ----ANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSL 286
                    +  I     L + V  Y     P KA  + +         +       + L
Sbjct: 149 EISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAESYKDSTLIMQL 208

Query: 287 L 287
           L
Sbjct: 209 L 209


>2btpA [x.x.x] 14-3-3 PROTEIN TAU
          Length = 248

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 16/165 (9%), Positives = 38/165 (23%), Gaps = 7/165 (4%)

Query: 199 ENPGNYLLKYHYGVELYRAERYGEAAEVLIQA-ANNTDSSTIYFPKLLRYIVLAYHSGGQ 257
           E     +   +       A R   + E   +      D       +L            +
Sbjct: 62  ERNLLSVAYKNVVGGRRSAWRVISSIEQKTKKLQLIKDYREKVESELRSICTTVLELLDK 121

Query: 258 PAKALDVIRQGLQLF----PNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYA 313
              A     +    +     +Y            + +    +   + +A  + ++  Q  
Sbjct: 122 YLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT 181

Query: 314 SFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPAL 358
               +    +L       E+  N E A      +  +       L
Sbjct: 182 HPIRLG--LALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTL 224



 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 14/207 (6%), Positives = 35/207 (16%), Gaps = 17/207 (8%)

Query: 253 HSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL----PEQ 308
           H     +  +D+  + L                  Q + Y                   +
Sbjct: 2   HHHHHHSSGVDLGTENLYFQSMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNE 61

Query: 309 PPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI--IKILK 366
                S A             +        + L+   +          ++       + K
Sbjct: 62  ERNLLSVAYKNVVGGRRSAWRVISSIEQKTKKLQLIKDYREKVESELRSICTTVLELLDK 121

Query: 367 PRENPEYTRECLEKVLDFSSPQATLI--LSNIFFQQGAYKLTLEFLERLIRMGNSS---- 420
                    E     L         +  ++    ++     +    +    +        
Sbjct: 122 YLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT 181

Query: 421 -----AEILFRKSFCLIQERRFLEALR 442
                   L    F          A  
Sbjct: 182 HPIRLGLALNFSVFYYEILNNPELACT 208



 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 7/58 (12%), Positives = 16/58 (27%), Gaps = 1/58 (1%)

Query: 560 HEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
           H H ++   V+L  E +             A+   +   + +     +   E      
Sbjct: 2   HHHHHHSSGVDLGTENLYFQSMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELS 59


>2e2eA [x.x.x] FORMATE-DEPENDENT NITRITE REDUCTASE COMPLEX NRFG
          Length = 171

 Score = 42.7 bits (99), Expect = 3e-06
 Identities = 22/170 (12%), Positives = 51/170 (30%), Gaps = 10/170 (5%)

Query: 274 NYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEV 333
             A    Y        +     ++     +    Q  +         +  L         
Sbjct: 2   WQAVRAEYQRQRDPLHQFAEAQLQALQDKIRANPQNSEQ--------WALLGEYYLWQND 53

Query: 334 FLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV--LDFSSPQATL 391
           + N   A R  L+   +N     AL  ++     +     TR  ++K   LD +   A +
Sbjct: 54  YSNSLLAYRQALQLRGENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSNEITALM 113

Query: 392 ILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
           +L++  F Q  Y   +E  ++++ + +             + +     + 
Sbjct: 114 LLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRSD 163



 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 13/155 (8%), Positives = 44/155 (28%), Gaps = 5/155 (3%)

Query: 324 LYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLD 383
             +  +   +    E  L+   + +R NP        + +    + +   +     + L 
Sbjct: 7   AEYQRQRDPLHQFAEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQ 66

Query: 384 FSSPQATLI-----LSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFL 438
                A L      +      Q     T   +++ + + ++    L   +     +  + 
Sbjct: 67  LRGENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYA 126

Query: 439 EALRILNEYTADSYIYPLAKFNQILCFWVQGKKRK 473
           +A+ +  +    +                +  +R+
Sbjct: 127 QAIELWQKVMDLNSPRINRTQLVESINMAKLLQRR 161



 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 8/101 (7%), Positives = 25/101 (24%), Gaps = 4/101 (3%)

Query: 197 MVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGG 256
             EN   Y                 +   ++ +A     +        L  +        
Sbjct: 68  RGENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSN----EITALMLLASDAFMQA 123

Query: 257 QPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVE 297
             A+A+++ ++ + L     +         +      ++  
Sbjct: 124 NYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRSDL 164



 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 7/70 (10%), Positives = 23/70 (32%), Gaps = 1/70 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
                   +T  ++ + +  +     A  LLA       ++ +A   ++  ++L+  +  
Sbjct: 85  QASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRIN 144

Query: 618 YYISQSKLYE 627
                  +  
Sbjct: 145 RTQLVESINM 154


>2b05F [x.x.x] 14-3-3 PROTEIN GAMMA
          Length = 232

 Score = 41.7 bits (96), Expect = 6e-06
 Identities = 9/87 (10%), Positives = 24/87 (27%), Gaps = 2/87 (2%)

Query: 272 FPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIA 331
             +Y            +      + + + +A  + ++  Q      +    +L +     
Sbjct: 125 KGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRL--GLALNYSVFYY 182

Query: 332 EVFLNYEEALRYYLESLRDNPGFQPAL 358
           E+    E+A      +  D       L
Sbjct: 183 EIQNAPEQACHLAKTAFDDAIAELDTL 209


