RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABO49938.1 dred0 ABO49938.1 GIB00494CH01 "glycosyl transferase,
family 2"
         (640 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1w3bA [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE                     96   5e-23
1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497               71   1e-15
1omxA [c.68.1.15] ALPHA-1,4-N-ACETYLHEXOSAMINYLTRANSFERASE EXTL2       69   4e-15
1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70...    67   2e-14
1xhbA2 [c.68.1.17] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE...    65   6e-14
1h7lA [c.68.1.1] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN        61   1e-12
2dm9A1 [d.81.4.1] V-TYPE ATP SYNTHASE SUBUNIT E A:81 -- 198            56   5e-11
1xnfA [a.118.8.1] LIPOPROTEIN NLPI                                     55   6e-11
1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265              55   6e-11
2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524                                  55   1e-10
2bo4A1 [c.68.1.18] MANNOSYLGLYCERATE SYNTHASE A:2 -- 382               51   1e-09
1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365                         51   2e-09
1ouvA [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN             49   5e-09
1wfdA [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18                       45   1e-07
2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:2...    44   1e-07
1hz4A [a.118.8.2] MALT REGULATORY PROTEIN                              43   2e-07
2ooeA1 [a.118.8.7] CLEAVAGE STIMULATION FACTOR 77 KDA SUBUNIT A:...    43   3e-07
1elrA [a.118.8.1] TPR2A-DOMAIN OF HOP                                  43   3e-07
1e96B [a.118.8.1] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,      43   4e-07
1b89A [a.118.1.3] PROTEIN (CLATHRIN HEAVY CHAIN)                       42   5e-07
1d8dA [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)                  42   8e-07
1elwA [a.118.8.1] TPR1-DOMAIN OF HOP                                   41   1e-06
1q7sA [c.131.1.1] BIT1                                                 41   1e-06
2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111               40   2e-06
2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129           39   4e-06
2fezA2 [a.118.8.3] PROBABLE REGULATORY PROTEIN EMBR A:105 -- 283       39   5e-06
2crbA1 [a.7.16.1] NUCLEAR RECEPTOR BINDING FACTOR 2 A:8 -- 90          39   5e-06
1a87A [f.1.1.1] COLICIN N                                              39   6e-06
1kt0A1 [a.118.8.1] 51 KDA FK506-BINDING PROTEIN A:254 -- 412           38   8e-06
3ck7A1 [a.118.8.6] SUSD A:42 -- 551                                    38   1e-05
2c2lA1 [a.118.8.1] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN...    37   2e-05
1nznA [a.118.8.1] FISSION PROTEIN FIS1P                                37   2e-05
2fsqA1 [d.61.1.4] ATU0111 PROTEIN A:6 -- 237                           37   3e-05
1zu2A1 [a.118.8.1] MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM20-3...    35   1e-04
1hxiA [a.118.8.1] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5          34   2e-04
1fchA [a.118.8.1] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR              33   2e-04
1tjcA [a.118.8.1] PROLYL 4-HYDROXYLASE ALPHA-1 SUBUNIT                 32   6e-04
1a17A [a.118.8.1] SERINE/THREONINE PROTEIN PHOSPHATASE 5               32   6e-04

>1w3bA [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
          Length = 388

 Score = 95.6 bits (236), Expect = 5e-23
 Identities = 50/389 (12%), Positives = 101/389 (25%), Gaps = 22/389 (5%)

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQP 309
              +  G    A     Q  +  P+   +         Q +   ++      A+      
Sbjct: 7   HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL 66

Query: 310 PQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRE 369
            +  S  G                    +EA+ +Y  +LR  P F      +   L    
Sbjct: 67  AEAYSNLGNVYKERG-----------QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAG 115

Query: 370 NPEYTRECLEKVLDF--SSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRK 427
           + E   +     L +          L N+    G  +       + I    + A      
Sbjct: 116 DMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNL 175

Query: 428 SFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPA 487
                 +     A+    +       +  A  N            +  +      +L P 
Sbjct: 176 GCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN 235

Query: 488 EDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPK- 546
                     +  ++    +      +                + L     +    D   
Sbjct: 236 HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYN 295

Query: 547 -------CLGDRMLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDF 598
                     D + ++  +  E G  E+ V L ++ +E   +   AH  LA   ++ G  
Sbjct: 296 TALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL 355

Query: 599 IEADHHYRYAIELDPSQPRYYISQSKLYE 627
            EA  HY+ AI + P+    Y +     +
Sbjct: 356 QEALMHYKEAIRISPTFADAYSNMGNTLK 384



 Score = 76.7 bits (187), Expect = 2e-17
 Identities = 51/401 (12%), Positives = 119/401 (29%), Gaps = 26/401 (6%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
                  Y+A  +  A    +Q              +L  +   +    +  ++      
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEP----DNTGVLLLLSSIHFQCRRLDRSAHFSTL 58

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHL 327
            ++  P  A+ +   G    +     +A+E +  A+ L                    +L
Sbjct: 59  AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-----------YINL 107

Query: 328 GEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL--DFS 385
                   + E A++ Y+ +L+ NP        +  +LK     E  + C  K +    +
Sbjct: 108 AAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN 167

Query: 386 SPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILN 445
              A   L  +F  QG   L +   E+ + +  +  +        L + R F  A+    
Sbjct: 168 FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYL 227

Query: 446 EYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRK 505
              + S  + +   N    ++ QG         +    L+P              ++   
Sbjct: 228 RALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSV 287

Query: 506 YVHR------IFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKC--LGDRMLDIIR 557
                     + L       L ++         +     L+ +             ++  
Sbjct: 288 AEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLAS 347

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGD 597
           +  + G  ++ +   +E I  +    +A+  +  T +E+ D
Sbjct: 348 VLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD 388



 Score = 71.3 bits (173), Expect = 1e-15
 Identities = 42/307 (13%), Positives = 96/307 (31%), Gaps = 17/307 (5%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
           ++ +    +   +  +   P       +    L  A     A +  + A           
Sbjct: 79  ERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD----L 134

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
             +   +     + G+  +A     + ++  PN+A      G           A+  F +
Sbjct: 135 YCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEK 194

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
           AV L                    +LG + +    ++ A+  YL +L  +P        +
Sbjct: 195 AVTLDPNFLDA-----------YINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL 243

Query: 362 IKILKPRENPEYTRECLEK--VLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNS 419
             +   +   +   +   +   L    P A   L+N   ++G+     +     +R+  +
Sbjct: 244 ACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPT 303

Query: 420 SAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQ 479
            A+ L   +    ++    EA+R+  +       +  A  N       QGK ++     +
Sbjct: 304 HADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYK 363

Query: 480 EIRTLEP 486
           E   + P
Sbjct: 364 EAIRISP 370



 Score = 38.2 bits (87), Expect = 9e-06
 Identities = 19/198 (9%), Positives = 48/198 (24%), Gaps = 3/198 (1%)

Query: 93  REVLVKYVADEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYRFRGAIHEQIADV 152
            + +               ++                  L  N +      A       +
Sbjct: 193 EKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGL 252

Query: 153 ILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGV 212
           I          I             +   ++              +     +    +   
Sbjct: 253 IDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLA 312

Query: 213 ELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLF 272
            + R +   E A  L + A         F      +       G+  +AL   ++ +++ 
Sbjct: 313 NIKREQGNIEEAVRLYRKALEVFPE---FAAAHSNLASVLQQQGKLQEALMHYKEAIRIS 369

Query: 273 PNYADLHYYGGLSLLQLK 290
           P +AD +   G +L +++
Sbjct: 370 PTFADAYSNMGNTLKEMQ 387



 Score = 32.0 bits (71), Expect = 7e-04
 Identities = 12/73 (16%), Positives = 24/73 (32%), Gaps = 1/73 (1%)

Query: 555 IIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
           +    ++ G +E       +       N     LL+  H +      + H    AI+ +P
Sbjct: 5   LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP 64

Query: 614 SQPRYYISQSKLY 626
                Y +   +Y
Sbjct: 65  LLAEAYSNLGNVY 77


>1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497
          Length = 458

 Score = 70.9 bits (172), Expect = 1e-15
 Identities = 27/377 (7%), Positives = 73/377 (19%), Gaps = 40/377 (10%)

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVR 319
           ++   +RQ   L  +  D            +      +  L          +        
Sbjct: 4   QSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKV------- 56

Query: 320 GFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLE 379
                                          N     A   +          +  +E   
Sbjct: 57  -----EQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCT 111

Query: 380 KVLDF--SSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRF 437
           +            + L +I   +        +     ++  S+ +   + +     +   
Sbjct: 112 QSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDH 171

Query: 438 LEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP-AEDTESILRL 496
           L  +       A  + +P A  N         + R        +             + L
Sbjct: 172 LTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYL 231

Query: 497 LLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDII 556
               ++      ++                     E    E LF +        +++ + 
Sbjct: 232 SKSLEKLSPLREKL---------------------EEQFKELLFQKAF---NSQQLVHVT 267

Query: 557 RLYHEHGYYEKTVELLQEYIEA-NQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQ 615
            +     ++ +      E              L          +          E   + 
Sbjct: 268 VINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAY 327

Query: 616 PRYYISQSKLYEDRSEK 632
           P   +  S  +     +
Sbjct: 328 PLPAVKVSMDWLRLRPR 344



 Score = 65.5 bits (158), Expect = 6e-14
 Identities = 34/277 (12%), Positives = 61/277 (22%), Gaps = 20/277 (7%)

Query: 195 KEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHS 254
                                   +           AN   S      +    + L   S
Sbjct: 44  LVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSE----VQANLSLFLEAAS 99

Query: 255 GGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYAS 314
           G       ++  Q             + G          +A   +  A  L     Q   
Sbjct: 100 GFYTQLLQELCTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQP-- 157

Query: 315 FAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYT 374
                       L  +A    ++   + YY  S+     F  A   + K L         
Sbjct: 158 ---------YNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDE 208

Query: 375 RECLEKV----LDFSSPQATLILSNIFFQQGAYKLTL-EFLERLIRMGNSSAEILFRKSF 429
            +    V      F      + LS    +    +  L E  + L+     +++ L   + 
Sbjct: 209 VKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTV 268

Query: 430 CLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFW 466
             + +   L       E    S    L     +  F 
Sbjct: 269 INLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFM 305



 Score = 56.2 bits (134), Expect = 3e-11
 Identities = 26/371 (7%), Positives = 79/371 (21%), Gaps = 33/371 (8%)

Query: 133 FKNRSQYRFRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHI 192
             ++   +       +     L+   +         +  +             +     +
Sbjct: 51  ALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLL-QEL 109

Query: 193 IQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAY 252
             +    +        H G       +  +A      AA           +    + +  
Sbjct: 110 CTQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQLVP----SNGQPYNQLAILA 165

