RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABO50272.1 dred0 ABO50272.1 GIB00494CH01 "Radical SAM domain
protein"
         (198 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cixA [x.x.x] FEFE-HYDROGENASE MATURASE                                54   3e-10
3ciwA [x.x.x] FEFE-HYDROGENASE MATURASE                                45   2e-07
2a5hA [x.x.x] L-LYSINE 2,3-AMINOMUTASE                                 43   7e-07
3c8fA [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME               42   1e-06
2bw2A [x.x.x] BYPASS OF FORESPORE C                                    39   1e-05
3chvA [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)          38   2e-05
3cl4A [x.x.x] HEMAGGLUTININ-ESTERASE                                   36   8e-05
2a5hB [x.x.x] L-LYSINE 2,3-AMINOMUTASE                                 36   8e-05
3bz6A [x.x.x] UPF0502 PROTEIN PSPTO_2686                               35   2e-04
3cl5A [x.x.x] HEMAGGLUTININ-ESTERASE                                   34   4e-04
3bg3A [x.x.x] PYRUVATE CARBOXYLASE, MITOCHONDRIAL                      34   5e-04
3cb8A [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME               34   5e-04
3e65A [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE                         34   5e-04

>3cixA [x.x.x] FEFE-HYDROGENASE MATURASE
          Length = 345

 Score = 54.3 bits (129), Expect = 3e-10
 Identities = 23/172 (13%), Positives = 52/172 (30%), Gaps = 11/172 (6%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
              +  +N C   C++C    +        +  E  VE    +V+       IV     +
Sbjct: 53  RAIIEFSNVCRKNCLYCGLRRDNKNLKRYRMTPEEIVERARLAVQFG--AKTIVLQSGED 110

Query: 74  PLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNAT 133
           P    +V+  +  ++K+MG  ++ ++       +             D   +     N  
Sbjct: 111 PYYMPDVISDIVKEIKKMG-VAVTLSLGE----WPREYYEKWKEAGADRYLLRHETANPV 165

Query: 134 VYTEICRPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQ 185
           ++ ++         + + L               S+V  PG  I+       
Sbjct: 166 LHRKLRPDTS----FENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLL 213


>3ciwA [x.x.x] FEFE-HYDROGENASE MATURASE
          Length = 344

 Score = 44.7 bits (104), Expect = 2e-07
 Identities = 21/172 (12%), Positives = 48/172 (27%), Gaps = 12/172 (6%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
              +  +N C   C++C    +        +  E  + E         +  + +    GE
Sbjct: 54  RAIIEFSNVCRKNCLYCGLRRDNKNLKRYRMTPE-EIVERARLAVQFGA--KTIVLQSGE 110

Query: 74  PLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNAT 133
                +V+  +  ++K+MG              Y             D   +     N  
Sbjct: 111 DPYMPDVISDIVKEIKKMGVAVTLSLGEWPREYYEKWK-----EAGADRYLLRHETANPV 165

Query: 134 VYTEICRPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQ 185
           ++ ++      + ++ + L               S+V  PG  I+       
Sbjct: 166 LHRKLRP----DTSFENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLL 213


>2a5hA [x.x.x] L-LYSINE 2,3-AMINOMUTASE
          Length = 400

 Score = 43.0 bits (100), Expect = 7e-07
 Identities = 15/90 (16%), Positives = 32/90 (35%), Gaps = 5/90 (5%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
              + +     + C  C R    G       + E   + +      PQ   +++  G   
Sbjct: 111 PDRVLLLITDCSYCRHCTRRRFAG---QSDDSPERIDKAIDYIRNTPQ-VRDVLLSGGDA 166

Query: 74  PLSRLEVVKGVASKLKEMGA-RSIRINTNG 102
            L   E ++ + +KL+E+     +RI +  
Sbjct: 167 LLVSDETLEYIIAKLREIPHVEIVRIGSRT 196


>3c8fA [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
          Length = 245

 Score = 42.0 bits (97), Expect = 1e-06
 Identities = 23/149 (15%), Positives = 46/149 (30%), Gaps = 4/149 (2%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
             ++     C+ +C++C             +  E  ++EV+       +    V    GE
Sbjct: 20  IRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGE 79