>3dssA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 313

 Score = 41.6 bits (96), Expect = 6e-06
 Identities = 33/316 (10%), Positives = 62/316 (19%), Gaps = 67/316 (21%)

Query: 218 ERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYAD 277
           E+         Q                + +     +G      L++  Q L   P++A 
Sbjct: 1   EQAEAKRLEREQKLKLY-------QSATQAVFQKRQAGELDESVLELTSQILGANPDFAT 53

Query: 278 LHYYGGLSLLQLKHYHKAVELFLQAVALPEQPP--------------------------- 310
           L       L  L+      E      A                                 
Sbjct: 54  LWNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPN 113

Query: 311 --------QYASFAGVRGFRSLYHLGEI-AEVFLNYEEALRYYLESLRDNPGFQPALERI 361
                        A  R F    +   + A+  +   E L +    +  N     +    
Sbjct: 114 WARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYR 173

Query: 362 IKILK--------PRENPEYTRECLEKVLDFSSPQAT---------LILSNIFFQQGAYK 404
             +L         P        E ++          +            S          
Sbjct: 174 SCLLPQLHPQPRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKS 233

Query: 405 LTLEF-------LERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLA 457
             L+        L+ L          +      L       E L+  +   A   +    
Sbjct: 234 TVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAY 293

Query: 458 KFNQILCFWVQGKKRK 473
             +    F ++    K
Sbjct: 294 LDDLRSKFLLENSVLK 309



 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 13/73 (17%), Positives = 21/73 (28%)

Query: 564 YYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQS 623
             E   EL +   E         LL      L    E   ++     +DP +  Y     
Sbjct: 239 ELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLR 298

Query: 624 KLYEDRSEKIKGE 636
             +   +  +K E
Sbjct: 299 SKFLLENSVLKME 311



 Score = 37.8 bits (86), Expect = 9e-05
 Identities = 4/55 (7%), Positives = 14/55 (25%), Gaps = 2/55 (3%)

Query: 565 YEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
            E      ++ ++  Q   A   + +  +               +  +P     +
Sbjct: 3   AEAKRLEREQKLKLYQ--SATQAVFQKRQAGELDESVLELTSQILGANPDFATLW 55



 Score = 37.8 bits (86), Expect = 9e-05
 Identities = 10/117 (8%), Positives = 21/117 (17%), Gaps = 7/117 (5%)

Query: 185 KKNRNLHIIQKEMVENPGNYLLK----YHYGVELYRAERYGEAAEVLIQAANNTDSSTIY 240
           +         +         L          VE     +    +   +Q     +     
Sbjct: 199 QNAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKSTVLQSELESCKELQELEPENKW--- 255

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVE 297
               +  ++ A        + L        + P  A          L      K   
Sbjct: 256 CLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEY 312


>2bugA [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
          Length = 131

 Score = 41.1 bits (95), Expect = 9e-06
 Identities = 15/137 (10%), Positives = 28/137 (20%), Gaps = 13/137 (9%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
                  A+          + K Y  A++ + QA+ L      Y             +  
Sbjct: 5   ADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIY-----------YGNRS 53

Query: 329 EIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL--DFSS 386
                   Y  AL     ++  +  +     R                  E V+      
Sbjct: 54  LAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHD 113

Query: 387 PQATLILSNIFFQQGAY 403
             A +            
Sbjct: 114 KDAKMKYQECNKIVKQK 130



 Score = 36.8 bits (84), Expect = 2e-04
 Identities = 19/139 (13%), Positives = 37/139 (26%), Gaps = 10/139 (7%)

Query: 194 QKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYH 253
                              + ++A+ Y  A +   QA                   LAY 
Sbjct: 2   DPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNP----SNAIYYGNRSLAYL 57

Query: 254 SGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQY 312
                  AL+   + ++L   Y   +Y    S + L  +  A+  +   V + P      
Sbjct: 58  RTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAK 117

Query: 313 ASFAGVRGFRSLYHLGEIA 331
             +           + + A
Sbjct: 118 MKYQ-----ECNKIVKQKA 131


>3ck7B [x.x.x] SUSD
          Length = 497

 Score = 41.0 bits (94), Expect = 1e-05
 Identities = 21/380 (5%), Positives = 75/380 (19%), Gaps = 22/380 (5%)

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVR 319
             +             +   +Y            + +  + +   +P      +      
Sbjct: 7   VFVKGYAMLGVTDEGESG--FYRTTFNCNELPTDECLWAWQKNQDIP---QLTSISWSPS 61

Query: 320 GFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIK--ILKPRENPEYTREC 377
             R+ +    +      Y   L             Q A  R ++        +       
Sbjct: 62  SQRTEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRALHYWYFLDLFGKAPF 121

Query: 378 LEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRF 437
            E   +    +               +  L  +E  +     +      K+   +   R 
Sbjct: 122 KEHFSNDLPVEKK-----GTELYTYIQNELNEIEADMYEPRQAPFGRADKAANWLLRARL 176

Query: 438 LEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLL 497
                +    T  +     A       + +     ++     +       E    I +  
Sbjct: 177 YLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEIILPIRQDG 236

Query: 498 LRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLD--- 554
           ++++      + +   + A    +        +     + + F                 
Sbjct: 237 VKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVEIP 296