Query: 253 HSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQY 312
            S G     +    + + +   +         +L +       V+         +   ++
Sbjct: 166 SSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKF 225

Query: 313 AS--------------------------FAGVRGFRSLYHLGEIAEVFLNYEEALRYYLE 346
                                       F      + L H+  I    L++        E
Sbjct: 226 HGHVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETE 285

Query: 347 SLRDNPGFQPALERIIKILKPRENPEYTRECLEKV--LDFSSPQATLILSNIFFQQGAYK 404
               +   Q    +++ +                      + P   + +S  + +     
Sbjct: 286 QHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRV 345

Query: 405 LTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILC 464
                ++    +      +L                L    E      + P  +      
Sbjct: 346 FQEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSK 405

Query: 465 FWVQGKKRKVR 475
              +G++R++R
Sbjct: 406 GHKEGQQRRIR 416



 Score = 51.2 bits (121), Expect = 1e-09
 Identities = 18/296 (6%), Positives = 68/296 (22%), Gaps = 13/296 (4%)

Query: 337 YEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL-DFSSPQATLILSN 395
             ++ +Y  ++         +     ++   R+  +   + +     +++  +       
Sbjct: 2   SLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLW 61

Query: 396 IFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYP 455
               +          +       S  +                    +  + ++ SYI  
Sbjct: 62  NHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYICQ 121

Query: 456 LAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEK------RKYVHR 509
               +       + +  +  S  +    L P+         +L S +         Y   
Sbjct: 122 HCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRS 181

Query: 510 IFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGD----RMLDIIRLYHEHGYY 565
           I +         ++   L    E     +    V             + + +   +    
Sbjct: 182 IAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPL 241

Query: 566 EKTVE--LLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
            + +E    +   +   N +    +   +      +    +          +   +
Sbjct: 242 REKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCW 297


>1omxA [c.68.1.15] ALPHA-1,4-N-ACETYLHEXOSAMINYLTRANSFERASE EXTL2
          Length = 250

 Score = 69.3 bits (169), Expect = 4e-15
 Identities = 14/101 (13%), Positives = 29/101 (28%), Gaps = 4/101 (3%)

Query: 3   NRISLCMIVKNEEGNIRRCLASVTGV--VNEIIVVDTGSTDNTCKIAR--EMGARIYSFE 58
           +  +L M   N    + R L     V  ++++IVV                    +    
Sbjct: 3   DSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVKGPEELWNSLGPHPIPVIFKP 62

Query: 59  WNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKY 99
              N    R     +   + +L +D D  ++ +        
Sbjct: 63  QTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSI 103


>1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70)
           A:1 -- 450
          Length = 450

 Score = 66.8 bits (161), Expect = 2e-14
 Identities = 26/456 (5%), Positives = 82/456 (17%), Gaps = 43/456 (9%)

Query: 199 ENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQP 258
           ++      +Y    + +   +     +++    +      + +       +         
Sbjct: 1   DSLDEQRSRYAQIKQAWDNRQMDVVEQMMPGLKDYPLYPYLEY-----RQITDDLMNQPA 55

Query: 259 AKALDVIRQGLQLFPNYADL-----------------------------HYYGGLSLLQL 289
               + +R    L P                                        +    
Sbjct: 56  VTVTNFVRANPTLPPARTLQSRFVNELARREDWRGLLAFSPEKPGTTEAQCNYYYAKWNT 115

Query: 290 KHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLR 349
               +A +   +     +  P            S           +              
Sbjct: 116 GQSEEAWQGAKELWLTGKSQPNACDKLFSVWRASGKQDPLAYLERIRLAMKAGNTGLVTV 175

Query: 350 DNPGFQPALERIIKILKPRENPEYTRECLEKVLDFS----SPQATLILSNIFFQQGAYKL 405
                    + I   +    N   T     +    +       A    S         +L
Sbjct: 176 LAGQMPADYQTIASAIISLANNPNTVLTFARTTGATDFTRQMAAVAFASVARQDAENARL 235

Query: 406 TLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCF 465
            +  L +  ++     + L       +      +      +              ++   
Sbjct: 236 MIPSLAQAQQLNEDQIQELRDIVAWRLMGNDVTDEQAKWRDDAIMRSQSTSLIERRVRMA 295

Query: 466 WVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVG 525
              G +R + + +  +      E  E          E+ +      +    +        
Sbjct: 296 LGTGDRRGLNTWLARLPMEAK-EKDEWRYWQADLLLERGREAEAKEILHQLMQQRGFYPM 354

Query: 526 RLLYLSELTRVEELFSRVDPKCLGDRM---LDIIRLYHEHGYYEKTVELLQEYIEANQNG 582
                       ++                +  +R                  +++    
Sbjct: 355 VAAQRIGEEYELKIDKAPQNVDSALTQGPEMARVRELMYWNLDNTARSEWANLVKSKSKT 414

Query: 583 EAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRY 618
           E    LA        +  +          D  + R+
Sbjct: 415 E-QAQLARYAFNNQWWDLSVQATIAGKLWDHLEERF 449



 Score = 58.7 bits (140), Expect = 6e-12
 Identities = 20/298 (6%), Positives = 46/298 (15%), Gaps = 23/298 (7%)

Query: 191 HIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVL 250
                  V               +              +    TD +            +
Sbjct: 168 GNTGLVTVLAGQMPADYQTIASAIISLANNPNTVLTFARTTGATDFTRQMAAVAFAS--V 225

Query: 251 AYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPP 310
           A          +  + Q  QL  +            L           +     +  Q  
Sbjct: 226 ARQDAENARLMIPSLAQAQQLNEDQIQELRDIVAWRLMGNDVTDEQAKWRDDAIMRSQST 285

Query: 311 QYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPREN 370
                        +     +A    +      +      +             +L  R  
Sbjct: 286 SL-----------IERRVRMALGTGDRRGLNTWLARLPMEAKEKDEWRYWQADLLLERGR 334

Query: 371 PEYTRECLEKV--LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKS 428
               +E L ++       P          ++    K        L +    +        
Sbjct: 335 EAEAKEILHQLMQQRGFYPMVAAQRIGEEYELKIDKAPQNVDSALTQGPEMARVRELMYW 394

Query: 429 FCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP 486
                 R     L      T         +       +               +  + 
Sbjct: 395 NLDNTARSEWANLVKSKSKT--------EQAQLARYAFNNQWWDLSVQATIAGKLWDH 444



 Score = 44.5 bits (103), Expect = 1e-07
 Identities = 16/259 (6%), Positives = 53/259 (20%), Gaps = 18/259 (6%)

Query: 385 SSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRIL 444
              ++        +      +  + +   ++       + +R+    +  +  +     +
Sbjct: 4   DEQRSRYAQIKQAWDNRQMDVVEQMMPG-LKDYPLYPYLEYRQITDDLMNQPAVTVTNFV 62

Query: 445 NEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRT----LEPAEDTESILRLLLRS 500
                      L           +  +  +    ++  T            +  +     
Sbjct: 63  RANPTLPPARTLQSRFVNELARREDWRGLLAFSPEKPGTTEAQCNYYYAKWNTGQSEEAW 122

Query: 501 QEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKC----------LGD 550
           Q  ++         +A   L  +         L  +E +   +              +  
Sbjct: 123 QGAKELWLTGKSQPNACDKLFSVWRASGKQDPLAYLERIRLAMKAGNTGLVTVLAGQMPA 182

Query: 551 RMLDIIRLYHEHGYYEKTVELLQEYIEANQNGE---AHFLLAETHRELGDFIEADHHYRY 607
               I            TV        A        A    +   ++  +          
Sbjct: 183 DYQTIASAIISLANNPNTVLTFARTTGATDFTRQMAAVAFASVARQDAENARLMIPSLAQ 242

Query: 608 AIELDPSQPRYYISQSKLY 626
           A +L+  Q +         
Sbjct: 243 AQQLNEDQIQELRDIVAWR 261



 Score = 41.8 bits (96), Expect = 8e-07
 Identities = 32/306 (10%), Positives = 72/306 (23%), Gaps = 18/306 (5%)

Query: 322 RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV 381
           RS Y   + A      +   +     L+D P +     R I      +        +   
Sbjct: 7   RSRYAQIKQAWDNRQMDVVEQMM-PGLKDYPLYPYLEYRQITDDLMNQPAVTVTNFVRAN 65

Query: 382 LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
                 +        F  + A +     L         + E      +      +  EA 
Sbjct: 66  PTLPPARTLQS---RFVNELARREDWRGLLAFSPEKPGTTEAQCNYYYAKWNTGQSEEAW 122

Query: 442 RILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQ 501
           +   E        P A       +   GK+  +  L +  R    A +T  +  L  +  
Sbjct: 123 QGAKELWLTGKSQPNACDKLFSVWRASGKQDPLAYLERI-RLAMKAGNTGLVTVLAGQMP 181

Query: 502 EKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHE 561
              + +    +        +    R    ++ TR                +        +
Sbjct: 182 ADYQTIASAIISLANNPNTVLTFARTTGATDFTRQMAA------------VAFASVARQD 229

Query: 562 HGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYI 620
                  +  L +  + N    +    +        D  +    +R    +         
Sbjct: 230 AENARLMIPSLAQAQQLNEDQIQELRDIVAWRLMGNDVTDEQAKWRDDAIMRSQSTSLIE 289

Query: 621 SQSKLY 626
            + ++ 
Sbjct: 290 RRVRMA 295



 Score = 38.3 bits (87), Expect = 8e-06
 Identities = 24/352 (6%), Positives = 62/352 (17%), Gaps = 37/352 (10%)

Query: 273 PNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAE 332
            +     Y         +      ++       P  P               Y       
Sbjct: 3   LDEQRSRYAQIKQAWDNRQMDVVEQMMPGLKDYPLYP------------YLEYRQITD-- 48

Query: 333 VFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVL-DFSSPQATL 391
                 +        +R NP   PA     + +      E  R  L        + +A  
Sbjct: 49  --DLMNQPAVTVTNFVRANPTLPPARTLQSRFVNELARREDWRGLLAFSPEKPGTTEAQC 106

Query: 392 ILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADS 451
                 +  G  +   +  + L   G S      +         +      +     A  
Sbjct: 107 NYYYAKWNTGQSEEAWQGAKELWLTGKSQPNACDKLFSVWRASGKQDPLAYLERIRLAMK 166

Query: 452 YIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIF 511
                               +           +    +  + +    R+     +     
Sbjct: 167 AGNTGL--------VTVLAGQMPADYQTIASAIISLANNPNTVLTFARTTGATDF----- 213

