RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABO50753.1 dred0 ABO50753.1 GIB00494CH01 "Extracellular
ligand-binding receptor"
         (394 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1usgA [c.93.1.1] LEUCINE-SPECIFIC BINDING PROTEIN                     244   2e-67
3ckmA1 [c.93.1.1] YRAM (HI1655) A:257 -- 573                          153   4e-40
1peaA [c.93.1.1] AMIDASE OPERON                                       146   4e-38
1dp4A [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A                104   2e-25
1jdnA [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE CLEARANCE RECEPTOR         94   2e-22
1n2zA [c.92.2.2] VITAMIN B12 TRANSPORT PROTEIN BTUF                    33   8e-04
2gmnA1 [d.157.1.1] METALLO-BETA-LACTAMASE A:29 -- 292                  33   8e-04

>1usgA [c.93.1.1] LEUCINE-SPECIFIC BINDING PROTEIN
          Length = 345

 Score =  244 bits (623), Expect = 2e-67
 Identities = 84/341 (24%), Positives = 154/341 (45%), Gaps = 10/341 (2%)

Query: 37  NEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVNAAGGVLGKKIKFNVMDNKSDATEAAN 96
           ++I +     +SGP+A +G    NGA    +++NA GG+ G K+     D+  D  +A  
Sbjct: 1   DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVA 60

Query: 97  VATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTALEVTVDPNTKKVRDYV 156
           VA +++  D +  V+G   S +T     +  D  + +I+P  T  E+T     ++   ++
Sbjct: 61  VANKIV-NDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELT-----QRGYQHI 114

Query: 157 FRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEE 216
            RT  +D  QG   A +    +K +   +  D Q  Y +GLA+  +D        +V  +
Sbjct: 115 MRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKAANANVVFFD 173

Query: 217 AFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKL 276
                ++DF A + ++K  N D +Y   YY  +G++++Q R +G+   F+G +G  +  L
Sbjct: 174 GITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASL 233

Query: 277 PEIAGGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAI 336
             IAG AA      +      + DP  +G V+  +A        +  + Y     L  A+
Sbjct: 234 SNIAGDAA-EGMLVTMPKRYDQ-DPANQGIVDALKADKKDPSGPYVWITYAAVQSLATAL 291

Query: 337 KRSEDASPEKIKEALANAKDVQAITGKLSFDENHNPIKGAV 377
           +R+    P  + + L  A     + G L++DE  +      
Sbjct: 292 ERTGSDEPLALVKDLK-ANGANTVIGPLNWDEKGDLKGFDF 331


>3ckmA1 [c.93.1.1] YRAM (HI1655) A:257 -- 573
          Length = 317

 Score =  153 bits (387), Expect = 4e-40
 Identities = 51/350 (14%), Positives = 95/350 (27%), Gaps = 40/350 (11%)

Query: 41  IGGNLELSGPVATFGTAMKNGAEMYFEEVNAAGGVLGKKIKFNVMDNKSDATEAANVATR 100
           IG  L LSG     GT +++G                  I   V D   ++ +       
Sbjct: 3   IGLLLPLSGDGQILGTTIQSGFND---------AKGNSTIPVQVFDTSXNSVQDII---A 50

Query: 101 LITQDKVVAVMGAATSGNTMGFM-QVATDNKVPIITPSGTALEVTVDPNTKKVRDYVFRT 159
              Q  +  ++G     N    +   A      ++  + T           +    +   
Sbjct: 51  QAKQAGIKTLVGPLLKQNLDVILADPAQIQGXDVLALNATP--------NSRAIPQLCYY 102

Query: 160 CFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEEAFM 219
                 +    AN   ND      V    N     + +   F   + +  G       + 
Sbjct: 103 GLSPEDEAESAANKXWNDGVRNPLVAXPQND--LGQRVGNAFNVRWQQLAGTDANIRYY- 159