Query: 555 ------IIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRY 607
                   ++      +    E + +    +     +         +             
Sbjct: 297 TKGLDTDEQIDAFDAEHGIRTEDMIKAAGDDRALLYSGVGGGRRKIQTDAISGFTDGLSI 356

Query: 608 AIELDPSQPRYYISQSKLYE 627
               +       +S +   +
Sbjct: 357 VKWQNYRSDGKPVSHATYPD 376


>3ceqA [x.x.x] KINESIN LIGHT CHAIN 2
          Length = 250

 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 19/179 (10%), Positives = 46/179 (25%), Gaps = 13/179 (7%)

Query: 245 LRYIVLAYHSGGQPAKALDVIRQGLQLFP--------NYADLHYYGGLSLLQLKHYHKAV 296
           L  + + Y   G+  +A  + ++ L++          + A       L         +  
Sbjct: 75  LNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVE 134

Query: 297 ELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQP 356
             + +A+ +                ++  +L         Y++A   Y E L      + 
Sbjct: 135 YYYRRALEIYATRLGPDDP---NVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEF 191

Query: 357 ALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIR 415
                          E            +       L  ++ +QG  +      +   R
Sbjct: 192 GSVNGDNKPIWMHAEEREESKAC--KSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASR 248


>2avpA [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
          Length = 68

 Score = 40.0 bits (93), Expect = 2e-05
 Identities = 15/63 (23%), Positives = 32/63 (50%)

Query: 243 KLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQA 302
           +    +  AY+  G   +A++  ++ L+L P  A+  Y  G +  +   Y +A+E + +A
Sbjct: 2   EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61

Query: 303 VAL 305
           + L
Sbjct: 62  LEL 64



 Score = 38.8 bits (90), Expect = 4e-05
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
            Y++ G Y++ +E  Q+ +E + ++ EA + L   + + GD+ EA  +Y+ A+ELDP
Sbjct: 10  AYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDP 66



 Score = 34.6 bits (79), Expect = 8e-04
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 276 ADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFL 335
           A+  Y  G +  +   Y +A+E + +A+ L  +  +             Y+LG       
Sbjct: 1   AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEA-----------WYNLGNAYYKQG 49

Query: 336 NYEEALRYYLESLRDNP 352
           +Y+EA+ YY ++L  +P
Sbjct: 50  DYDEAIEYYQKALELDP 66


>2d4cD [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
          Length = 217

 Score = 39.9 bits (92), Expect = 2e-05
 Identities = 16/208 (7%), Positives = 54/208 (25%), Gaps = 13/208 (6%)

Query: 246 RYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
            +  +           ++++ + ++             +         +A+  F + +  
Sbjct: 21  DFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMYPQAEALLAEAMLKFGRELGD 80

Query: 306 PEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKIL 365
                             L  +GE        +++L   ++    +P      + + +I 
Sbjct: 81  DCNFGPA-----------LGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQ 129

Query: 366 KPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILF 425
              ++     E      D    +    L      +   + ++  L  +     S    L 
Sbjct: 130 SALQHHLKKLEGRRLDFDIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALV 189

Query: 426 RKSFCLIQE--RRFLEALRILNEYTADS 451
           +      ++  +   +    L E    +
Sbjct: 190 QAQLEYHKQAVQILQQVTVRLEERIRQA 217



 Score = 37.6 bits (86), Expect = 1e-04
 Identities = 8/71 (11%), Positives = 19/71 (26%), Gaps = 1/71 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQN-GEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
                      +E++ + IE  Q    +   L+   +      EA   +   +  D +  
Sbjct: 26  ERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMYPQAEALLAEAMLKFGRELGDDCNFG 85

Query: 617 RYYISQSKLYE 627
                  +   
Sbjct: 86  PALGEVGEAMR 96


>3edtH [x.x.x] KINESIN LIGHT CHAIN 2
          Length = 254

 Score = 39.9 bits (92), Expect = 2e-05
 Identities = 29/232 (12%), Positives = 64/232 (27%), Gaps = 18/232 (7%)

Query: 199 ENPGNYLLKYHYGVELYRAERYGEAAEVLIQ----AANNTDSSTIYFPKLLRYIVLAYHS 254
           ++P    +     +      +Y EAA +L                     L  + + Y  
Sbjct: 24  DHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGK 83

Query: 255 GGQPAKALDVIRQGLQLFPNYADLHYYGGLSLL--------QLKHYHKAVELFLQAVALP 306
            G+  +A  + ++ L++        +      L              +    + +A+ + 
Sbjct: 84  RGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIY 143

Query: 307 EQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKI-- 364
                          ++  +L         Y++A   Y E L      +        I  
Sbjct: 144 ATRLGPDDPNVA---KTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSGDNKPIWM 200

Query: 365 -LKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIR 415
             + RE  +  R    KV   +       L  ++ +QG  +      +   R
Sbjct: 201 HAEEREESKDKRRDACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASR 252



 Score = 37.2 bits (85), Expect = 1e-04
 Identities = 33/272 (12%), Positives = 74/272 (27%), Gaps = 39/272 (14%)

Query: 218 ERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYAD 277
               +A E L + + +           L  + L Y    +  +A  ++   L +      
Sbjct: 8   PLCKQALEDLEKTSGHDHPDVATM---LNILALVYRDQNKYKEAAHLLNDALAIREKTLG 64