Query: 74  PLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNAT 133
            + + E V+      K+ G  +                +I EL  + D + + L   N  
Sbjct: 80  AILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDP---VIDELLEVTDLVMLDLKQMNDE 136

Query: 134 VYTEICRPADGENAYFSMLEFARKCVGVI 162
           ++ +                 A K V V 
Sbjct: 137 IH-QNLVGVSNHRTLEFAKYLANKNVKVW 164


>2bw2A [x.x.x] BYPASS OF FORESPORE C
          Length = 140

 Score = 38.8 bits (89), Expect = 1e-05
 Identities = 11/142 (7%), Positives = 30/142 (21%), Gaps = 11/142 (7%)

Query: 19  ITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFC-GYGEPLSR 77
           + +    Q    + +           + E   E+V        +Y            +  
Sbjct: 3   VEHYEPLQVHVQLEKVYLDGDV----SIEHKHEKVFSMDDFWAAYAGWTLVEQKKGYVLF 58

Query: 78  LEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGL-IDTMSISLNAQNATVYT 136
            + +  ++   K  G   +  N          H      +        I L    + +  
Sbjct: 59  RKQMDDISPLSKVNGYIGVSDNGVI----STFHGRPEPASEPIQSFFQIDLERLESHMQK 114

Query: 137 EICRPADGENAYFSMLEFARKC 158
            + +            +     
Sbjct: 115 NLLKGI-PFRTKAEFEDVIEHM 135


>3chvA [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)
          Length = 270

 Score = 38.1 bits (87), Expect = 2e-05
 Identities = 17/157 (10%), Positives = 39/157 (24%), Gaps = 15/157 (9%)

Query: 20  TNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKN-PQSYNEIVFCGYGEPLSR- 77
              C+                 + +    TV E ++S +   ++   I  C         
Sbjct: 2   NKPCIICVAITGSVPTKADNPAVPI----TVSEQVESTQEAFEAGAAIAHCHVRNDDGTP 57

Query: 78  ---LEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATV 134
               +    +   L       ++ +T G++        +P       ++S+  N   + V
Sbjct: 58  SSDPDRFARLTEGLHTHCPGIVQFSTGGRSGAGQARGGLPLK--PDASLSVGSNNFPSRV 115

Query: 135 YTEICRPADGENAYFSMLE-FARKCVGVIPRVILSVV 170
           Y       D   A            +       +   
Sbjct: 116 YENPPDLVDWLAA---QRSYRVTPEIEAFDLSHILRA 149


>3cl4A [x.x.x] HEMAGGLUTININ-ESTERASE
          Length = 358

 Score = 36.3 bits (82), Expect = 8e-05
 Identities = 15/142 (10%), Positives = 33/142 (23%), Gaps = 23/142 (16%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNE-------I 66
                IT      C + +  +              + E +L         N+        
Sbjct: 218 NSTETITTGFDFNCHYLVLPSGNY--------LAISNELLLTVPTKAICLNKRKDFTPVQ 269

Query: 67  VFCGYGEPLSRLEVVKGVASKLKEMGARSIRINTNGQAN-KYYGHNIIPELAGLIDT--- 122
           V         + + +  VA +      R+   N  G  +  +        L+GL+     
Sbjct: 270 VVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYDSPC 329

Query: 123 ----MSISLNAQNATVYTEICR 140
                    +  ++        
Sbjct: 330 FSQQGVFRYDNVSSVWPLYSYG 351


>2a5hB [x.x.x] L-LYSINE 2,3-AMINOMUTASE
          Length = 401

 Score = 36.2 bits (82), Expect = 8e-05
 Identities = 22/162 (13%), Positives = 42/162 (25%), Gaps = 15/162 (9%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
              + +     + C  C R    G       + E   + +      PQ   +++  G   
Sbjct: 111 PDRVLLLITDCSYCRHCTRRRFAG---QSDDSPERIDKAIDYIRNTPQ-VRDVLLSGGDA 166

Query: 74  PLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNAT 133
            L   E ++ + +KL+E+      +    +        I PEL  L     +        
Sbjct: 167 LLVSDETLEYIIAKLREIP-HVEIVRIGSRTPVVLPQRITPELVNLKKYHPV------WL 219