Query: 512 LGKDAVTLLLDIVGRLLYLSELTRVEELFSRV---DPKCLGDRMLDIIRLYHEHGYYEKT 568
                +  +               +    ++    +       + DI+            
Sbjct: 214 --TRQMAAVAFASVARQDAENARLMIPSLAQAQQLNEDQ-IQELRDIVAWRLMGNDVTDE 270

Query: 569 VELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
               ++      Q+              GD    +            +  + 
Sbjct: 271 QAKWRDDAIMRSQSTSLIERRVRMALGTGDRRGLNTWLARLPMEAKEKDEWR 322



 Score = 32.9 bits (73), Expect = 4e-04
 Identities = 3/50 (6%), Positives = 12/50 (24%), Gaps = 1/50 (2%)

Query: 577 EANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
           ++     + +   +   +       +      ++  P  P     Q    
Sbjct: 1   DSLDEQRSRYAQIKQAWDNRQMDVVEQMMP-GLKDYPLYPYLEYRQITDD 49


>1xhbA2 [c.68.1.17] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1
           A:95 -- 422
          Length = 316

 Score = 65.3 bits (157), Expect = 6e-14
 Identities = 27/151 (17%), Positives = 49/151 (32%), Gaps = 13/151 (8%)

Query: 4   RISLCMIVKNEEGNIRRCLASV------TGVVNEIIVVDTGSTDNTCKIAREMGAR---- 53
             S+ ++  NE  +                ++ EI++VD  S  +  K   E   +    
Sbjct: 23  TTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKV 82

Query: 54  ---IYSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFI 110
              +   E  +    AR    A + G  I FLDA  E      E L+  +  ++      
Sbjct: 83  PVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCP 142

Query: 111 KIINYLGKEGWTETCPDLVFRLFKNRSQYRF 141
            I              D+ +  F  +  +R+
Sbjct: 143 IIDVISDDTFEYMAGSDMTYGGFNWKLNFRW 173


>1h7lA [c.68.1.1] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN
          Length = 239

 Score = 60.9 bits (146), Expect = 1e-12
 Identities = 17/148 (11%), Positives = 47/148 (31%), Gaps = 15/148 (10%)

Query: 4   RISLCMIVKNEEGNIRRCLASV---TGVVNEIIVVDTGSTDNTCKIAREMGAR------- 53
           ++S+ M   N+   + + ++S+   T    E+ ++D  S + T  + R            
Sbjct: 2   KVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQ 61

Query: 54  -----IYSFEWNNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQVEGY 108
                +        ++   N ++  A G++I +   D     +    +V+ +     +  
Sbjct: 62  SDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAV 121

Query: 109 FIKIINYLGKEGWTETCPDLVFRLFKNR 136
                         +       ++  N 
Sbjct: 122 IYSASKTYHLNDIVKETVRPAAQVTWNA 149


>2dm9A1 [d.81.4.1] V-TYPE ATP SYNTHASE SUBUNIT E A:81 -- 198
          Length = 118

 Score = 55.6 bits (133), Expect = 5e-11
 Identities = 12/107 (11%), Positives = 26/107 (24%), Gaps = 11/107 (10%)

Query: 21  CLASV---TGVVNEIIVVDTGSTDNTCKIAREMGAR------IYSFEWNNNFSDARNFSL 71
            ++SV        E +  D         +   +         + S E       +R   +
Sbjct: 2   IISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEI 61

Query: 72  AKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGK 118
               GD  + L    +  G             +++  F   +     
Sbjct: 62  KSELGDVSIELGETVDTMGGVIVETEDGR--IRIDNTFEARMERFEG 106


>1xnfA [a.118.8.1] LIPOPROTEIN NLPI
          Length = 259

 Score = 55.4 bits (133), Expect = 6e-11
 Identities = 40/238 (16%), Positives = 76/238 (31%), Gaps = 19/238 (7%)

Query: 211 GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQ 270
            V L    +         Q   +   +     +LL    + Y S G  A A +   Q L 
Sbjct: 6   AVPLQPTLQQEVILARXEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALA 65

Query: 271 LFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEI 330
           + P+  ++  Y G+ L Q  ++  A E F   + L    P Y          +  + G  
Sbjct: 66  IRPDXPEVFNYLGIYLTQAGNFDAAYEAFDSVLEL---DPTYN--------YAHLNRGIA 114

Query: 331 AEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQ-- 388
                  + A    L   +D+P   P     + + + + + +  +E L++  + S  +  
Sbjct: 115 LYYGGRDKLAQDDLLAFYQDDPN-DPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQW 173

Query: 389 ----ATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALR 442
                   L NI  Q    +L  +  +    +    +E  F      +       A  
Sbjct: 174 GWNIVEFYLGNISEQTLXERLKADATD-NTSLAEHLSETNFYLGKYYLSLGDLDSATA 230



 Score = 36.5 bits (84), Expect = 3e-05
 Identities = 12/70 (17%), Positives = 24/70 (34%), Gaps = 1/70 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQNG-EAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
           LY   G          + +    +  E    L     + G+F  A   +   +ELDP+  
Sbjct: 46  LYDSLGLRALARNDFSQALAIRPDXPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYN 105

Query: 617 RYYISQSKLY 626
             ++++    
Sbjct: 106 YAHLNRGIAL 115



 Score = 35.3 bits (81), Expect = 7e-05
 Identities = 14/81 (17%), Positives = 29/81 (35%), Gaps = 5/81 (6%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
              + G ++   E     +E +     AH          G    A        + DP+ P
Sbjct: 80  YLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDP 139

Query: 617 R----YYISQSKLYEDRSEKI 633
                 Y+++ KL E +++++
Sbjct: 140 FRSLWLYLAEQKLDEKQAKEV 160



 Score = 35.3 bits (81), Expect = 7e-05
 Identities = 23/101 (22%), Positives = 41/101 (40%), Gaps = 8/101 (7%)

Query: 209 HYGVELYRAERY---GEAAEVLIQAANNTDSSTIYFPKLLRYIV--LAYHSGGQPAKALD 263
              + LY AE+     +A EVL Q    +D    +   ++ + +  ++  +  +  KA  
Sbjct: 140 FRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKE-QWGWNIVEFYLGNISEQTLXERLKA-- 196

Query: 264 VIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVA 304
                  L  + ++ ++Y G   L L     A  LF  AVA
Sbjct: 197 DATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVA 237



 Score = 34.6 bits (79), Expect = 1e-04
 Identities = 7/49 (14%), Positives = 18/49 (36%)

Query: 571 LLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
           L    +  ++  +  +     +  LG    A + +  A+ + P  P  +
Sbjct: 26  LASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDXPEVF 74



 Score = 33.4 bits (76), Expect = 2e-04
 Identities = 34/235 (14%), Positives = 70/235 (29%), Gaps = 31/235 (13%)

Query: 383 DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALR 442
           D    Q       ++   G   L      + + +     E+       L Q   F  A  
Sbjct: 33  DDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDXPEVFNYLGIYLTQAGNFDAAYE 92

Query: 443 ILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLL----L 498
             +        Y  A  N+ +  +  G+ +  +  +      +P +   S+   L    L
Sbjct: 93  AFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKL 152

Query: 499 RSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRL 558
             ++ ++ + + F   D      +IV    YL  ++           + L +R+      
Sbjct: 153 DEKQAKEVLKQHFEKSDKEQWGWNIVE--FYLGNISE----------QTLXERLKADATD 200

Query: 559 YHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
                              A    E +F L + +  LGD   A   ++ A+  + 
Sbjct: 201 NTSL---------------AEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNV 240


>1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265
          Length = 264

 Score = 55.4 bits (132), Expect = 6e-11
 Identities = 26/191 (13%), Positives = 52/191 (27%), Gaps = 14/191 (7%)

Query: 254 SGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQY 312
           S GQ  +AL+++ + ++  P  A L       L     + +A E   Q++ L PE  P  
Sbjct: 8   SEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLXQSIKLFPEYLPGA 67

Query: 313 ASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPE 372
           +          +             + A       +               +    ++ E
Sbjct: 68  SQLR-----HLVKAAQA------RKDFAQGAATAKVLGENEELTKSLVSFNLSXVSQDYE 116

Query: 373 YTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMG--NSSAEILFRKSFC 430
              E   ++ +    +  L     F         L     L           I    +  
Sbjct: 117 QVSELALQIEELRQEKGFLANDTSFSDVRDIDDRLGGYIELFSTAGNYFLVPIASINTLE 176

Query: 431 LIQERRFLEAL 441
           +      LE++
Sbjct: 177 IKSATSLLESV 187



 Score = 47.3 bits (111), Expect = 2e-08
 Identities = 22/173 (12%), Positives = 45/173 (26%), Gaps = 9/173 (5%)

Query: 190 LHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQA-ANNTDSSTIYFPKLLRYI 248
           L ++ + +  +P +  L+  +   L     +  A E L Q+     +          +  
Sbjct: 16  LELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLXQSIKLFPEYLPGAS----QLR 71

Query: 249 VLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQ 308
            L   +  +   A       +                    + Y +  EL LQ   L ++
Sbjct: 72  HLVKAAQARKDFAQGAATAKVLGENEELTKSLVSFNLSXVSQDYEQVSELALQIEELRQE 131

Query: 309 PPQYASFAG----VRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPA 357
               A+             L    E+     NY       + +L         
Sbjct: 132 KGFLANDTSFSDVRDIDDRLGGYIELFSTAGNYFLVPIASINTLEIKSATSLL 184



 Score = 43.0 bits (100), Expect = 3e-07
 Identities = 20/238 (8%), Positives = 56/238 (23%), Gaps = 7/238 (2%)

Query: 382 LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEAL 441
                         +    G ++   E L + I++         +    +   +   +  
Sbjct: 25  ASPKDASLRSSFIELLCIDGDFERADEQLXQSIKLFPEYLPGASQLRHLVKAAQARKDFA 84

Query: 442 RIL-NEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRS 500
           +                         V     +V  L  +I  L   +   +        
Sbjct: 85  QGAATAKVLGENEELTKSLVSFNLSXVSQDYEQVSELALQIEELRQEKGFLANDTSFSDV 144

Query: 501 ----QEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDII 556
                    Y+       +   + +  +  L   S  + +E ++  V+    G    +  
Sbjct: 145 RDIDDRLGGYIELFSTAGNYFLVPIASINTLEIKSATSLLESVWRPVEFDIDGLGEGEGH 204

Query: 557 RLYHEHGYYEKTVELLQEYIEANQNGEAHFL-LAETHRELGDFIEADHHYRYAIELDP 613
                        +L +E        +  +L L      +G+        +  +++  
Sbjct: 205 XPXTYVDSESDAQKLGRETDWKQIADKEVYLGLGLKCWLVGEXALPISDLQ-NLQVIK 261



 Score = 42.6 bits (99), Expect = 4e-07
 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%)