Query: 278 LHYYG--------GLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGE 329
             +           +   +   Y +A  L  +A+ + E+             + L +L  
Sbjct: 65  KDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFH---PDVAKQLNNLAL 121

Query: 330 IAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQA 389
           + +     EE   YY  +L            I       ++P   +              
Sbjct: 122 LCQNQGKAEEVEYYYRRAL-----------EIYATRLGPDDPNVAKTKNNL--------- 161

Query: 390 TLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLI-QERRFLEALRILNEYT 448
               ++ + +QG Y+      + ++   +             +  E R     +  +   
Sbjct: 162 ----ASCYLKQGKYQDAETLYKEILTRAHEKEFGSGDNKPIWMHAEEREESKDKRRDACK 217

Query: 449 ADSYIYPLAKFNQILCFWVQGKKRKVRSLVQE 480
            DS        +    +  QGK     +L   
Sbjct: 218 VDSPTVNTTLRSLGALYRRQGKLEAAHTLEDC 249



 Score = 36.1 bits (82), Expect = 3e-04
 Identities = 23/211 (10%), Positives = 54/211 (25%), Gaps = 24/211 (11%)

Query: 434 ERRFLEALRILNE-YTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTES 492
                +AL  L +    D            L +  Q K ++   L+ +   +        
Sbjct: 7   VPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIRE------ 60

Query: 493 ILRLLLRSQEKRKYVHRIFLGKDAVTL--LLDIVGRLLYLSELTRVEELFSRVDPKCLGD 550
                 ++  K        L   AV                    + E         +  
Sbjct: 61  ------KTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAK 114

Query: 551 RMLDIIRLYHEHGYYEKTVELLQEYIEANQ---------NGEAHFLLAETHRELGDFIEA 601
           ++ ++  L    G  E+     +  +E              +    LA  + + G + +A
Sbjct: 115 QLNNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDA 174

Query: 602 DHHYRYAIELDPSQPRYYISQSKLYEDRSEK 632
           +  Y+  +     +         ++    E+
Sbjct: 175 ETLYKEILTRAHEKEFGSGDNKPIWMHAEER 205



 Score = 35.3 bits (80), Expect = 5e-04
 Identities = 25/237 (10%), Positives = 74/237 (31%), Gaps = 22/237 (9%)

Query: 289 LKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESL 348
           +    +A+E   +        P  A+   +          +  E      +AL    ++L
Sbjct: 7   VPLCKQALEDLEK--TSGHDHPDVATMLNILA-LVYRDQNKYKEAAHLLNDALAIREKTL 63

Query: 349 R-DNPGFQPALERIIKILKPRENPEYTRECLEKVLD-------FSSPQATLILSNIFF-- 398
             D+P     L  +  +   R   +      ++ L+          P     L+N+    
Sbjct: 64  GKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLC 123

Query: 399 -QQGAYKLTLEFLERLIRMGN--------SSAEILFRKSFCLIQERRFLEALRILNEYTA 449
             QG  +    +  R + +          + A+     + C +++ ++ +A  +  E   
Sbjct: 124 QNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILT 183

Query: 450 DSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKY 506
            ++       +    +    ++ + +   ++   ++      ++  L    + + K 
Sbjct: 184 RAHEKEFGSGDNKPIWMHAEEREESKDKRRDACKVDSPTVNTTLRSLGALYRRQGKL 240


>2axvA [x.x.x] PRGX
          Length = 302

 Score = 39.8 bits (91), Expect = 2e-05
 Identities = 6/117 (5%), Positives = 22/117 (18%), Gaps = 16/117 (13%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLH------YYGGLSLLQLKHYHK 294
             K    I +   +  +    ++       +     + +      Y   +          
Sbjct: 192 VLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNID 251

Query: 295 AVELFLQAVALPEQ--PPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLR 349
           +    +  + + +                RSL            +       +    
Sbjct: 252 SYLNAVNIINIFKIIGKEDIH--------RSLVEELTKISAKEKFTPPKEVTMYYEN 300


>3dsxA [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
          Length = 316

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 14/90 (15%), Positives = 24/90 (26%), Gaps = 3/90 (3%)

Query: 547 CLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYR 606
                +     L  E    ++  EL  E            LL      L    E   ++ 
Sbjct: 229 RCELSVEKSTVLQSELESCKELQELEPENKW---CLLTIILLMRALDPLLYEKETLQYFS 285

Query: 607 YAIELDPSQPRYYISQSKLYEDRSEKIKGE 636
               +DP +  Y       +   +  +K E
Sbjct: 286 TLKAVDPMRAAYLDDLRSKFLLENSVLKME 315



 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 4/48 (8%), Positives = 13/48 (27%), Gaps = 1/48 (2%)

Query: 557 RLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADH 603
           R      Y ++T++        +         L          ++ ++
Sbjct: 269 RALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEY 316



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 5/65 (7%), Positives = 18/65 (27%)

Query: 562 HGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYIS 621
           HG  +   + L+   +      A   + +  +               +  +P     +  
Sbjct: 2   HGRLKVEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNC 61

Query: 622 QSKLY 626
           + ++ 
Sbjct: 62  RREVL 66



 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 22/223 (9%), Positives = 48/223 (21%), Gaps = 44/223 (19%)