Query: 220 PEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEI 279
               D    + +    N   +Y  A    + +       I   +         +      
Sbjct: 160 NLPADVTYFVQENNS-NTTALYAVASPTELAEXKGYLTNIVPNLAIYASSRASASATNTN 218

Query: 280 -AGGAALNNTYFSN-HYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIK 337
               A  N   FS+  +    + P+ +   +    ++        A G D A LL++   
Sbjct: 219 TDFIAQXNGVQFSDIPFFKDTNSPQYQKLAKSTGGEYQLXR--LYAXGAD-AWLLINQFN 275

Query: 338 RSEDASPEKIKEALANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQV 387
                     +        +  +TG LS D N N  +     + +DG  V
Sbjct: 276 ----------ELRQVPGYRLSGLTGILSADTNCNVERDXTWYQYQDGAIV 315


>1peaA [c.93.1.1] AMIDASE OPERON
          Length = 368

 Score =  146 bits (368), Expect = 4e-38
 Identities = 57/359 (15%), Positives = 117/359 (32%), Gaps = 19/359 (5%)

Query: 40  VIGGNLELSGPVATFGTAMKNGAEMYFEEVNAAGGVLGKKIKFNVMDNKSDATEAANVAT 99
           +IG     +G  A    + + GA +  E++N  GGV G+ I+    D   D       A 
Sbjct: 2   LIGLLFSETGVTADIERSQRYGALLAVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAE 61

Query: 100 RLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTALEVTVDPNTKKVRDYVFRT 159
             I    V  ++G   S      M V       +  P+                  +   
Sbjct: 62  DFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLCYPTPYEGFEY--------SPNIVYG 113

Query: 160 CFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEEAFM 219
                     +A +       +  V+++ +   Y +      +  + + GG ++ E    
Sbjct: 114 GPAPNQNSAPLAAYLIRHYGER--VVFIGSDYIYPRESNHVMRHLYRQHGGTVLEEIYIP 171

Query: 220 --PEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGI--TVPFLGGDGWDSPK 275
             P D D +  + +I     DV++         ++ +           P +        +
Sbjct: 172 LYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAE 231

Query: 276 LPEIAGGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQ--VPDTFAALGYDTAVLLV 333
           + ++    A         Y S  D P  + FV+     F +      +A   Y   +LL 
Sbjct: 232 VAKMESDVA-EGQVVVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLG 290

Query: 334 DAIKRSEDASPEKIKEALANAKDVQAITGKLSFD-ENHNPIKGAVILEMKDGKQVYKTY 391
            A + + +   E ++  L +  D+ A  G +  + +N++    + I E+         +
Sbjct: 291 RAAQAAGNWRVEDVQRHLYD-IDIDAPQGPVRVERQNNHSRLSSRIAEIDARGVFQVRW 348


>1dp4A [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
          Length = 425

 Score =  104 bits (258), Expect = 2e-25
 Identities = 37/291 (12%), Positives = 79/291 (27%), Gaps = 22/291 (7%)

Query: 37  NEIVIGGNLELSGPVATFGTA-MKNGAEMYFEEVNAAGGVL-GKKIKFNVMDNKSDATEA 94
           +++ +   L L+     +  A +    E+    V A   +L G  ++  +  +++ A   
Sbjct: 1   SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVC 60

Query: 95  ANVA-----TRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTALEVTVDPNT 149
           ++ A       L  +      +G     +     +     +VP++T    AL +      
Sbjct: 61  SDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIG----V 116

Query: 150 KKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQG 209
           K       RT       G  +            A++              FF    +   
Sbjct: 117 KDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVL--YADRLGDDRPCFFIVEGLYMR 174

Query: 210 GKI-----VGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVP 264
            +      V  + F+  D D    L +       VIY+ +  +    ++      G+T  
Sbjct: 175 VRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGE 234

Query: 265 --FLGGDGWDSPKLPEIAGGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAK 313
                        L    G          +         +     +    K
Sbjct: 235 DYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDR--SARQAFQAAKIITYK 283


