RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABO50761.1 dred0 ABO50761.1 GIB00494CH01 "type III
restriction-modification system methyla.."
         (227 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1booA [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE        52   1e-09

>1booA [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE
          Length = 282

 Score = 52.5 bits (124), Expect = 1e-09
 Identities = 13/117 (11%), Positives = 34/117 (29%), Gaps = 27/117 (23%)

Query: 99  FDNTENLYIEGDNLDALKLLQETYLGKVKMIYIDPPYNTGNDFIYEDDFAQDADEYLANS 158
           +  +      GD+L+ L+   E     + ++   PP+       Y +    +  EY+   
Sbjct: 8   YTTSNGSMYIGDSLELLESFPEE---SISLVMTSPPFALQRKKEYGNL---EQHEYVD-- 59

Query: 159 GQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDNEVENL 215
                              +   +  ++  +LK     + + G  ++          
Sbjct: 60  -------------------WFLSFAKVVNKKLKPDGSFVVDFGGAYMKGVPARSIYN 97


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0385    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 25,550,961
Number of extensions: 1638423
Number of successful extensions: 16954
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7390
Number of HSP's successfully gapped: 172
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)