Query: 563 GYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYIS 621
           G  ++ +ELL E I+A+ ++        E     GDF  AD     +I+L P        
Sbjct: 10  GQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLXQSIKLFPEYLPGASQ 69

Query: 622 QSKLYEDRSEK 632
              L +    +
Sbjct: 70  LRHLVKAAQAR 80



 Score = 38.0 bits (87), Expect = 1e-05
 Identities = 8/72 (11%), Positives = 19/72 (26%), Gaps = 2/72 (2%)

Query: 557 RLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADH-HYRYAIELDPS 614
            L    G +E+  E L + I+   +       L    +      +         +  +  
Sbjct: 38  ELLCIDGDFERADEQLXQSIKLFPEYLPGASQLRHLVKAAQARKDFAQGAATAKVLGENE 97

Query: 615 QPRYYISQSKLY 626
           +    +    L 
Sbjct: 98  ELTKSLVSFNLS 109



 Score = 33.4 bits (75), Expect = 3e-04
 Identities = 3/63 (4%), Positives = 11/63 (17%), Gaps = 1/63 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
           +       +         +    +      +         D+ +         EL   + 
Sbjct: 74  VKAAQARKDFAQGAATAKVLGENEELTKSLVSFNLSXVSQDYEQVSELALQIEELRQEKG 133

Query: 617 RYY 619
              
Sbjct: 134 FLA 136


>2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524
          Length = 502

 Score = 54.6 bits (129), Expect = 1e-10
 Identities = 9/121 (7%), Positives = 21/121 (17%), Gaps = 11/121 (9%)

Query: 240 YFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELF 299
                        +       + +        +   A+       +      Y   VE+ 
Sbjct: 391 RAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVV 450

Query: 300 LQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALE 359
            + V                         +  E      E   +    L      +  + 
Sbjct: 451 NRLVFAEPDNRAA-----------RELQADALEQLGYQAENAGWRNSYLSAAYELRHGVP 499

Query: 360 R 360
           R
Sbjct: 500 R 500



 Score = 53.0 bits (125), Expect = 3e-10
 Identities = 14/115 (12%), Positives = 32/115 (27%), Gaps = 5/115 (4%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPA 259
           N    L +Y    +   A     + E                 + L     A ++ G+  
Sbjct: 389 NARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYM----GGAERLLEQARASYARGEYR 444

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQYA 313
             ++V+ + +   P+          +L QL +  +        ++   E      
Sbjct: 445 WVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVP 499



 Score = 43.8 bits (101), Expect = 2e-07
 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 5/74 (6%)

Query: 550 DRMLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYR-- 606
           +R+L+  R  +  G Y   VE++   + A   N  A  L A+   +LG   E        
Sbjct: 428 ERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSY 487

Query: 607 --YAIELDPSQPRY 618
              A EL    PR 
Sbjct: 488 LSAAYELRHGVPRD 501



 Score = 41.1 bits (94), Expect = 1e-06
 Identities = 8/70 (11%), Positives = 15/70 (21%), Gaps = 1/70 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEANQNG-EAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
            +       + E           G E     A      G++          +  +P    
Sbjct: 403 GNPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRA 462

Query: 618 YYISQSKLYE 627
               Q+   E
Sbjct: 463 ARELQADALE 472



 Score = 31.9 bits (70), Expect = 7e-04
 Identities = 2/47 (4%), Positives = 8/47 (17%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
           +     +L             +                  + Q++  
Sbjct: 391 RAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARAS 437


>2bo4A1 [c.68.1.18] MANNOSYLGLYCERATE SYNTHASE A:2 -- 382
          Length = 380

 Score = 51.3 bits (121), Expect = 1e-09
 Identities = 19/151 (12%), Positives = 31/151 (20%), Gaps = 20/151 (13%)

Query: 6   SLCMIVKNEEGNIRRCLASV--TGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEW---- 59
            +    K+E   +      V         ++      D T +        I         
Sbjct: 2   LVVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTPVS 61

Query: 60  --------------NNNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQV 105
                          +  + A  + L +   + I F DAD    G       +  AD   
Sbjct: 62  VRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADFGY 121

Query: 106 EGYFIKIINYLGKEGWTETCPDLVFRLFKNR 136
                           T       F L    
Sbjct: 122 GLVRHYFPRASTDAMITWMITRTGFALLWPH 152


>1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365
          Length = 169

 Score = 50.6 bits (120), Expect = 2e-09
 Identities = 22/167 (13%), Positives = 51/167 (30%), Gaps = 31/167 (18%)

Query: 214 LYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDV--------- 264
                 + E A+V ++  +      +   + L+ I   +        A+           
Sbjct: 3   GDSHPDFPEDADVDLKDVDKI----LLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVE 58

Query: 265 -------IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAG 317
                     G +L P         G   L++  +  AV+  L+A+ +     +      
Sbjct: 59  GSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKA----- 113

Query: 318 VRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKI 364
                 LY   +  +    Y++AL    ++    P  +     ++K+
Sbjct: 114 ------LYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKV 154



 Score = 45.6 bits (107), Expect = 5e-08
 Identities = 21/151 (13%), Positives = 56/151 (37%), Gaps = 6/151 (3%)

Query: 252 YHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQ 311
             S     +  DV  + +      ++     G +  + +++  A++ + + +   E    
Sbjct: 3   GDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRA 62

Query: 312 YASFAGVRGFRS-----LYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILK 366
            A  A     +      + ++G       +++ A+   LE+L  +P    AL R  +  +
Sbjct: 63  AAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQ 122

Query: 367 PRENPEYTRECLEKVLDFSSPQATLILSNIF 397
             +  +     L+K  +  +P+   I + + 
Sbjct: 123 GLKEYDQALADLKKAQEI-APEDKAIQAELL 152



 Score = 43.6 bits (102), Expect = 2e-07
 Identities = 15/117 (12%), Positives = 37/117 (31%), Gaps = 8/117 (6%)

Query: 179 QIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSST 238
           ++ +  + +R            P       + G    +   +  A +  ++A        
Sbjct: 52  KVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDP--- 108

Query: 239 IYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKA 295
               K L      +    +  +AL  +++  ++ P    +       LL++K   KA
Sbjct: 109 -SNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAE----LLKVKQKIKA 160



 Score = 42.5 bits (99), Expect = 5e-07
 Identities = 14/110 (12%), Positives = 33/110 (30%), Gaps = 12/110 (10%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF------------PKLLRYIVLAYHSG 255
            + G   ++++ +  A +   +     + S                   +  I       
Sbjct: 31  KNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKM 90

Query: 256 GQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
                A+D   + L++ P+     Y        LK Y +A+    +A  +
Sbjct: 91  SDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEI 140



 Score = 40.2 bits (93), Expect = 2e-06
 Identities = 11/64 (17%), Positives = 26/64 (40%), Gaps = 1/64 (1%)

Query: 557 RLYHEHGYYEKTVELLQEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQ 615
               +   ++  V+   E +E +  N +A +  A+  + L ++ +A    + A E+ P  
Sbjct: 85  ACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPED 144

Query: 616 PRYY 619
               
Sbjct: 145 KAIQ 148



 Score = 37.5 bits (86), Expect = 1e-05
 Identities = 22/176 (12%), Positives = 55/176 (31%), Gaps = 27/176 (15%)

Query: 285 SLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYY 344
           S      + +  ++ L+ V       +            L ++G       N+E A++ Y
Sbjct: 2   SGDSHPDFPEDADVDLKDVDKILLISE-----------DLKNIGNTFFKSQNWEMAIKKY 50

Query: 345 LESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYK 404
            + LR   G + A E                      L   +    L +     +   ++
Sbjct: 51  TKVLRYVEGSRAAAEDADGAK----------------LQPVALSCVLNIGACKLKMSDWQ 94

Query: 405 LTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFN 460
             ++     + +  S+ + L+R++      + + +AL  L +    +      +  
Sbjct: 95  GAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAE 150



 Score = 35.5 bits (81), Expect = 6e-05
 Identities = 7/70 (10%), Positives = 23/70 (32%), Gaps = 1/70 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEANQN-GEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
              +    +      +  +           +     ++ D+  A      A+E+DPS  +
Sbjct: 53  VLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTK 112

Query: 618 YYISQSKLYE 627
               +++ ++
Sbjct: 113 ALYRRAQGWQ 122



 Score = 32.8 bits (74), Expect = 4e-04
 Identities = 6/72 (8%), Positives = 18/72 (25%), Gaps = 1/72 (1%)

Query: 558 LYHEHGYYEKTVEL-LQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
               H  + +  ++ L++  +     E    +  T  +  ++  A   Y   +       
Sbjct: 2   SGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSR 61

Query: 617 RYYISQSKLYED 628
                       
Sbjct: 62  AAAEDADGAKLQ 73



 Score = 32.5 bits (73), Expect = 5e-04
 Identities = 15/135 (11%), Positives = 48/135 (35%), Gaps = 18/135 (13%)

Query: 387 PQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS----------------AEILFRKSFC 430
            +    + N FF+   +++ ++   +++R    S                   +     C
Sbjct: 27  SEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGAC 86

Query: 431 LIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT 490
            ++   +  A+    E          A + +   +    +  +  + +++ + + P  + 
Sbjct: 87  KLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAP--ED 144

Query: 491 ESILRLLLRSQEKRK 505
           ++I   LL+ ++K K
Sbjct: 145 KAIQAELLKVKQKIK 159


>1ouvA [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
          Length = 265

 Score = 49.0 bits (115), Expect = 5e-09
 Identities = 13/128 (10%), Positives = 26/128 (20%), Gaps = 11/128 (8%)

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
           PK L  +    +      +A     +   L  N    +        Q    +        
Sbjct: 2   PKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFY 61

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
           A A             +      + LG +        +     L+        + A    
Sbjct: 62  AKAC-----------DLNYSNGCHLLGNLYYSGQGVSQNTNKALQYYSKACDLKYAEGCA 110

Query: 362 IKILKPRE 369
                  +
Sbjct: 111 SLGGIYHD 118



 Score = 36.2 bits (82), Expect = 4e-05
 Identities = 6/46 (13%), Positives = 16/46 (34%)

Query: 581 NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLY 626
           + +    L     +  DF +A  ++  A +L  +   + +      
Sbjct: 1   DPKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQ 46



 Score = 34.3 bits (77), Expect = 1e-04
 Identities = 8/97 (8%), Positives = 26/97 (26%), Gaps = 2/97 (2%)

Query: 322 RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV 381
           + L  LG  +    ++ +A +Y+ ++             ++            +      
Sbjct: 3   KELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYA 62

Query: 382 L--DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRM 416
              D +      +L N+++             +    
Sbjct: 63  KACDLNYSNGCHLLGNLYYSGQGVSQNTNKALQYYSK 99


>1wfdA [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18
          Length = 93