Query: 247 YIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQ--------LKHYHKAVEL 298
             +L+       A+ L++  + L+          Y      Q        L      +  
Sbjct: 107 CWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITR 166

Query: 299 --------FLQAVALPEQPPQ-------------YASFAGVRGFRSLYHLGEIAEVFLNY 337
                     ++  LP+  PQ                 A                +    
Sbjct: 167 NFSNYSSWHYRSCLLPQLHPQPRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGAG 226

Query: 338 EEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIF 397
                  +E          + + + ++                  +       ++L    
Sbjct: 227 SGRCELSVEKSTVLQSELESCKELQELEP---------------ENKWCLLTIILLMRAL 271

Query: 398 FQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEA 440
                 K TL++   L  +    A  L       + E   L+ 
Sbjct: 272 DPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKM 314


>1e96B [a.118.8] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,
          Length = 185

 Score = 39.5 bits (91), Expect = 3e-05
 Identities = 21/183 (11%), Positives = 46/183 (25%), Gaps = 28/183 (15%)

Query: 273 PNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-----------------PEQPPQYASF 315
              A   +  G+     K +  A++ F                         +  +  + 
Sbjct: 2   LVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTR 61

Query: 316 AGVRGFRSL---YHLGEIAEVFLNYEEALRYYLESLRDNPGFQP-ALERIIKILKPRENP 371
           +  R        +  G +      Y+ A++   E+L    G Q    + +    K     
Sbjct: 62  SINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACE 121

Query: 372 EYTRECLE--KVLDFSSPQATLILSN---IFFQQGAYKLTLEFLERLIRM--GNSSAEIL 424
                     K  ++   +  L L+       +       +E + +             L
Sbjct: 122 VLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKL 181

Query: 425 FRK 427
           FR 
Sbjct: 182 FRP 184



 Score = 39.1 bits (90), Expect = 4e-05
 Identities = 24/183 (13%), Positives = 54/183 (29%), Gaps = 14/183 (7%)

Query: 201 PGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAK 260
               +  ++ GV     + +  A +      +          ++   I   Y       +
Sbjct: 2   LVEAISLWNEGVLAADKKDWKGALDAFSAVQDP-------HSRICFNIGCMYTILKNMTE 54

Query: 261 ALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRG 320
           A     + +    + A  ++  G+   Q + Y  A++   +  AL +             
Sbjct: 55  AEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKE--ALIQLRGNQL-----ID 107

Query: 321 FRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEK 380
           ++ L    ++    + Y  A  Y  +        Q AL   +K        +   EC+ K
Sbjct: 108 YKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWK 167

Query: 381 VLD 383
              
Sbjct: 168 QKL 170


>2c08A [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
          Length = 196

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 10/95 (10%), Positives = 21/95 (22%), Gaps = 3/95 (3%)

Query: 211 GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQ 270
           G +L    +     +V  +A   T +              A               + L 
Sbjct: 2   GTKLDDDFKEERKVDVTSRAVEITKTIEYLQ---PNPASRAKPQAEALLAEALKFGRELG 58

Query: 271 LFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
              N+       G +    +      E+    +  
Sbjct: 59  DDCNFGPALGEVGEARELSEVKDSLDEVKQNFIDP 93



 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 19/191 (9%), Positives = 50/191 (26%), Gaps = 34/191 (17%)

Query: 190 LHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIV 249
           + +  + +        L+ +             A  +        D +   F   L  + 
Sbjct: 15  VDVTSRAVEITKTIEYLQPNPASRAKPQAEALLAEALKFGRELGDDCN---FGPALGEVG 71

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQL-------------------- 289
            A           +V +  +    N  D         L+                     
Sbjct: 72  EARELSEVKDSLDEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD 131

Query: 290 KHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLR 349
           +   +A+E F ++  + E                L  + +++++    +  L Y+ ++++
Sbjct: 132 EELRQALEKFDESKEIAESSFNL-----------LEDIEQVSQLSALVQAQLEYHKQAVQ 180

Query: 350 DNPGFQPALER 360
                   LE 
Sbjct: 181 ILQQVTVRLEE 191



 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 12/227 (5%), Positives = 44/227 (19%), Gaps = 42/227 (18%)

Query: 395 NIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFL-EALRILNEYTADSYI 453
                    +  ++   R + +  +   +    +     +   L            D   
Sbjct: 3   TKLDDDFKEERKVDVTSRAVEITKTIEYLQPNPASRAKPQAEALLAEALKFGRELGDDCN 62

Query: 454 YPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLG 513
           +  A         +   K  +  + Q                      +K     +    
Sbjct: 63  FGPALGEVGEARELSEVKDSLDEVKQNFIDPLQ------------NLHDKDLREIQHH-- 108

Query: 514 KDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQ 573
                                       +++ + L        +         + +E   
Sbjct: 109 --------------------------LKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFD 142

Query: 574 EYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
           E  E    +      + +  +          +++ A+++        
Sbjct: 143 ESKEIAESSFNLLEDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL 189


>2axuL [x.x.x] PRGX
          Length = 295

 Score = 38.7 bits (88), Expect = 5e-05
 Identities = 5/86 (5%), Positives = 17/86 (19%), Gaps = 10/86 (11%)

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQP--PQYASFAGVRGFR 322
           I+          +++Y   +          +    +  + + +                R
Sbjct: 216 IKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIH--------R 267

