BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV55454.1 elen0 ACV55454.1 GIB01015CH01 "ABC transporter
related"
         (1228 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2hydA [x.x.x] ABC TRANSPORTER HOMOLOG                                 259   4e-71
1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA            227   1e-61
3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                         214   1e-57
3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                         214   1e-57
3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA        208   8e-56
2ghiA [x.x.x] TRANSPORT PROTEIN                                       202   6e-54
2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               199   5e-53
2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               197   1e-52
3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               197   1e-52
1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN               196   4e-52
2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               195   7e-52
2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               194   9e-52
1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               192   6e-51
1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING       188   8e-50
1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING       188   8e-50
2ghiB [x.x.x] TRANSPORT PROTEIN                                       182   5e-48
2ghiC [x.x.x] TRANSPORT PROTEIN                                       181   1e-47
1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA        176   4e-46
2ghiD [x.x.x] TRANSPORT PROTEIN                                       171   1e-44
2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           153   2e-39
2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           153   2e-39
2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           149   3e-38
1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1                               149   6e-38
2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           148   7e-38
2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           145   8e-37
2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           132   5e-33
2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1               102   5e-24
2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN             97   2e-22
2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN             97   2e-22
3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING           92   6e-21
1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING     90   4e-20
2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                90   4e-20
2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                90   4e-20
2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                90   4e-20
3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          90   4e-20
2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          90   4e-20
2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          90   4e-20
2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                89   5e-20
2oukB [x.x.x] PROTEIN ARTP                                             89   7e-20
2oljA [x.x.x] AMINO ACID ABC TRANSPORTER                               89   7e-20
2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          89   9e-20
2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          89   9e-20
1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                 89   9e-20
1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               88   1e-19
1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               88   1e-19
1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               88   1e-19
2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                88   1e-19
2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             88   2e-19
2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             88   2e-19
1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID                 87   2e-19
1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                 87   2e-19
1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               87   3e-19
1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               86   6e-19
2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN               84   3e-18
2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                83   5e-18
1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               82   1e-17
1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        81   1e-17
1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        81   1e-17
2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                81   1e-17
2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                81   1e-17
1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               81   2e-17
3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN               80   2e-17
2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                80   3e-17
1b0uA [c.37.1] HISTIDINE PERMEASE                                      80   3e-17
2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                79   5e-17
1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK        78   2e-16
2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          78   2e-16
2d2fA [x.x.x] SUFC PROTEIN                                             77   2e-16
2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          77   2e-16
2d2eA [x.x.x] SUFC PROTEIN                                             76   6e-16
2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                76   6e-16
3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1                 75   8e-16
2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN         74   2e-15
3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC              73   4e-15
3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC              73   4e-15
1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN             73   5e-15
1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN             73   5e-15
1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        73   5e-15
1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               72   1e-14
2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING         71   2e-14
3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN                      69   6e-14
2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  69   1e-13
2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  69   1e-13
2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  66   5e-13
1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BIN...    66   6e-13
2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING             64   2e-12
2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  64   3e-12
1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           63   5e-12
1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           63   5e-12
2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  61   2e-11
1yqtA [x.x.x] RNASE L INHIBITOR                                        61   2e-11
2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         60   4e-11
1ji0A [c.37.1] ABC TRANSPORTER                                         59   6e-11
1l7vC [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD          59   8e-11
2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         58   1e-10
1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER                                57   2e-10
2qi9C [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD              55   8e-10
2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          55   1e-09
2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               53   5e-09
2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               53   5e-09
2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             53   5e-09
2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             53   5e-09
2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             53   5e-09
1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN                    52   7e-09
2ix3A [x.x.x] ELONGATION FACTOR 3                                      52   1e-08
2iwhB [x.x.x] ELONGATION FACTOR 3A                                     52   1e-08
2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     45   1e-06
2ix8A [x.x.x] ELONGATION FACTOR 3A                                     44   3e-06
2iw3B [x.x.x] ELONGATION FACTOR 3A                                     44   3e-06
2iw3A [x.x.x] ELONGATION FACTOR 3A                                     44   3e-06
2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               43   6e-06
2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               43   6e-06
2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          43   6e-06
2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          43   6e-06
1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           42   1e-05
2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     39   6e-05
1xewY [c.37.1] SMC PROTEIN                                             38   2e-04
2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066                              37   3e-04
1xexB [c.37.1] SMC PROTEIN                                             35   9e-04

>2hydA [x.x.x] ABC TRANSPORTER HOMOLOG
          Length = 578

 Score =  259 bits (661), Expect = 4e-71
 Identities = 159/519 (30%), Positives = 268/519 (51%), Gaps = 17/519 (3%)

Query: 701  AVGLAGMVVVFVASRNDYKKTYVAAYTESE---GTRLRLADHLRKLPMSFFNRRDTTDVA 757
            A+G+A  + V V    ++ + Y+A +T ++     R +L +HL+ L   F+       V 
Sbjct: 62   AIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVI 121

Query: 758  DRIMGDVTAQESMLSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALS 817
             R++ DV   +  + + L  +    ++ ++  +++ F D +L    +   P     + + 
Sbjct: 122  SRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVF 181

Query: 818  RRHQSRLFERQNRVRLDALACVQDYL----EGIKDMRACRAVGKDSAAMEQAMLELKRVT 873
                 +L     R R  ALA VQ +L    +GI  +++      ++   ++         
Sbjct: 182  FGRLRKL----TRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRA 237