 Score = 44.6 bits (105), Expect = 1e-07
 Identities = 9/78 (11%), Positives = 23/78 (29%), Gaps = 4/78 (5%)

Query: 275 YADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVF 334
            A       + L     Y +A+  + + + +  Q  +    +     +      +I+   
Sbjct: 14  AAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESS----KRCVLRTKISGYM 69

Query: 335 LNYEEALRYYLESLRDNP 352
              E   +Y  +   D  
Sbjct: 70  DRAENIKKYLDQEKEDGK 87



 Score = 39.3 bits (91), Expect = 4e-06
 Identities = 4/57 (7%), Positives = 12/57 (21%), Gaps = 1/57 (1%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQ-NGEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
                  Y++ +   QE I+      +     ++                   +   
Sbjct: 24  ELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMDRAENIKKYLD 80



 Score = 37.3 bits (86), Expect = 2e-05
 Identities = 7/91 (7%), Positives = 23/91 (25%), Gaps = 10/91 (10%)

Query: 230 AANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQL 289
           +  ++DS+       +    +   +  +  +AL   ++G+ +               +  
Sbjct: 6   SGQDSDSTA---AVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLR 62

Query: 290 K-------HYHKAVELFLQAVALPEQPPQYA 313
                         +   Q     +  P   
Sbjct: 63  TKISGYMDRAENIKKYLDQEKEDGKSGPSSG 93



 Score = 36.2 bits (83), Expect = 4e-05
 Identities = 7/47 (14%), Positives = 13/47 (27%)

Query: 581 NGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYE 627
              A    A        + +A   Y+  I++     +     SK   
Sbjct: 14  AAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCV 60



 Score = 34.6 bits (79), Expect = 1e-04
 Identities = 9/69 (13%), Positives = 22/69 (31%)

Query: 418 NSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSL 477
           +++A  + +++  L  E R+ +AL    E                    ++ K       
Sbjct: 12  STAAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMDR 71

Query: 478 VQEIRTLEP 486
            + I+    
Sbjct: 72  AENIKKYLD 80



 Score = 32.3 bits (73), Expect = 5e-04
 Identities = 8/72 (11%), Positives = 18/72 (25%), Gaps = 4/72 (5%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
               VEL    RY +A     +  +      +   K  +          + +  +D    
Sbjct: 19  LKRAVELDAESRYQQALVCYQEGIDM----LLQVLKGTKESSKRCVLRTKISGYMDRAEN 74

Query: 268 GLQLFPNYADLH 279
             +      +  
Sbjct: 75  IKKYLDQEKEDG 86


>2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22
           -- 174
          Length = 153

 Score = 44.3 bits (104), Expect = 1e-07
 Identities = 18/121 (14%), Positives = 35/121 (28%), Gaps = 7/121 (5%)

Query: 213 ELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLF 272
           +   A  +    E                      +   Y+      KA+D   + L++ 
Sbjct: 39  KYKEALDFFIHTEEWDDQILLDKK-KNIEISCNLNLATCYNKNKDYPKAIDHASKVLKID 97

Query: 273 PNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQYASFAGVRGFRSLYHLGEIA 331
            N     Y  G++ +      +A E   +A +L P       S+        +  L E  
Sbjct: 98  KNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYE-----LCVNKLKEAR 152

Query: 332 E 332
           +
Sbjct: 153 K 153



 Score = 43.2 bits (101), Expect = 3e-07
 Identities = 26/186 (13%), Positives = 61/186 (32%), Gaps = 34/186 (18%)

Query: 288 QLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLES 347
           +   Y    E  +Q+    ++        G   F+      EI E  + Y+EAL ++   
Sbjct: 2   KKSIYDYTDEEKVQSAFDIKEE-------GNEFFKK----NEINEAIVKYKEALDFF--- 47

Query: 348 LRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTL 407
                      E   +IL  ++                     L L+  + +   Y   +
Sbjct: 48  -------IHTEEWDDQILLDKKKNIE-------------ISCNLNLATCYNKNKDYPKAI 87

Query: 408 EFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWV 467
           +   +++++  ++ + L++     +      EA   L +  + +      + +  LC   
Sbjct: 88  DHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNK 147

Query: 468 QGKKRK 473
             + RK
Sbjct: 148 LKEARK 153



 Score = 38.9 bits (90), Expect = 5e-06
 Identities = 13/72 (18%), Positives = 28/72 (38%), Gaps = 1/72 (1%)

Query: 557 RLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQ 615
             Y+++  Y K ++   + ++ +  N +A + L   +   G   EA  +   A  L+P+ 
Sbjct: 75  TCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNN 134

Query: 616 PRYYISQSKLYE 627
                S      
Sbjct: 135 LDIRNSYELCVN 146


>1hz4A [a.118.8.2] MALT REGULATORY PROTEIN
          Length = 366

 Score = 43.4 bits (101), Expect = 2e-07
 Identities = 45/351 (12%), Positives = 91/351 (25%), Gaps = 41/351 (11%)

Query: 276 ADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFL 335
           A+ +       +   +  +A  L    +AL E PP            +   LGE+     
Sbjct: 12  AEFNALRAQVAINDGNPDEAERLA--KLALEELPPG----WFYSRIVATSVLGEVLHCKG 65

Query: 336 NYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSN 395
               +L    ++ +           +                           + +  S 
Sbjct: 66  ELTRSLALMQQTEQMARQHDVWHYAL--------------------------WSLIQQSE 99

Query: 396 IFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEALRILNEYTADSYIYP 455
           I F QG  +   E  E+  ++ N            L++ R  L       +    S    
Sbjct: 100 ILFAQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSG 159

Query: 456 LAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKD 515
           +   +             +         L+ A    + L  LL + +             
Sbjct: 160 IEVLSSYQPQQQLQCLAMLIQCSLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVR 219

Query: 516 AVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEY 575
              +   + G     +   R        +   L  +  +I R     G +E    +L+E 
Sbjct: 220 V--IYWQMTGDKAAAANWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEEL 277

Query: 576 IEANQN-------GEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
            E  ++            LL + + + G   +A      A++L        
Sbjct: 278 NENARSLRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFIS 328



 Score = 41.1 bits (95), Expect = 1e-06
 Identities = 34/383 (8%), Positives = 83/383 (21%), Gaps = 56/383 (14%)

Query: 251 AYHSGGQPAKALDVIRQGLQLFP-----NYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
              + G P +A  + +  L+  P     +        G  L       +++ L  Q   +
Sbjct: 21  VAINDGNPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQM 80

Query: 306 PEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKIL 365
             Q   +          SL    EI       + A     ++ +           +    
Sbjct: 81  ARQHDVWHYALW-----SLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQLPMH--- 132

Query: 366 KPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILF 425
                                     I + + +               I + +S      
Sbjct: 133 ---------------------EFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQ 171

Query: 426 RKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLE 485
            +   ++ +               +     L        +     K +V           
Sbjct: 172 LQCLAMLIQCSLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVRVIYWQMTGDKAA 231

Query: 486 PAEDTESILRLLLRSQEKRKYVHR----IFLGKDAVTLLLDIVGRLLYLSELTRVEELFS 541
            A       +    +    +   R      +          ++  L   +   R+    +
Sbjct: 232 AANWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNENARSLRLMSDLN 291

Query: 542 RVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGD---- 597
           R         +L + +LY + G       +L + ++                 +      
Sbjct: 292 R--------NLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQ 343

Query: 598 ------FIEADHHYRYAIELDPS 614
                   E + H    I  + +
Sbjct: 344 LIQLNTLPELEQHRAQRILREIN 366


>2ooeA1 [a.118.8.7] CLEAVAGE STIMULATION FACTOR 77 KDA SUBUNIT A:21
           -- 549
          Length = 527

 Score = 43.1 bits (99), Expect = 3e-07
 Identities = 11/127 (8%), Positives = 31/127 (24%), Gaps = 1/127 (0%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
               K+    I +  + +          Y   L           +  +   +        
Sbjct: 400 CSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKS 459

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYAD-LHYYGGLSLLQLKHYHKAVELFL 300
            ++    +    + G  A  L V ++    F    +       +   +    +      L
Sbjct: 460 GEIWARFLAFESNIGDLASILKVEKRRFTAFREEYEGKETALLVDRYKFMDLYPCSASEL 519

Query: 301 QAVALPE 307
           +A+   +
Sbjct: 520 KALGYKD 526



 Score = 37.7 bits (85), Expect = 1e-05
 Identities = 14/115 (12%), Positives = 33/115 (28%), Gaps = 7/115 (6%)

Query: 252 YHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQ 311
           Y+     + A  +   GL+ + +  +        L  L   +    LF + +     PP+
Sbjct: 398 YYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPE 457

Query: 312 YASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILK 366
            +     R      ++G       +    L+                E  + + +
Sbjct: 458 KSGEIWARFLAFESNIG-------DLASILKVEKRRFTAFREEYEGKETALLVDR 505



 Score = 35.0 bits (78), Expect = 8e-05
 Identities = 6/80 (7%), Positives = 15/80 (18%), Gaps = 5/80 (6%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQN-----GEAHFLLAETHRELGDFIEADHHYRYAIELD 612
                     T  L +  + +        GE           +GD        +      
Sbjct: 431 YLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAF 490

Query: 613 PSQPRYYISQSKLYEDRSEK 632
             +     +   +   +   
Sbjct: 491 REEYEGKETALLVDRYKFMD 510


>1elrA [a.118.8.1] TPR2A-DOMAIN OF HOP
          Length = 128

 Score = 43.0 bits (100), Expect = 3e-07
 Identities = 18/126 (14%), Positives = 36/126 (28%), Gaps = 6/126 (4%)

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
               + +    +       AL    +  +L P              +   Y+K  EL  +
Sbjct: 4   ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEK 63

Query: 302 AVA-LPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALER 360
           A+    E    Y   A          +G        Y++A+ +Y +SL ++       + 
Sbjct: 64  AIEVGRENREDYRQIAKAY-----ARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKC 118

Query: 361 IIKILK 366
                 
Sbjct: 119 QQAEKI 124



 Score = 36.5 bits (83), Expect = 3e-05
 Identities = 11/81 (13%), Positives = 26/81 (32%), Gaps = 1/81 (1%)

Query: 548 LGDRMLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYR 606
                 +           EK +E+ +E  E   Q  +A+  +  ++ +   + +A H Y 
Sbjct: 44  QAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYN 103

Query: 607 YAIELDPSQPRYYISQSKLYE 627
            ++    +       Q     
Sbjct: 104 KSLAEHRTPDVLKKCQQAEKI 124



 Score = 36.1 bits (82), Expect = 4e-05
 Identities = 16/101 (15%), Positives = 38/101 (37%), Gaps = 3/101 (2%)

