RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABO50988.1 dred0 ABO50988.1 GIB00494CH01 "S-layer domain
protein"
         (387 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00395 SLH "S-layer homology domain"                                  39   2e-05

>PF00395 SLH "S-layer homology domain"
          Length = 45

 Score = 38.6 bits (89), Expect = 2e-05
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 103 WAKGPIQRLQMLGIASGFPDGTFQPEAPVTQEQ 135
           WA   I+ L   GI  G+PDGTF+P  P+T+ +
Sbjct: 11  WAAEAIRALAAKGIVQGYPDGTFRPNDPITRAE 43


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.317    0.136    0.383 

Gapped
Lambda     K      H
   0.267   0.0537    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,054,686
Number of extensions: 783490
Number of successful extensions: 104552
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1984
Number of HSP's successfully gapped: 231
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)