Query: 323 SLYHLGEIAEVFLNYEEALRYYLESL 348
           SL            +       +   
Sbjct: 268 SLVEELTKISAKEKFTPPKEVTMYYE 293


>3e6yB [x.x.x] 14-3-3-LIKE PROTEIN C
          Length = 232

 Score = 38.5 bits (88), Expect = 5e-05
 Identities = 21/211 (9%), Positives = 56/211 (26%), Gaps = 11/211 (5%)

Query: 419 SSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLV 478
           ++ E     +    Q  R+ E +  + + +       L    + L           R   
Sbjct: 3   TAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVAYKNVIGARRAS 62

Query: 479 QEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEE 538
             I +    ++        + S  + +      L K    +L  +  +L+  +     + 
Sbjct: 63  WRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKV 122

Query: 539 LFSRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQN----------GEAHFLL 588
            + ++        + +           E T+   +   +              G A    
Sbjct: 123 FYLKMKGDYH-RYLAEFKTGAERKEAAESTLTAYKAAQDIATTELAPTHPIRLGLALNFS 181

Query: 589 AETHRELGDFIEADHHYRYAIELDPSQPRYY 619
              +  L     A +  + A +   ++   Y
Sbjct: 182 VFYYEILNSPDRACNLAKQAFDEAIAEEESY 212


>2crbA [x.x.x] NUCLEAR RECEPTOR BINDING FACTOR 2
          Length = 97

 Score = 38.5 bits (89), Expect = 6e-05
 Identities = 11/96 (11%), Positives = 25/96 (26%), Gaps = 12/96 (12%)

Query: 266 RQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLY 325
             G++   N A         LL    Y +A+    +A     +  +              
Sbjct: 5   SSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKL------------T 52

Query: 326 HLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
              +         ++    L  +++        ER+
Sbjct: 53  ESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERL 88



 Score = 37.3 bits (86), Expect = 1e-04
 Identities = 6/70 (8%), Positives = 16/70 (22%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
                G YE+ +   ++               + H  L    ++       I+    + +
Sbjct: 24  RLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAK 83

Query: 618 YYISQSKLYE 627
                     
Sbjct: 84  REERLKAHSG 93



 Score = 36.2 bits (83), Expect = 3e-04
 Identities = 13/103 (12%), Positives = 22/103 (21%), Gaps = 12/103 (11%)

Query: 194 QKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYH 253
              M         +      L  A +Y EA     +A      +             A+ 
Sbjct: 5   SSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLT-----ESEQAHL 59

Query: 254 SGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAV 296
           S      +       +Q     A           +LK +    
Sbjct: 60  SLELQRDSHMKQLLLIQERWKRAKREE-------RLKAHSGPS 95


>2axuE [x.x.x] PRGX
          Length = 296

 Score = 38.3 bits (87), Expect = 6e-05
 Identities = 5/86 (5%), Positives = 17/86 (19%), Gaps = 10/86 (11%)

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQ--PPQYASFAGVRGFR 322
           I+          +++Y   +          +    +  + + +                R
Sbjct: 215 IKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIH--------R 266

Query: 323 SLYHLGEIAEVFLNYEEALRYYLESL 348
           SL            +       +   
Sbjct: 267 SLVEELTKISAKEKFTPPKEVTMYYE 292


>2e0zC [x.x.x] VIRUS-LIKE PARTICLE
          Length = 228

 Score = 38.0 bits (87), Expect = 8e-05
 Identities = 17/203 (8%), Positives = 44/203 (21%), Gaps = 32/203 (15%)

Query: 259 AKALDVIRQGLQLFPNYADLHYYGGLSLL-QLKHYHKAVELFLQAVALPEQPPQYASFAG 317
              ++  R  L+  P          + ++          + +     L ++         
Sbjct: 12  LDGVNKGRSLLKHLPVTRIEGQSFRVDIIKFEDGVRVVKQEYKPIPLLKKKFYVGIRELN 71

Query: 318 VRGFRSL-------------------------YHLGEIAEVFLNYEEALRYYLESLRDNP 352
              +                                     + N EEAL   + +L++  
Sbjct: 72  DGTYDVSIATKAGELLVKDEESLVIREILSTEGIKKMKLSSWDNPEEALNDLMNALQEAS 131

Query: 353 GFQPALERIIKILKPRENPEYTRECLEKVL----DFSSPQATLILSNIFFQQGAYKLTLE 408
                   +I   K         E L+++       +       +           + + 
Sbjct: 132 NASAGPFGLIINPKRYAKLLKIVEVLKEIFRGGIIVTLNIDENKVIIFANTPAVLDVVVG 191

Query: 409 FLERLIRMG--NSSAEILFRKSF 429
               L  +G        L  ++ 
Sbjct: 192 QDVTLQELGPEGDDVAFLVSEAI 214


>2c23A [x.x.x] 14-3-3 BETA/ALPHA
          Length = 225

 Score = 37.7 bits (86), Expect = 9e-05
 Identities = 9/197 (4%), Positives = 44/197 (22%), Gaps = 16/197 (8%)

Query: 245 LRYIVLAYHSGGQPAKALDVIRQGLQLFPNYA-DLHYYGGLSLLQLKHYHKAVELFLQAV 303
           L           +       ++   +     + +      ++   +    ++    + ++
Sbjct: 6   LVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSI 65