Query: 208 YHYGVELYRAERYGEAAEVLIQA-ANNTDSSTIYFPKLLRYIVLA--YHSGGQPAKALDV 264
              G + Y+ + +  A +   +A   +  + T    +   Y              KA++V
Sbjct: 8   KELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEV 67

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
            R+  + +   A  +   G S  + + Y  A+  + +++A 
Sbjct: 68  GRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAE 108



 Score = 34.9 bits (79), Expect = 9e-05
 Identities = 18/124 (14%), Positives = 44/124 (35%), Gaps = 9/124 (7%)

Query: 322 RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV 381
                LG  A    +++ AL++Y ++   +P     +     +   + +    RE  EK 
Sbjct: 5   LKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKA 64

Query: 382 L---------DFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLI 432
           +              +A   + N +F++  YK  + F  + +    +   +   +    I
Sbjct: 65  IEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKI 124

Query: 433 QERR 436
            + +
Sbjct: 125 LKEQ 128



 Score = 34.2 bits (77), Expect = 1e-04
 Identities = 12/40 (30%), Positives = 15/40 (37%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
           +       L     +  DF  A  HY  A ELDP+   Y 
Sbjct: 2   KQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYI 41


>1e96B [a.118.8.1] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,
          Length = 185

 Score = 42.6 bits (99), Expect = 4e-07
 Identities = 23/183 (12%), Positives = 52/183 (28%), Gaps = 14/183 (7%)

Query: 201 PGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAK 260
               +  ++ GV     + +  A +                 ++   I   Y       +
Sbjct: 2   LVEAISLWNEGVLAADKKDWKGALDAFSAV-------QDPHSRICFNIGCMYTILKNMTE 54

Query: 261 ALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRG 320
           A     + +    + A  ++  G+   Q + Y  A++   +A+                 
Sbjct: 55  AEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLID------- 107

Query: 321 FRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEK 380
           ++ L    ++    + Y  A  Y  +        Q AL   +K        +   EC+ K
Sbjct: 108 YKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWK 167

Query: 381 VLD 383
              
Sbjct: 168 QKL 170



 Score = 36.5 bits (83), Expect = 3e-05
 Identities = 24/180 (13%), Positives = 52/180 (28%), Gaps = 20/180 (11%)

Query: 273 PNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAE 332
              A   +  G+     K +  A++ F              S       R  +++G +  
Sbjct: 2   LVEAISLWNEGVLAADKKDWKGALDAF--------------SAVQDPHSRICFNIGCMYT 47

Query: 333 VFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLD---FSSPQA 389
           +  N  EA + +  S+  +     A  +   +    E  +   + L++ L     +    
Sbjct: 48  ILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLID 107

Query: 390 TLILSNIFFQQGAYKLTLEFLERLIRMGNSSAE---ILFRKSFCLIQERRFLEALRILNE 446
             IL   F       L         +     AE    L        +  +  +A+  + +
Sbjct: 108 YKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWK 167



 Score = 32.6 bits (73), Expect = 4e-04
 Identities = 2/32 (6%), Positives = 6/32 (18%)

Query: 588 LAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
             ++        +A          +P      
Sbjct: 148 SMKSEPRHSKIDKAMECVWKQKLYEPVVIPVG 179


>1b89A [a.118.1.3] PROTEIN (CLATHRIN HEAVY CHAIN)
          Length = 319

 Score = 42.4 bits (98), Expect = 5e-07
 Identities = 10/101 (9%), Positives = 26/101 (25%), Gaps = 5/101 (4%)

Query: 536 VEELFSRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQ--EYIEANQNGEAHFLLAETHR 593
           + +L   + P+    R    +  + +          L+  +        E+   L  T  
Sbjct: 222 LNDLLXVLSPRLDHTRA---VNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEE 278

Query: 594 ELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRSEKIK 634
           +      +   Y     +  +Q        +     +   K
Sbjct: 279 DYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFK 319



 Score = 35.4 bits (80), Expect = 6e-05
 Identities = 11/55 (20%), Positives = 15/55 (27%), Gaps = 1/55 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDP 613
             E   +          +  N N      LA T   LG++  A    R A     
Sbjct: 2   LAELEEFINGPMYDAAKLLYN-NVSNFGRLASTLVHLGEYQAAVDGARKANSTRT 55


>1d8dA [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)
          Length = 323

 Score = 41.7 bits (96), Expect = 8e-07
 Identities = 8/97 (8%), Positives = 20/97 (20%), Gaps = 11/97 (11%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
           L L      L+                    +  +   E+                 +  
Sbjct: 2   LSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDV-----------YDYFR 50

Query: 329 EIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKIL 365
            + +     E A +   +++  N            +L
Sbjct: 51  AVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLL 87



 Score = 35.9 bits (81), Expect = 4e-05
 Identities = 23/311 (7%), Positives = 75/311 (24%), Gaps = 29/311 (9%)

Query: 324 LYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV-- 381
                E A++    +      +  +  +  F+   +    +L+  E  E   +       
Sbjct: 12  YRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIE 71

Query: 382 LDFSSPQATLILSNI-FFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLEA 440
           L+ ++         +    Q   +  + ++  +I     + ++   +   +   +   + 
Sbjct: 72  LNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQE 131

Query: 441 LRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEP-------------- 486
           L  + +          A  ++                V ++   +               
Sbjct: 132 LEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVIS 191

Query: 487 -AEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDP 545
                     L    Q   + +  +   + A   L  I+           + +L      
Sbjct: 192 NTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPS 251

Query: 546 KCLGDRMLDIIRLYHEH---------GYYEKTVELLQEYIEANQ--NGEAHFLLAETHRE 594
                 +  ++ +Y +              K +EL +   +       E    +  + + 
Sbjct: 252 HSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQS 311

Query: 595 LGDFIEADHHY 605
                      
Sbjct: 312 KHSRESDIPAS 322



 Score = 35.2 bits (79), Expect = 7e-05
 Identities = 4/54 (7%), Positives = 10/54 (18%), Gaps = 1/54 (1%)

Query: 575 YIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYE 627
           ++  +      +   AE                  I         Y     + +
Sbjct: 1   FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQ 54



 Score = 33.2 bits (74), Expect = 3e-04
 Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 8/53 (15%)

Query: 256 GQPAKALDVIRQGLQLF--------PNYADLHYYGGLSLLQLKHYHKAVELFL 300
            Q     D++ + L+L             +   Y G SL         +   +
Sbjct: 271 NQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRESDIPASV 323


>1elwA [a.118.8.1] TPR1-DOMAIN OF HOP
          Length = 117

 Score = 41.1 bits (95), Expect = 1e-06
 Identities = 25/125 (20%), Positives = 40/125 (32%), Gaps = 11/125 (8%)

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQ 301
              L+       S G    AL    + ++L P+   L+     +  +   Y KA E   +
Sbjct: 3   VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCK 62

Query: 302 AVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
            V L     +  S        +L  L         +EEA R Y E L+         E +
Sbjct: 63  TVDLKPDWGKGYSRK----AAALEFLN-------RFEEAKRTYEEGLKHEANNPQLKEGL 111

Query: 362 IKILK 366
             +  
Sbjct: 112 QNMEA 116



 Score = 36.9 bits (84), Expect = 2e-05
 Identities = 13/114 (11%), Positives = 34/114 (29%), Gaps = 2/114 (1%)

Query: 322 RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV 381
             L   G  A    N ++AL+ Y E+++ +P               + + +   E   K 
Sbjct: 4   NELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKT 63

Query: 382 --LDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQ 433
             L     +     +        ++      E  ++   ++ ++         +
Sbjct: 64  VDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR 117



 Score = 34.6 bits (78), Expect = 1e-04
 Identities = 14/98 (14%), Positives = 31/98 (31%), Gaps = 4/98 (4%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
              G +        +A +   +A         +   L      AY   G   KA +   +
Sbjct: 7   KEKGNKALSVGNIDDALQCYSEAIKLDP----HNHVLYSNRSAAYAKKGDYQKAYEDGCK 62

Query: 268 GLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
            + L P++   +     +L  L  + +A   + + +  
Sbjct: 63  TVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 100



 Score = 33.4 bits (75), Expect = 2e-04
 Identities = 16/127 (12%), Positives = 40/127 (31%), Gaps = 13/127 (10%)

Query: 275 YADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVF 334
             +     G   L + +   A++ + +A+ L                    +        
Sbjct: 2   QVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVL-----------YSNRSAAYAKK 50

Query: 335 LNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV--LDFSSPQATLI 392
            +Y++A     +++   P +     R    L+     E  +   E+    + ++PQ    
Sbjct: 51  GDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEG 110

Query: 393 LSNIFFQ 399
           L N+  +
Sbjct: 111 LQNMEAR 117



 Score = 33.0 bits (74), Expect = 3e-04
 Identities = 11/86 (12%), Positives = 25/86 (29%)

Query: 542 RVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEA 601
           ++DP               +  Y +   +  +        G+ +   A     L  F EA
Sbjct: 31  KLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEA 90

Query: 602 DHHYRYAIELDPSQPRYYISQSKLYE 627
              Y   ++ + + P+       +  
Sbjct: 91  KRTYEEGLKHEANNPQLKEGLQNMEA 116



 Score = 32.6 bits (73), Expect = 4e-04
 Identities = 12/55 (21%), Positives = 21/55 (38%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRSEKIK 634
           +              +G+  +A   Y  AI+LDP     Y ++S  Y  + +  K
Sbjct: 1   EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQK 55


>1q7sA [c.131.1.1] BIT1
          Length = 117

 Score = 40.8 bits (95), Expect = 1e-06
 Identities = 12/107 (11%), Positives = 26/107 (24%), Gaps = 9/107 (8%)

Query: 247 YIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLK--HYHKAVELFLQAVA 304
            +     +      A+   +Q  +  P       Y G   + +K       + L   A  
Sbjct: 14  KMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKM 73

Query: 305 LPEQPPQYASFAGVRGFRSLYHLG--EIAEVFLNYEEALRYYLESLR 349
           L                R+    G   +  +     + +      L+
Sbjct: 74  LGLTVSLIQDAG-----RTQIAPGSQTVLGIGPGPADLIDKVTGHLK 115



 Score = 32.7 bits (74), Expect = 4e-04
 Identities = 9/109 (8%), Positives = 24/109 (22%), Gaps = 19/109 (17%)

Query: 207 KYHYGVELYRAERYGEAAEVLIQA-ANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVI 265
               G     A+    A     Q    N +    +       +V+           + ++
Sbjct: 12  DLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAP---DEETLIALL 68

Query: 266 RQGLQLFPNYADLHYYGGLSLLQ---------------LKHYHKAVELF 299
                L    + +   G   +                 +      ++L+
Sbjct: 69  AHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY 117


>2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111
          Length = 104

