RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABO48707.1 dred0 ABO48707.1 GIB00494CH01 "metal dependent
phosphohydrolase"
         (472 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ou5A2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:-1 -- 150                  71   3e-15
1ou5A1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:151 -- 354                 69   9e-15
1mivA2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:1 -- 139                   61   3e-12
1mivA1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:140 -- 404                 53   9e-10
1vfgA1 [a.173.1.1] POLY A POLYMERASE A:137 -- 351                      52   2e-09
2hekA1 [a.211.1.1] HYPOTHETICAL PROTEIN A:1 -- 369                     37   4e-05
1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136                        33   7e-04

>1ou5A2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:-1 -- 150
          Length = 140

 Score = 71.0 bits (174), Expect = 3e-15
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 14  QTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVVTNS 73
           +  + GGAVRDL     P D+DF  TA    + +         +    ++   +    + 
Sbjct: 31  ELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHE 90

Query: 74  WHLDFSPLRDEI--LEKDLFARDFTLNAMALP 103
            + + + LR      +KD   RD T+N+M L 
Sbjct: 91  ENFEITTLRIFTTDWQKDAERRDLTINSMFLG 122


>1ou5A1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:151 -- 354
          Length = 204

 Score = 69.4 bits (169), Expect = 9e-15
 Identities = 32/196 (16%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 135 ASSSSIQQDPLRSLRGIRFAATYNL---AIIPETMVLLRQGTRRIEQIAGERLWHELAIL 191
            +   IQ+D LR LR  RF            PET+  + +  + +  I+GER+W EL  +
Sbjct: 7   HAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKI 66

Query: 192 FKLPITSFWINYMDQELHFWQYLLPGQLRMAQTKQNHYHVENVWRHCLRTYECLEVILQE 251
                 +  I+ +  +L    Y+        +         + +     T       +Q+
Sbjct: 67  LVGNHVNHLIHLI-YDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQD 125

Query: 252 LSTIPSEGEPLLIHFNQHLSGGRSRCQVLKLAALIHDVGKPDTAVIREDGRISFHGHAEA 311
             T       +               + L  A    D  K                  ++
Sbjct: 126 DVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLK-----------PYQDFIIDS 174

Query: 312 GVPYAEALATRLKLSR 327
             P A      L   +
Sbjct: 175 REPDATTRVCELLKYQ 190


>1mivA2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:1 -- 139
          Length = 130

 Score = 61.0 bits (148), Expect = 3e-12
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 14  QTYLVGGAVRDLFLNKIPVDLDFCVTAK----VFALAQTLTQQYQGSLVTLDDQREMLRV 69
             Y VGGAVRDL L +   D+D   +A          +T+    +   V +  + +   V
Sbjct: 21  DAYFVGGAVRDLLLGRPIGDVDIATSALPEDVXAIFPKTIDVGSKHGTVVVVHKGKAYEV 80

Query: 70  VTNSWHLDFSPLRDEILEKDLFARDFTLNAMA 101
            T  +  D S      LE+DL  RDFT NA+A
Sbjct: 81  TT--FKTDGSVTFVRSLEEDLKRRDFTXNAIA 110


>1mivA1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:140 -- 404
          Length = 265

 Score = 52.6 bits (126), Expect = 9e-10
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 6/90 (6%)

Query: 139 SIQQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITS 198
             ++D LR  R +RF +    A+ P+T   + Q    +  I+ ER   E   L   P  +
Sbjct: 11  RFREDALRXXRAVRFVSELGFALAPDTEQAIVQNAPLLAHISVERXTXEXEKLLGGPFAA 70

Query: 199 FWINYMDQELHFWQYL-----LPGQLRMAQ 223
             +  +  E     YL        QLR+A 
Sbjct: 71  RALPLL-AETGLNAYLPGLAGKEKQLRLAA 99



 Score = 37.6 bits (87), Expect = 3e-05
 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 419 LSGAALLE-LGIPEGPEVGLILEKLCEEQVTGSITDTKTALL 459
           ++G  ++E +G P GP V   L+ +    V G + + K  + 
Sbjct: 210 VNGKDVIEWVGKPAGPWVKEALDAIWRAVVNGEVENEKERIY 251


>1vfgA1 [a.173.1.1] POLY A POLYMERASE A:137 -- 351
          Length = 215

 Score = 51.9 bits (124), Expect = 2e-09
 Identities = 20/87 (22%), Positives = 38/87 (43%), Gaps = 3/87 (3%)

Query: 133 RAASSSSIQQDPLRSLRGIRFAATYNLAIIPETMVLLRQ--GTRRIEQIAGERLWHELAI 190
           R     S  +DP+R LR +RFA   N  +   T  LL+Q      +++    RL +E+ +
Sbjct: 3   RVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKL 62

Query: 191 LFKLPITSFWINYMDQELHFWQYLLPG 217
             +       I  + ++    + ++ G
Sbjct: 63  ALRED-RFLEILELYRKYRVLEEIIEG 88


>2hekA1 [a.211.1.1] HYPOTHETICAL PROTEIN A:1 -- 369
          Length = 369

 Score = 37.3 bits (85), Expect = 4e-05
 Identities = 17/90 (18%), Positives = 26/90 (28%), Gaps = 20/90 (22%)

Query: 228 HYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVLKLAALIH 287
                  + H L  Y   E I + L     E                    ++KLA L+H
Sbjct: 45  PSAQHTRFEHSLGVYHITERICESLKVKEKE--------------------LVKLAGLLH 84

Query: 288 DVGKPDTAVIREDGRISFHGHAEAGVPYAE 317
           D+G P  +   E        H +      +
Sbjct: 85  DLGHPPFSHTTEVLLPRERSHEDFTERVIK 114


>1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
          Length = 127

 Score = 33.2 bits (75), Expect = 7e-04
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 13  IQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQT-----LTQQYQGSLVTLDDQREML 67
           ++ Y+VGG VRD+ L K   D+DF V      LA+          +          +   
Sbjct: 11  LRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGK 70

Query: 68  RVVTNSWHLDFSPLRDEILEKDLFARDFTLNAMA 101
             +  +     +     + E DL  RDFT+NAMA
Sbjct: 71  LKLEFATARRETVEPASLKE-DLIRRDFTINAMA 103


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0612    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,733,851
Number of extensions: 844820
Number of successful extensions: 4518
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 4370
Number of HSP's successfully gapped: 201
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)