Query: 304 ALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQP----ALE 359
              ++      +             ++ E+   Y        ES       +      L 
Sbjct: 66  EQKKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLS 125

Query: 360 RIIKILKPRENPEYTRECLEKVLDFS-----------SPQATLILSNIFFQQGAYKLTLE 408
            +      +     +++  ++  + S              A       +    + +    
Sbjct: 126 EVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACS 185

Query: 409 FLERLIRMGNSSAEILF 425
             +       +  + L 
Sbjct: 186 LAKTAFDEAIAELDTLN 202



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 15/177 (8%), Positives = 40/177 (22%), Gaps = 7/177 (3%)

Query: 187 NRNLHIIQKEMVENPGNYLLKYHYGVELYRA-ERYGEAAEVLIQAANNTDSSTIYFPKLL 245
                   +   E      + Y   V   R+  R   + E   +     +       +L 
Sbjct: 27  KAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKKKQQMGKEYREKIEAELQ 86

Query: 246 RYIVLAYHSGGQPAKALDVIRQGLQLFPN----YADLHYYGGLSLLQLKHYHKAVELFLQ 301
                      +         +    +      Y            +      + + + +
Sbjct: 87  DICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQE 146

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPAL 358
           A  + ++  Q      +    +L       E+  + E+A      +  +       L
Sbjct: 147 AFEISKKEMQPTHPIRL--GLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL 201



 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 20/189 (10%), Positives = 45/189 (23%), Gaps = 16/189 (8%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
                   +AERY + A  +               +    + +AY +     ++   +  
Sbjct: 7   VQKAKLAEQAERYDDMAAAMKAVTEQGHE---LSNEERNLLSVAYKNVVGARRSSWRVIS 63

Query: 268 GLQL-----------FPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFA 316
            ++                A+L       L  L  Y        ++     +        
Sbjct: 64  SIEQKKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRY 123

Query: 317 GVRGFRSLYHLGEIAEVFLNYEEALRYYLESL--RDNPGFQPALERIIKILKPRENPEYT 374
                        ++     Y+EA     + +          AL   +   +   +PE  
Sbjct: 124 LSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKA 183

Query: 375 RECLEKVLD 383
               +   D
Sbjct: 184 CSLAKTAFD 192


>3efzD [x.x.x] 14-3-3 PROTEIN
          Length = 214

 Score = 37.2 bits (85), Expect = 1e-04
 Identities = 9/88 (10%), Positives = 28/88 (31%)

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSL 324
               ++L  +             + +   +AVE +  A+       +      +     L
Sbjct: 105 RAFCIKLKGDLMRYKAEILKDEEKNQCIKQAVEFYEDALQRERSFLEKYPSDPLYLATIL 164

Query: 325 YHLGEIAEVFLNYEEALRYYLESLRDNP 352
            +     ++  N E A+++   +++   
Sbjct: 165 NYTILKYDLLGNPEGAMKFANRAIQAAE 192


>2c0lA [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
          Length = 292

 Score = 36.6 bits (82), Expect = 2e-04
 Identities = 11/90 (12%), Positives = 24/90 (26%)

Query: 545 PKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHH 604
           P            L + +   E      +          + + L  +   LG   EA  H
Sbjct: 172 PNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEH 231

Query: 605 YRYAIELDPSQPRYYISQSKLYEDRSEKIK 634
           +  A+ +             + E+    ++
Sbjct: 232 FLEALNMQRKSRGPRGEGGAMSENIWSTLR 261



 Score = 36.2 bits (81), Expect = 3e-04
 Identities = 16/121 (13%), Positives = 33/121 (27%), Gaps = 4/121 (3%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
              + ++ +      +   P +YLL    G  L    +  EA     +A           
Sbjct: 153 LSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSR 212

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
             L      +  + G   +A++   + L +          GG     +    +     L 
Sbjct: 213 YNLGI----SCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLG 268

Query: 302 A 302
            
Sbjct: 269 Q 269


>2bq0B [x.x.x] 14-3-3 BETA/ALPHA
          Length = 231

 Score = 36.5 bits (83), Expect = 2e-04
 Identities = 22/210 (10%), Positives = 57/210 (27%), Gaps = 15/210 (7%)

Query: 420 SAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQ 479
               L +K+    Q  R+ +    +   T   +     + N +   +      +  S   
Sbjct: 2   DKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRV 61

Query: 480 EIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEEL 539
                +  E  E   ++    +EK +   +         L      + L  +      ++
Sbjct: 62  ISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELL-----DKYLIPNATQPESKV 116

Query: 540 FSRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQN----------GEAHFLLA 589
           F           + ++    ++      + +  QE  E ++           G A     
Sbjct: 117 FYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSV 176

Query: 590 ETHRELGDFIEADHHYRYAIELDPSQPRYY 619
             +  L    +A    + A +   ++    
Sbjct: 177 FYYEILNSPEKACSLAKTAFDEAIAELDTL 206


>2axzB [x.x.x] PRGX
          Length = 299

 Score = 36.3 bits (82), Expect = 2e-04
 Identities = 7/173 (4%), Positives = 36/173 (20%), Gaps = 11/173 (6%)

Query: 138 QYRFRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEM 197
                              + +    +   +       +       D   ++  +  + +
Sbjct: 130 TITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPYPIVDSFGKDYDLTIQTV 189

