RPS-BLAST 2.2.16 [Mar-25-2007] Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002; 95pdb09Oct16_0003 66,450 sequences; 15,983,541 total letters Searching..................................................done Query= ABO50761.1 dred0 ABO50761.1 GIB00494CH01 "type III restriction-modification system methyla.." (227 letters) Score E Sequences producing significant alignments: (bits) Value 1booA [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE 52 1e-09 >1booA [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE Length = 282 Score = 52.5 bits (124), Expect = 1e-09 Identities = 13/117 (11%), Positives = 34/117 (29%), Gaps = 27/117 (23%) Query: 99 FDNTENLYIEGDNLDALKLLQETYLGKVKMIYIDPPYNTGNDFIYEDDFAQDADEYLANS 158 + + GD+L+ L+ E + ++ PP+ Y + + EY+ Sbjct: 8 YTTSNGSMYIGDSLELLESFPEE---SISLVMTSPPFALQRKKEYGNL---EQHEYVD-- 59 Query: 159 GQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDNEVENL 215 + + ++ +LK + + G ++ Sbjct: 60 -------------------WFLSFAKVVNKKLKPDGSFVVDFGGAYMKGVPARSIYN 97 Database: 95pdb09Oct16_0000 Posted date: Oct 27, 2009 4:27 PM Number of letters in database: 15,983,541 Number of sequences in database: 66,450 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0385 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 66450 Number of Hits to DB: 25,550,961 Number of extensions: 1638423 Number of successful extensions: 16954 Number of sequences better than 1.0e-03: 10 Number of HSP's gapped: 7390 Number of HSP's successfully gapped: 172 Length of database: 100,000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits)