RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABO50700.1 dred0 ABO50700.1 GIB00494CH01
"selenocysteine-specific translation elongation f.."
         (635 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00009 GTP_EFTU "Elongation factor Tu GTP binding domain"             94   2e-22
PF09107 SelB-wing_3 "Elongation factor SelB, winged helix "            58   1e-11
PF09106 SelB-wing_2 "Elongation factor SelB, winged helix "            44   2e-07
PF02421 FeoB_N "Ferrous iron transport protein B"                      37   2e-05
PF01926 MMR_HSR1 "GTPase of unknown function"                          37   2e-05

>PF00009 GTP_EFTU "Elongation factor Tu GTP binding domain"
          Length = 183

 Score = 94.0 bits (233), Expect = 2e-22
 Identities = 65/179 (36%), Positives = 93/179 (51%), Gaps = 19/179 (10%)

Query: 6   IGTAGHVDHGKTLLIKTL---TGMDT-----------DRLKEEKERGISIELGFAQLKLP 51
           IG  GHVDHGKT L   L   TG+             D+LK E+ERGI+I+      +  
Sbjct: 5   IGIIGHVDHGKTTLTDRLLYYTGIIDKRGIVKEAAVLDKLKAERERGITIDSAAWSFETK 64

Query: 52  SGKQAGIVDVPGHEKFIKNMLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGI 111
                 I+D PGH  FIK M+ G+   D  +LV+ A EGV PQT+EH+ +   L V   I
Sbjct: 65  K-YLINIIDTPGHVDFIKEMITGLSQADGAVLVVDAGEGVEPQTREHLLLAFTLGVPL-I 122

Query: 112 VVLTKIDMVDEEWLSLVTEEIREYLKDTV---LSEAPVVPVSSTTKQGIPQLLDLIDQF 167
           VV+ K+D  +E     + +E+ + L   +    +  PVVP+S+    G+  LL+ ID +
Sbjct: 123 VVVNKMDRTEEARFEEIKKEVSQSLLKKIGYNPAAVPVVPISALHGDGVLTLLEAIDAY 181


>PF09107 SelB-wing_3 "Elongation factor SelB, winged helix "
          Length = 50

 Score = 57.7 bits (139), Expect = 1e-11
 Identities = 29/47 (61%), Positives = 33/47 (70%)

Query: 588 EYLKENKEISVAQTRDLLKTSRKFTLPLLETMDRERLTRRVGDNRVL 634
           E L EN  I+VA+ RD L  SRK+ +PLLE  DRE  TRRVGD RVL
Sbjct: 3   ELLAENGPITVAEFRDALGLSRKYAIPLLEYFDREGFTRRVGDKRVL 49


>PF09106 SelB-wing_2 "Elongation factor SelB, winged helix "
          Length = 58

 Score = 43.8 bits (103), Expect = 2e-07
 Identities = 23/47 (48%), Positives = 30/47 (63%)

Query: 451 MVINYHREYPLREGYPKEELRSRKFPFINNKHFQYLLQAMEIDGLLK 497
           ++  YH E PLR G  KEELRSR    ++ K F  LL+A+  +GLLK
Sbjct: 4   LLAEYHEENPLRPGMDKEELRSRLALGLDPKLFDALLEALLAEGLLK 50


>PF02421 FeoB_N "Ferrous iron transport protein B"
          Length = 188

 Score = 37.4 bits (86), Expect = 2e-05
 Identities = 47/171 (27%), Positives = 80/171 (46%), Gaps = 15/171 (8%)

Query: 4   IIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPG 63
           + I   G+ + GKT L   LTG    R       G+++E    + KL  GKQ  +VD+PG
Sbjct: 1   LTIALVGNPNVGKTTLFNALTGA---RQHVGNWPGVTVEKKEGKFKL-GGKQVTLVDLPG 56

Query: 64  HEKFIKNMLAGVGGIDLVL-----LVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKID 118
                   L      D +L     ++I   +    +   ++ + QLL++  GI V+  ++
Sbjct: 57  TYSLSPYSLDEQVARDYLLEEKPDVIINVVDATNLERNLYLTL-QLLEL--GIPVVVALN 113

Query: 119 MVDEEWLSLVTEEIREYLKDTVLSEAPVVPVSSTTKQGIPQLLDLIDQFVD 169
           M+DE     +  +I++  K   L   PVVP S+   +GI +L + ID+  +
Sbjct: 114 MMDEAEKRGIKIDIKKLSK---LLGVPVVPTSARKGEGIDELKEAIDELAE 161


>PF01926 MMR_HSR1 "GTPase of unknown function"
          Length = 105

 Score = 37.4 bits (86), Expect = 2e-05
 Identities = 36/113 (31%), Positives = 51/113 (45%), Gaps = 19/113 (16%)

Query: 15  GKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKNMLAG 74
           GK+ L   LTG    R K     G + +     +++  G Q  +VD PG    IK    G
Sbjct: 1   GKSTLFNALTGRA--RAKVANYPGTTRDPNVGVVEVKDGTQIELVDTPG---LIKGASKG 55

Query: 75  VGGI-----------DLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTK 116
            G +           D +L V+ A E   P  +  ++II LL++KK IVVL K
Sbjct: 56  EGELGNKFLRHIREADAILHVVDAFE---PDNENDLEIIDLLRLKKVIVVLNK 105


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.316    0.136    0.376 

Gapped
Lambda     K      H
   0.267   0.0528    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 18,325,422
Number of extensions: 1007213
Number of successful extensions: 140995
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2692
Number of HSP's successfully gapped: 219
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)