>1jdnA [c.93.1.1] ATRIAL NATRIURETIC PEPTIDE CLEARANCE RECEPTOR
          Length = 407

 Score = 94.2 bits (232), Expect = 2e-22
 Identities = 44/382 (11%), Positives = 105/382 (27%), Gaps = 35/382 (9%)

Query: 38  EIVIGGNLELSGPVATFGTAMKNGAEMYFEEVNAAGGVLGKKIKFNVMDNKSDATEAANV 97
           +I +   L          T ++   E     V       G + +    D+        ++
Sbjct: 3   KIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEG--LPPGTRFQVAYEDSDCGNRALFSL 60

Query: 98  ATRLITQ--DKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTALEVTVDPNTKKVRDY 155
             R+      K   ++G           ++A+   +P+++    A       +      +
Sbjct: 61  VDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQ---HKDSEYSH 117

Query: 156 VFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG--KIV 213
           + R        G +M     +   ++ A++Y D++           +             
Sbjct: 118 LTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNC--YFTLEGVHEVFQEEGLHT 175

Query: 214 GEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGIT----------- 262
              +F          + +    +  V+ + A  + +  I+      G+T           
Sbjct: 176 SIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIEL 235

Query: 263 -VPFLGGDGWDSPKLPEIAGGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTF 321
                 GDG                ++  +         PE + F  + ++   +     
Sbjct: 236 FNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRT-VKPEFEKFSMEVKSSVEKQGLNM 294

Query: 322 -------AALGYDTAVLLVDAIKRSEDASPEKIKEALANAKDVQ----AITGKLSFDENH 370
                      +D  +L V A+     A   K        +        I G++S D N 
Sbjct: 295 EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANG 354

Query: 371 NPIKGAVILEMKDGKQVYKTYV 392
           +      ++ M D +   +  +
Sbjct: 355 DRYGDFSVIAMTDVEAGTQEVI 376


>1n2zA [c.92.2.2] VITAMIN B12 TRANSPORT PROTEIN BTUF
          Length = 245

 Score = 32.6 bits (74), Expect = 8e-04
 Identities = 22/111 (19%), Positives = 40/111 (36%), Gaps = 9/111 (8%)

Query: 177 DLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEEAFMPEDQDFKATLT--KIKG 234
           D   K   L      P+  G     K+S   Q  ++ G E    + +     ++  ++  
Sbjct: 131 DKPKKRVFLQFGINPPFTSG-----KESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLA 185

Query: 235 LNPDVIYVPAYYEPVGKIV-KQGREIGITVPFLGGDGWDSPKLPEIAGGAA 284
            +P  I +    + + KI    G ++ I V  L  D ++    P I   A 
Sbjct: 186 RSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERAS-PRIILAAQ 235


>2gmnA1 [d.157.1.1] METALLO-BETA-LACTAMASE A:29 -- 292
          Length = 264

 Score = 32.6 bits (73), Expect = 8e-04
 Identities = 28/162 (17%), Positives = 52/162 (32%), Gaps = 16/162 (9%)

Query: 118 NTMGFMQVATDNKVPIITPSGTA--LEVTVDPNTKKVRDYVFRTCFIDPF---------- 165
           +T GF ++  +    ++        LE    P  +K  D  F    +D            
Sbjct: 78  HTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLG 137

Query: 166 QGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEEAFMPEDQDF 225
              + A+         T+           + +  F   +        VG+  +     D+
Sbjct: 138 DTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRL--VGQPTYAGIVDDY 195

Query: 226 KATLTKIKGLNPDVIYVPAYYEPVGKIVK-QGREIGITVPFL 266
           +AT  K K +  DV+ +  + E  G   K    + G   PF+
Sbjct: 196 RATFAKAKAMKIDVL-LGPHPEVYGMQAKRAEMKDGAPNPFI 236


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.138    0.400 

Gapped
Lambda     K      H
   0.267   0.0592    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 17,060,189
Number of extensions: 1238626
Number of successful extensions: 4824
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 4638
Number of HSP's successfully gapped: 208
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)