 Score = 40.3 bits (94), Expect = 2e-06
 Identities = 12/79 (15%), Positives = 28/79 (35%), Gaps = 4/79 (5%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
                  A           +  +Y +A++L+  AV       +Y +       ++   + 
Sbjct: 4   TSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGD----KAKQSIR 59

Query: 329 EIAEVFLNYEEALRYYLES 347
                +L+  E L+ YL++
Sbjct: 60  AKCTEYLDRAEKLKEYLKN 78



 Score = 38.7 bits (90), Expect = 6e-06
 Identities = 14/65 (21%), Positives = 25/65 (38%), Gaps = 10/65 (15%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYE----------DR 629
           Q        A    + G++ EA   Y++A++      +Y     K  +          DR
Sbjct: 9   QKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDR 68

Query: 630 SEKIK 634
           +EK+K
Sbjct: 69  AEKLK 73



 Score = 34.1 bits (78), Expect = 2e-04
 Identities = 7/55 (12%), Positives = 15/55 (27%)

Query: 241 FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKA 295
               L          G   +AL + +  +Q F +       G  +   ++     
Sbjct: 10  KAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTE 64


>2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129
          Length = 126

 Score = 39.3 bits (91), Expect = 4e-06
 Identities = 9/71 (12%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 559 YHEHGYYEKTVELLQEYIEANQNG--EAHFLLAETHRELGDFIEADHHYRYAIELDPSQP 616
             +       V++L +  +  ++   E  + L     +LG++  A  +     E + +  
Sbjct: 49  STDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNK 108

Query: 617 RYYISQSKLYE 627
           +    +S + +
Sbjct: 109 QVGALKSMVED 119



 Score = 36.2 bits (83), Expect = 4e-05
 Identities = 13/102 (12%), Positives = 26/102 (25%), Gaps = 5/102 (4%)

Query: 209 HYGVELYRAE--RYGEAAEVLIQAANNTDSSTIYFPKLLRY--IVLAYHSGGQPAKALDV 264
            +   L  A    Y +  E+L Q   +    T        Y   ++           + +
Sbjct: 2   DFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKI 61

Query: 265 IRQGLQLFP-NYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
           +    +       +  YY  +   +L  Y  A          
Sbjct: 62  LTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEH 103



 Score = 36.2 bits (83), Expect = 4e-05
 Identities = 7/90 (7%), Positives = 26/90 (28%), Gaps = 3/90 (3%)

Query: 203 NYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKAL 262
           +        ++           ++L       +S      + L Y+ +  +  G+ + A 
Sbjct: 38  SRFNYAWGLIKSTDVNDERLGVKILTDIYKEAES---RRRECLYYLTIGCYKLGEYSMAK 94

Query: 263 DVIRQGLQLFPNYADLHYYGGLSLLQLKHY 292
             +    +   N   +     +   +++  
Sbjct: 95  RYVDTLFEHERNNKQVGALKSMVEDKIQKE 124



 Score = 34.3 bits (78), Expect = 1e-04
 Identities = 14/128 (10%), Positives = 28/128 (21%), Gaps = 16/128 (12%)

Query: 244 LLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYY-----GGLSLLQLKHYHKAVEL 298
               +  AY     P +   + +Q +      A +        G +    +      V++
Sbjct: 3   FWPTLKDAYEPLY-PQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKI 61

Query: 299 FLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPAL 358
                       +            LY+L         Y  A RY           +   
Sbjct: 62  LTDIYKE--AESRRREC--------LYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVG 111

Query: 359 ERIIKILK 366
                +  
Sbjct: 112 ALKSMVED 119


>2fezA2 [a.118.8.3] PROBABLE REGULATORY PROTEIN EMBR A:105 -- 283
          Length = 179

 Score = 39.2 bits (90), Expect = 5e-06
 Identities = 12/114 (10%), Positives = 23/114 (20%), Gaps = 4/114 (3%)

Query: 182 QKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYF 241
             D       +            L             R       L              
Sbjct: 45  VLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYR---- 100

Query: 242 PKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKA 295
             L   ++ AY+   + + AL   R+      +   +     L  L  +   + 
Sbjct: 101 EPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQ 154



 Score = 37.3 bits (85), Expect = 2e-05
 Identities = 15/162 (9%), Positives = 28/162 (17%), Gaps = 27/162 (16%)

Query: 200 NPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPA 259
           + G ++ +   GV    A R+ +A+  L  A                             
Sbjct: 7   DLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREW----------------RGPVLDDLR 50

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVR 319
               V      L  +    H     + +        +                       
Sbjct: 51  DFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYRE--------- 101

Query: 320 GFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERI 361
                  L     +     +AL  Y                 
Sbjct: 102 --PLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGP 141



 Score = 36.9 bits (84), Expect = 2e-05
 Identities = 9/148 (6%), Positives = 25/148 (16%), Gaps = 13/148 (8%)

Query: 270 QLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGF-------- 321
                        G+       + +A      A+     P                    
Sbjct: 5   TCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVE 64

Query: 322 ---RSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECL 378
               +     E           +        ++P  +P   ++I      +         
Sbjct: 65  DKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAY 124

Query: 379 EKVL--DFSSPQATLILSNIFFQQGAYK 404
            +V              +     +   +
Sbjct: 125 RRVKTTLADDLGIDPGPTLRALNERILR 152



 Score = 35.3 bits (80), Expect = 7e-05
 Identities = 6/76 (7%), Positives = 12/76 (15%), Gaps = 1/76 (1%)

Query: 552 MLDIIRLYHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIE 610
                      G     +  L+     +         L   +       +A   YR    
Sbjct: 70  HTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKT 129

Query: 611 LDPSQPRYYISQSKLY 626
                       +   
Sbjct: 130 TLADDLGIDPGPTLRA 145


>2crbA1 [a.7.16.1] NUCLEAR RECEPTOR BINDING FACTOR 2 A:8 -- 90
          Length = 83

 Score = 38.9 bits (90), Expect = 5e-06
 Identities = 6/62 (9%), Positives = 16/62 (25%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
                G YE+ +   ++               + H  L    ++       I+    + +
Sbjct: 17  RLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAK 76

Query: 618 YY 619
             
Sbjct: 77  RE 78



 Score = 33.5 bits (76), Expect = 2e-04
 Identities = 11/92 (11%), Positives = 23/92 (25%), Gaps = 12/92 (13%)

Query: 269 LQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLG 328
           ++   N A         LL    Y +A+    +A     +               L    
Sbjct: 1   MEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSE------------AMKLTESE 48

Query: 329 EIAEVFLNYEEALRYYLESLRDNPGFQPALER 360
           +         ++    L  +++        ER
Sbjct: 49  QAHLSLELQRDSHMKQLLLIQERWKRAKREER 80


>1a87A [f.1.1.1] COLICIN N
          Length = 297

 Score = 38.7 bits (89), Expect = 6e-06
 Identities = 11/156 (7%), Positives = 36/156 (23%), Gaps = 12/156 (7%)

Query: 217 AERYGEAAEVLIQAA-----NNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQL 271
           +    +  E L            +    +  + +R    A  S  +      +       
Sbjct: 114 SGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDK 173

Query: 272 FPNY-ADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEI 330
                A           ++ +  KA ++   A+ + +   +           +  + G +
Sbjct: 174 DAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKS------IEGYNTGNWGPL 227

Query: 331 AEVFLNYEEALRYYLESLRDNPGFQPALERIIKILK 366
                ++         ++         L      + 
Sbjct: 228 LLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVT 263



 Score = 33.7 bits (76), Expect = 2e-04
 Identities = 10/90 (11%), Positives = 24/90 (26%), Gaps = 6/90 (6%)

Query: 544 DPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQ------NGEAHFLLAETHRELGD 597
           D      + ++   + ++ G   K  ++    I+  +       G           E+  
Sbjct: 174 DAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVES 233

Query: 598 FIEADHHYRYAIELDPSQPRYYISQSKLYE 627
           +I        AI L  +   +         
Sbjct: 234 WIIGGVVAGVAISLFGAVLSFLPISGLAVT 263



 Score = 32.9 bits (74), Expect = 4e-04
 Identities = 16/148 (10%), Positives = 30/148 (20%), Gaps = 1/148 (0%)

Query: 154 LEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVE 213
               K+    I          Y ++              + K   +   N   + +    
Sbjct: 129 KNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDM 188

Query: 214 LYRAERYGEAAEVLIQAAN-NTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLF 272
             +    G+A +V   A                                  V    + LF
Sbjct: 189 ANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLF 248

Query: 273 PNYADLHYYGGLSLLQLKHYHKAVELFL 300
                     GL++  L         +L
Sbjct: 249 GAVLSFLPISGLAVTALGVIGIMTISYL 276


>1kt0A1 [a.118.8.1] 51 KDA FK506-BINDING PROTEIN A:254 -- 412
          Length = 155

 Score = 38.4 bits (89), Expect = 8e-06
 Identities = 13/77 (16%), Positives = 30/77 (38%), Gaps = 1/77 (1%)

Query: 559 YHEHGYYEKTVELLQEYIEAN-QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
           Y +   Y K VE   + +  +  N +  +   E    + +F  A   +   +E++ ++ +
Sbjct: 74  YLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQ 133

Query: 618 YYISQSKLYEDRSEKIK 634
             + Q K  E      +
Sbjct: 134 ISMCQKKAKEHNERDRR 150



 Score = 37.3 bits (86), Expect = 2e-05
 Identities = 14/106 (13%), Positives = 35/106 (33%), Gaps = 11/106 (10%)

Query: 211 GVELYRAERYGEAAEVLIQAAN-----------NTDSSTIYFPKLLRYIVLAYHSGGQPA 259
           G   ++  +Y +A     +  +            + +S  +       + + Y    +  
Sbjct: 22  GTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYT 81

Query: 260 KALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
           KA++   + L L        Y  G + L +  +  A   F + + +
Sbjct: 82  KAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEV 127


>3ck7A1 [a.118.8.6] SUSD A:42 -- 551
          Length = 496

 Score = 37.6 bits (85), Expect = 1e-05
 Identities = 15/223 (6%), Positives = 36/223 (16%), Gaps = 17/223 (7%)

Query: 220 YGEAAEVLIQAANNTDSSTIYFPKL---LRYIVLAYHSGGQPAKALDVIRQGLQLFPNYA 276
                         TD     F +       +                    +   P+  
Sbjct: 3   QQGVFVKGYAMLGVTDEGESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPSSQ 62

Query: 277 DLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLN 336
              +        +  Y+  ++             +             +        FL+
Sbjct: 63  RTEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQR---------AEIRFLRALHYWYFLD 113

Query: 337 YEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNI 396
                 +      D P  +   E    I       E       +     + +A       
Sbjct: 114 LFGKAPFKEHFSNDLPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKA-----AN 168

