RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABO50103.1 dred0 ABO50103.1 GIB00494CH01
"binding-protein-dependent transport systems inne.."
         (254 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG...    64   2e-13
2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE ...    45   7e-08
3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN...    43   4e-07
1tluA [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,        37   3e-05

>2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
           G:7 -- 296
          Length = 284

 Score = 63.8 bits (155), Expect = 2e-13
 Identities = 26/229 (11%), Positives = 57/229 (24%), Gaps = 17/229 (7%)

Query: 36  KVLQTALDLTASGILLKHITISLYRVFAGFLLTVLFAFPLAILVGINQR----------- 84
             L  ++       +L  +  S+       +  V  +   A      +            
Sbjct: 55  LALGFSVITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGML 114

Query: 85  LAPYIDPVLDFLGHXXXXXXXXXXXXWFGIGETSKLAVIILATFFPVFLNTLNGILGCNK 144
           +      VL  +              + G+     +    L                 + 
Sbjct: 115 IFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDS 174

Query: 145 QLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGAELIAASSGIG--- 201
            L E   + G T    F  +++P ++P + V F L    +   +  A L+          
Sbjct: 175 SLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLA 234

Query: 202 ---YMIIDAEQLSRPDIIIVGILTIGLFGYIIDYCFFKLTNHLIPWAGK 247
                 ++ +     D     +++      +       L N L     K
Sbjct: 235 VGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVK 283


>2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
           -- 252
          Length = 252

 Score = 45.4 bits (107), Expect = 7e-08
 Identities = 24/221 (10%), Positives = 59/221 (26%), Gaps = 21/221 (9%)

Query: 27  NQYIIPPPTKVLQTALDLTASGILLKHITISLYRVFAGFLLTVLFAFPLAILVGINQRLA 86
               +          L   +   + K +  + Y      L+ V+F  PLA ++       
Sbjct: 24  VAATVTLQLFNFDEFLKAASDPAVWKVVLTTYYAALISTLIAVIFGTPLAYILARKSFPG 83

Query: 87  PYIDPVL---------------DFLGHXXXXXXXXXXXXWFGIGETSKLAVIILATFFPV 131
             +   +                 +               F       +  ++  +    
Sbjct: 84  KSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIY 143

Query: 132 FLNTLNGILGCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGA 191
                 G    + +L  V    G +    F  + +P ++  I+ G  +            
Sbjct: 144 INQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFGAV 203

Query: 192 ELIA------ASSGIGYMIIDAEQLSRPDIIIVGILTIGLF 226
            +IA       +      + +    + P   I+ +L++ +F
Sbjct: 204 VVIAYYPMIAPTLIYERYLSEGLSAAMPVAAILILLSLAVF 244


>3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
           A:6 -- 208
          Length = 203

 Score = 43.0 bits (101), Expect = 4e-07
 Identities = 23/166 (13%), Positives = 52/166 (31%), Gaps = 18/166 (10%)

Query: 50  LLKHITISLYRVFAGFLLTVLFAFPLAILVGINQRLAPYIDPVLDFLG------------ 97
           L++ +  +L   F       +   P+ +L+ + +      +  L                
Sbjct: 4   LVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPF 63

Query: 98  --HXXXXXXXXXXXXWFGIGETSKLAVIILATFFPVFLNTLNGILGCNKQLLEVGDVFGF 155
                             IG  + +  + +     +     N +L     L+E     G 
Sbjct: 64  IILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGA 123

Query: 156 TARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGAELIAASSGIG 201
           T      ++++P ALP ++    + L     +L+G   +  + G G
Sbjct: 124 TPMQIVRKVLLPEALPGLVNAATITLI----TLVGYSAMGGAVGAG 165


>1tluA [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
          Length = 117

 Score = 36.9 bits (85), Expect = 3e-05
 Identities = 11/83 (13%), Positives = 25/83 (30%)

Query: 120 LAVIILATFFPVFLNTLNGILGCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRL 179
           L   ++A F+      L+ +    +++ +     G T         +P  +  ++V    
Sbjct: 3   LGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVISES 62

Query: 180 GLGYSWRSLIGAELIAASSGIGY 202
            L        G   I   +    
Sbjct: 63  HLTIHTWPEYGYAAIDLFTCGED 85


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.312    0.130    0.341 

Gapped
Lambda     K      H
   0.267   0.0565    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 12,715,535
Number of extensions: 877922
Number of successful extensions: 4017
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 3722
Number of HSP's successfully gapped: 278
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)