Query: 134 VYTEICRPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGV 175
                      E          +        +    V   GV
Sbjct: 220 NTHFNHPNEITEE----STRACQLLADAGVPLGNQSVLLRGV 257


>3bz6A [x.x.x] UPF0502 PROTEIN PSPTO_2686
          Length = 164

 Score = 35.2 bits (80), Expect = 2e-04
 Identities = 11/136 (8%), Positives = 28/136 (20%), Gaps = 12/136 (8%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
           T             + C ++T         L +    + +            +V      
Sbjct: 24  TNPETYPLTLNALVIACNQKTSRDPV---NLTQGQVGQSLRALEGRG--LTRLVGSRADR 78

Query: 74  PLSR----LEVVKGVASKLKEMGARSIRINTNGQANKYYGH-NIIPEL-AGLIDTMSISL 127
              +    LE+V         +  R  +  +               ++   L   ++  L
Sbjct: 79  WEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRHDFEDSEQVVHQLERLIARGL 138

Query: 128 NAQNATVYTEICRPAD 143
                   +       
Sbjct: 139 ATLVP-RQSGQREDRY 153


>3cl5A [x.x.x] HEMAGGLUTININ-ESTERASE
          Length = 358

 Score = 33.8 bits (76), Expect = 4e-04
 Identities = 12/99 (12%), Positives = 24/99 (24%), Gaps = 15/99 (15%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNE-------I 66
                IT      C + +  +              + E +L         N+        
Sbjct: 218 NSTETITTGFDFNCHYLVLPSGNY--------LAISNELLLTVPTKAICLNKRKDFTPVQ 269

Query: 67  VFCGYGEPLSRLEVVKGVASKLKEMGARSIRINTNGQAN 105
           V         + + +  VA +      R+   N  G  +
Sbjct: 270 VVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYD 308


>3bg3A [x.x.x] PYRUVATE CARBOXYLASE, MITOCHONDRIAL
          Length = 679

 Score = 33.8 bits (76), Expect = 5e-04
 Identities = 10/69 (14%), Positives = 22/69 (31%), Gaps = 1/69 (1%)

Query: 63  YNEIVFCGYGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDT 122
           Y   V          L+   G+A +L   G   + I+  G         ++  L      
Sbjct: 213 YTGDVADPS-RTKYSLQYYMGLAEELVRAGTHILCIDMAGLLKPTACTMLVSSLRDRFPD 271

Query: 123 MSISLNAQN 131
           + + ++  +
Sbjct: 272 LPLHIHTHD 280


>3cb8A [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
          Length = 244

 Score = 33.6 bits (75), Expect = 5e-04
 Identities = 13/89 (14%), Positives = 29/89 (32%)

Query: 14  TLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGE 73
             ++     C+ +C++C             +  E  ++EV+       +    V    GE
Sbjct: 19  IRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGE 78

Query: 74  PLSRLEVVKGVASKLKEMGARSIRINTNG 102
            + + E V+      K+ G  +       
Sbjct: 79  AILQAEFVRDWFRACKKEGIHTCLDTNGF 107


>3e65A [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
          Length = 417

 Score = 33.5 bits (76), Expect = 5e-04
 Identities = 21/185 (11%), Positives = 41/185 (22%), Gaps = 10/185 (5%)

Query: 16  YLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNP--QSYNEIVFCGYGE 73
            L+                   +      +K   +EE+L        Q Y         E
Sbjct: 17  TLHHKATSDFTSCLGSIMNPKSLTRG-PRDKPTPLEELLPHAIEFINQYYGSFKEAKIEE 75

Query: 74  PLSRL-EVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNA 132
            L+RL  V K + +           I     A +     I       +        +   
Sbjct: 76  HLARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQ 135

Query: 133 TVYTEIC------RPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQN 186
            ++  IC             +  ++                 ++ + G  +         
Sbjct: 136 EMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDA 195

Query: 187 LGTEF 191
              EF
Sbjct: 196 ATLEF 200


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.140    0.404 

Gapped
Lambda     K      H
   0.267   0.0614    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 26,093,787
Number of extensions: 1651243
Number of successful extensions: 19067
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7704
Number of HSP's successfully gapped: 909
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)