Query: 397 FFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCLIQERRFLE 439
           +  +    L             +                 + E
Sbjct: 169 WLLRARLYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSE 211


>2c2lA1 [a.118.8.1] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
           A:24 -- 224
          Length = 201

 Score = 37.4 bits (85), Expect = 2e-05
 Identities = 4/52 (7%), Positives = 13/52 (25%)

Query: 566 EKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPR 617
           E+  EL +       + +   + A+         +              + +
Sbjct: 150 ERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRK 201



 Score = 32.8 bits (73), Expect = 4e-04
 Identities = 8/40 (20%), Positives = 12/40 (30%)

Query: 580 QNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYY 619
            + +              + EA   Y  AI  +P    YY
Sbjct: 2   PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYY 41



 Score = 32.0 bits (71), Expect = 7e-04
 Identities = 14/181 (7%), Positives = 45/181 (24%), Gaps = 19/181 (10%)

Query: 190 LHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIV 249
                + +  NP   +   +  +   + ++  +A     +A            K   ++ 
Sbjct: 24  AACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDG----QSVKAHFFLG 79

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQ 308
                     +A+  +++   L             S L++    +   +  + +    E 
Sbjct: 80  QCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESEL 139

Query: 309 PPQYASFAGVRGFRSL--------------YHLGEIAEVFLNYEEALRYYLESLRDNPGF 354
                        R L              +   + A +   +++ +    E        
Sbjct: 140 HSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK 199

Query: 355 Q 355
           +
Sbjct: 200 R 200


>1nznA [a.118.8.1] FISSION PROTEIN FIS1P
          Length = 122

 Score = 36.9 bits (84), Expect = 2e-05
 Identities = 15/116 (12%), Positives = 30/116 (25%), Gaps = 6/116 (5%)

Query: 251 AYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPP 310
              S     K     +             +     L++ ++     +       +     
Sbjct: 8   ELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRTRYNDDIRK------GIVLLEE 61

Query: 311 QYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILK 366
                +       +++L         YE+AL+Y    L+  P    A E    I K
Sbjct: 62  LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDK 117



 Score = 33.1 bits (74), Expect = 3e-04
 Identities = 14/100 (14%), Positives = 31/100 (31%), Gaps = 3/100 (3%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQ 267
                EL   E   +  +   Q+     S +        + ++         K + ++ +
Sbjct: 3   EAVLNELVSVEDLLKFEK-KFQSEKAAGSVSKSTQFEYAWCLVRTRYNDDIRKGIVLLEE 61

Query: 268 GLQL--FPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL 305
            L         D  +Y  +   +LK Y KA++     +  
Sbjct: 62  LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQT 101


>2fsqA1 [d.61.1.4] ATU0111 PROTEIN A:6 -- 237
          Length = 232

 Score = 36.7 bits (84), Expect = 3e-05
 Identities = 15/206 (7%), Positives = 31/206 (15%), Gaps = 38/206 (18%)

Query: 251 AYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPP 310
              +         +  +         +        L++      A+    Q         
Sbjct: 7   YISTANHDQPPRHLGSRFSAEGEFLPEPGNTVVCHLVEGSQTESAIVSTRQRFLD-XPEA 65

Query: 311 QYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPREN 370
              +F  V         G I       E          +  P   P              
Sbjct: 66  SQLAFTPVSSLHXTVFQGVI-------ESRRALP-YWPQTLPLDTPIDAVTDYYR----- 112

Query: 371 PEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFC 430
                                   +              +  L  +G             
Sbjct: 113 ------------------------DRLSTFPTLPAFNXRVTGLRPVGXVXKGATAEDDSI 148

Query: 431 LIQERRFLEALRILNEYTADSYIYPL 456
           +   R              D+Y + +
Sbjct: 149 VALWRDTFADFFGYRHPDHDTYEFHI 174



 Score = 32.9 bits (74), Expect = 4e-04
 Identities = 19/205 (9%), Positives = 38/205 (18%), Gaps = 18/205 (8%)

Query: 216 RAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNY 275
            A        +  + +   +        ++         G Q   A+   RQ     P  
Sbjct: 10  TANHDQPPRHLGSRFSAEGEFLPEPGNTVVC----HLVEGSQTESAIVSTRQRFLDXPEA 65

Query: 276 ADLHYYGGLSLLQLKH---YHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAE 332
           + L +    SL              L      LP   P  A            +  +   
Sbjct: 66  SQLAFTPVSSLHXTVFQGVIESRRALPYWPQTLPLDTPIDAVTD---------YYRDRLS 116

Query: 333 VFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLI 392
            F                    + A      I+    +              +      +
Sbjct: 117 TFPTLPAFNXRVTGLRPVGXVXKGATAEDDSIVALWRDTFADFFGYRHPDHDTYEFHITL 176

Query: 393 LSNIFFQQGAYKLTLEFLERLIRMG 417
             +        +    +   L    
Sbjct: 177 --SYIVSWFEPECLPRWQAXLDEEL 199


>1zu2A1 [a.118.8.1] MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM20-3
           A:1 -- 145
          Length = 145

 Score = 34.8 bits (78), Expect = 1e-04
 Identities = 17/126 (13%), Positives = 41/126 (32%), Gaps = 10/126 (7%)

Query: 251 AYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLK----------HYHKAVELFL 300
            +       +         +  P  AD     G  LL+L              +A+  F 
Sbjct: 6   EFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFE 65

Query: 301 QAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALER 360
           +A+ +  +  +     G       +   +  E   N++ A +++ +++ + P     L+ 
Sbjct: 66  EALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKS 125

Query: 361 IIKILK 366
           +    K
Sbjct: 126 LEMTAK 131


>1hxiA [a.118.8.1] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
          Length = 112

 Score = 34.0 bits (78), Expect = 2e-04
 Identities = 15/86 (17%), Positives = 26/86 (30%), Gaps = 6/86 (6%)

Query: 544 DPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADH 603
           +P   G   L +  L      +E   +         +  EA   L  T  E      A  
Sbjct: 18  NPXEEGLSXLKLANLAEAALAFEAVCQK------EPEREEAWRSLGLTQAENEKDGLAII 71

Query: 604 HYRYAIELDPSQPRYYISQSKLYEDR 629
              +A  LDP     + + +  + + 
Sbjct: 72  ALNHARXLDPKDIAVHAALAVSHTNE 97



 Score = 32.1 bits (73), Expect = 6e-04
 Identities = 12/77 (15%), Positives = 22/77 (28%), Gaps = 6/77 (7%)

Query: 266 RQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVAL-PEQPPQYASFAGVRGFRSL 324
               Q  P   +     GL+  + +    A+     A  L P+    +A+ A      S 
Sbjct: 40  EAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARXLDPKDIAVHAALA-----VSH 94

Query: 325 YHLGEIAEVFLNYEEAL 341
            +         +    L
Sbjct: 95  TNEHNANAALASLRAWL 111



 Score = 32.1 bits (73), Expect = 6e-04
 Identities = 7/50 (14%), Positives = 15/50 (30%)

Query: 250 LAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELF 299
           L      +   A+  +     L P    +H    +S     + + A+   
Sbjct: 58  LTQAENEKDGLAIIALNHARXLDPKDIAVHAALAVSHTNEHNANAALASL 107



 Score = 31.7 bits (72), Expect = 8e-04
 Identities = 14/90 (15%), Positives = 22/90 (24%), Gaps = 9/90 (10%)

Query: 327 LGEIAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKV--LDF 384
           L  +AE  L +E   +         P  + A   +       E        L     LD 
Sbjct: 29  LANLAEAALAFEAVCQK-------EPEREEAWRSLGLTQAENEKDGLAIIALNHARXLDP 81

Query: 385 SSPQATLILSNIFFQQGAYKLTLEFLERLI 414
                   L+     +      L  L   +
Sbjct: 82  KDIAVHAALAVSHTNEHNANAALASLRAWL 111


>1fchA [a.118.8.1] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
          Length = 302

 Score = 33.4 bits (74), Expect = 2e-04
 Identities = 6/70 (8%), Positives = 21/70 (30%), Gaps = 5/70 (7%)

Query: 240 YFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYG-----GLSLLQLKHYHK 294
            + +    + ++  + G   +A++   + L +                 L+L  L     
Sbjct: 223 GYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSGGAMSENIWSTLRLALSMLGQSDA 282

Query: 295 AVELFLQAVA 304
                 + ++
Sbjct: 283 YGAADARDLS 292


>1tjcA [a.118.8.1] PROLYL 4-HYDROXYLASE ALPHA-1 SUBUNIT
          Length = 95

 Score = 32.2 bits (73), Expect = 6e-04
 Identities = 15/86 (17%), Positives = 27/86 (31%), Gaps = 3/86 (3%)

Query: 208 YHYGVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIV---LAYHSGGQPAKALDV 264
           +  G   Y    Y      + QA    D   I     +  +     A +  G   KAL +
Sbjct: 9   FELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLL 68

Query: 265 IRQGLQLFPNYADLHYYGGLSLLQLK 290
            ++ L+L P +   +         + 
Sbjct: 69  TKKLLELDPEHQRANGNLKYFEYIMA 94



 Score = 31.9 bits (72), Expect = 7e-04
 Identities = 11/78 (14%), Positives = 23/78 (29%), Gaps = 8/78 (10%)

Query: 558 LYHEHGYYEKTVELLQEYIEANQN--------GEAHFLLAETHRELGDFIEADHHYRYAI 609
           + +    Y  T   +++ +                   L+    + GD  +A    +  +
Sbjct: 14  VAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLL 73

Query: 610 ELDPSQPRYYISQSKLYE 627
           ELDP   R   +      
Sbjct: 74  ELDPEHQRANGNLKYFEY 91


>1a17A [a.118.8.1] SERINE/THREONINE PROTEIN PHOSPHATASE 5
          Length = 159

 Score = 32.0 bits (71), Expect = 6e-04
 Identities = 17/162 (10%), Positives = 38/162 (23%), Gaps = 7/162 (4%)

Query: 270 QLFPNYADLHYYGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGE 329
                 A+          + K Y  A++ + QA+ L      Y          +      
Sbjct: 4   DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRS----LAYLRTEC 59

Query: 330 IAEVFLNYEEALRYYLESLRDNPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQA 389
                 +     R      +   G+       + + K R         ++        + 
Sbjct: 60  YGYALGDAT---RAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKM 116

Query: 390 TLILSNIFFQQGAYKLTLEFLERLIRMGNSSAEILFRKSFCL 431
                N   +Q A++  +   E    + +S            
Sbjct: 117 KYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEY 158


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0582    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 22,301,021
Number of extensions: 1657300
Number of successful extensions: 7243
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 6503
Number of HSP's successfully gapped: 714
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)