Query: 198 VENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQ 257
           ++N     +  +     Y   ++     +   + N       Y  ++     +      +
Sbjct: 190 LKNALTISINRNLKEAQYYINQFEHLKTIKNISINGY-----YDLEINYLKQIYQFLTDK 244

Query: 258 PAKALDVIRQGLQLFPNYADLHYYG------GLSLLQLKHYHKAVELFLQAVA 304
              +       + +F        +            + K        + +   
Sbjct: 245 NIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTYYENYV 297


>2b05E [x.x.x] 14-3-3 PROTEIN GAMMA
          Length = 231

 Score = 36.3 bits (82), Expect = 3e-04
 Identities = 10/89 (11%), Positives = 26/89 (29%), Gaps = 2/89 (2%)

Query: 270 QLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGE 329
           ++  +Y            +      + + + +A  + ++  Q       R   +L +   
Sbjct: 122 KMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPI--RLGLALNYSVF 179

Query: 330 IAEVFLNYEEALRYYLESLRDNPGFQPAL 358
             E+    E+A      +  D       L
Sbjct: 180 YYEIQNAPEQACHLAKTAFDDAIAELDTL 208


>2aw6B [x.x.x] PRGX
          Length = 286

 Score = 35.9 bits (81), Expect = 3e-04
 Identities = 10/114 (8%), Positives = 21/114 (18%), Gaps = 16/114 (14%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
                          +    LK     +  F     +                   Y   
Sbjct: 187 DLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDL-----EINYLKQ 241

Query: 329 EIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL 382
               +     ++    +  +            I KI+   +      E L K+ 
Sbjct: 242 IYQFLTDKNIDSYLNAVNII-----------NIFKIIGKEDIHRSLVEELTKIS 284



 Score = 35.1 bits (79), Expect = 6e-04
 Identities = 6/67 (8%), Positives = 16/67 (23%), Gaps = 7/67 (10%)

Query: 552 MLDIIRLYHEHGYYEKTVELLQEYIEANQN-------GEAHFLLAETHRELGDFIEADHH 604
            L I  +       +  +   +                E ++L           I++  +
Sbjct: 197 ALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLN 256

Query: 605 YRYAIEL 611
               I +
Sbjct: 257 AVNIINI 263


>2bq0A [x.x.x] 14-3-3 BETA/ALPHA
          Length = 230

 Score = 35.5 bits (80), Expect = 5e-04
 Identities = 11/113 (9%), Positives = 31/113 (27%), Gaps = 2/113 (1%)

Query: 246 RYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
             + L        A   +     L++  +Y            +      + + + +A  +
Sbjct: 96  DVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEI 155

Query: 306 PEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPAL 358
            ++  Q      +    +L       E+  + E+A      +  +       L
Sbjct: 156 SKKEMQPTHPIRLG--LALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL 206


>2axuB [x.x.x] PRGX
          Length = 296

 Score = 35.2 bits (79), Expect = 5e-04
 Identities = 4/110 (3%), Positives = 21/110 (19%), Gaps = 16/110 (14%)

Query: 247 YIVLAYHSGGQPAKALDVIRQGLQLF------PNYADLHYYGGLSLLQLKHYHKAVELFL 300
             +    +  +    ++       +           +++Y   +          +    +
Sbjct: 192 LTISINRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAV 251

Query: 301 QAVALPEQP--PQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESL 348
             + + +                RSL            +       +   
Sbjct: 252 NIINIFKIIGKEDIH--------RSLVEELTKISAKEKFTPPKEVTMYYE 293


>3efzC [x.x.x] 14-3-3 PROTEIN
          Length = 213

 Score = 35.1 bits (80), Expect = 6e-04
 Identities = 13/141 (9%), Positives = 37/141 (26%), Gaps = 15/141 (10%)

Query: 218 ERYGEAAEVLIQAANNT----DSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGL---- 269
            +        IQ   +     + S +   + +  I+           A     +      
Sbjct: 43  RKEKSLNNEFIQVIEDIKRDFEESILLESEDVIRIIDDNLLMYSEEGARAFCIKLKGDLM 102

Query: 270 QLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGE 329
           +                  ++ Y  A++     +      P Y +         L +   
Sbjct: 103 RYKAEILKDEEKNQCIKQAVEFYEDALQRERSFLEKYPSDPLYLATI-------LNYTIL 155

Query: 330 IAEVFLNYEEALRYYLESLRD 350
             ++  N E A+++   +++ 
Sbjct: 156 KYDLLGNPEGAMKFANRAIQA 176


>2c1nA [x.x.x] 14-3-3 PROTEIN ZETA/DELTA
          Length = 225

 Score = 34.7 bits (79), Expect = 8e-04
 Identities = 9/72 (12%), Positives = 23/72 (31%), Gaps = 2/72 (2%)

Query: 557 RLYHEHGYYEKTVELLQEYIEANQ--NGEAHFLLAETHRELGDFIEADHHYRYAIELDPS 614
           +L  +   Y+     ++   E     + E   LL+  ++ +     +      +IE    
Sbjct: 11  KLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE 70

Query: 615 QPRYYISQSKLY 626
                   ++ Y
Sbjct: 71  GAEKKQQMAREY 82


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0586    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 38,074,234
Number of extensions: 2473763
Number of successful extensions: 30046
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 12780
Number of HSP's successfully gapped: 1734
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)