Query: 874  MRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGGVDFMVLLMFLLIVSRVYGPILAL 933
            ++       S +  + +   G  +   VGA L  SG +    L  F+  +  ++GP+  L
Sbjct: 238  LKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRL 297

Query: 934  VSQLPNLLNLSTKTARIKAVMDEP----EARGSASADVPGHDLSFQGVRFGYGDEE--VL 987
            V+    L        R+  ++DE        G+   ++    +    V F Y D E  +L
Sbjct: 298  VASFTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPIL 357

Query: 988  HGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHV 1047
              ++    +GE  A VG SG GKST   L  +F++  SG++L  G +I +F   S    +
Sbjct: 358  KDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQI 417

Query: 1048 SIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGAS 1107
             +V QD +LF DTV  NI +GR  A+DEEV EAA+ A+  +FI  LPQG+DT +GE G  
Sbjct: 418  GLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVK 477

Query: 1108 LSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRLR 1167
            LSGG++QRLSIAR  L + P+++LDEAT++LD E+E++IQ A+  L   +T +++AHRL 
Sbjct: 478  LSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLS 537

Query: 1168 TVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRLQ 1206
            T+ +ADKIVV+++G + E G H+ L+A+ G Y  L+ +Q
Sbjct: 538  TITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQ 576



 Score =  186 bits (471), Expect = 4e-49
 Identities = 121/370 (32%), Positives = 178/370 (48%), Gaps = 2/370 (0%)

Query: 217 EYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLP 276
           E V+G+ VVK+F       K       ++   +L  T +   S      V +   + V+ 
Sbjct: 205 ERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIG 264

Query: 277 VGILLA-PGAQDWPTXXXXXXXXXXXXHSISSVFTKILYVSEDGMLAQANIDRIDSVLGI 335
           VG  LA  G+    T              +  +      +++           ID    I
Sbjct: 265 VGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDYDI 324

Query: 336 EELSCPEAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTL 395
           +       P   K   + +  V+F Y D+  P L++++L I  G   A VG SG GKSTL
Sbjct: 325 KN-GVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTL 383

Query: 396 ANLVARFWDVDSGQVLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXX 455
            NL+ RF+DV SGQ+L+ G ++++     L   + LV QD+ LF ++V ENI  GRP   
Sbjct: 384 INLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTAT 443

Query: 456 XXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDE 515
                          FI  LP GY T +G  GV LSGG+            + PI++LDE
Sbjct: 444 DEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDE 503

Query: 516 ATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELL 575
           AT+  D E+E +IQ+A + L   +T ++VAHRLST+  ADKIVV++ G  VE GTH+EL+
Sbjct: 504 ATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELI 563

Query: 576 AASGTYAKMW 585
           A  G Y  ++
Sbjct: 564 AKQGAYEHLY 573


>1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
          Length = 520

 Score =  227 bits (579), Expect = 1e-61
 Identities = 155/492 (31%), Positives = 245/492 (49%), Gaps = 49/492 (9%)

Query: 709  VVFVASRNDYKKTYVAAYTESEGT---RLRLADHLRKLPMSFFNRRDTTDVADRIMGDVT 765
            ++FV   + +  +Y  ++         R RL +H   +P+ FF++  T  +  RI  D  
Sbjct: 65   LMFVRGLSGFASSYCLSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSE 124

Query: 766  AQESMLSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLF 825
                  S  L  ++    S + +  ++ +  W+L+  ++V  P    V+A +    S+ F
Sbjct: 125  QVAGATSRALVSIVREGASIIGLLTLMFWNSWQLSLVLIVVAP----VVAFAISFVSKRF 180

Query: 826  ERQNRVRLDALACVQDYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVS 885
             + +R    A+   Q  ++ +            + ++   ++++                
Sbjct: 181  RKISRNMQTAMGHRQQTMKLVS-----------AQSIADPVIQMIXXXXXXXXXXXXXXD 229

Query: 886  LASAILRSGVGLTACVGAVLLASGGVDFMVLLMFLLIVSRVYG---PILALVSQLPNLLN 942
               A L  G                        F ++ S ++G   P+ AL S       
Sbjct: 230  SIRAELTPGT-----------------------FTVVFSAMFGLMRPLKALTSVTSEFQR 266

Query: 943  LSTKTARIKAVMDEPEAR--GSASADVPGHDLSFQGVRFGYGDEE--VLHGVSFVAREGE 998
                   +  +MD    R  G   A+    ++  + V F Y  +E   L  VSF   +G+
Sbjct: 267  GMAACQTLFGLMDLETERDNGKYEAERVNGEVDVKDVTFTYQGKEKPALSHVSFSIPQGK 326

Query: 999  VTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFD 1058
              ALVG SGSGKST A L  +F++ DSG +   G D+ ++   +   H ++V Q+V LF+
Sbjct: 327  TVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFN 386

Query: 1059 DTVANNIRIGREGA-SDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLS 1117
            DT+ANNI    EG  + E++ +AAR AH +EFIE +PQG DTV+GENG SLSGG+RQR++
Sbjct: 387  DTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVA 446

Query: 1118 IARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIVV 1177
            IARALL+DAPV++LDEAT++LD E+E  IQ A+  L   KTV+VIAHRL T+  AD+I+V
Sbjct: 447  IARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILV 506

Query: 1178 LDSGRVAEEGNH 1189
            +D G + E G H
Sbjct: 507  VDEGEIIERGRH 518



 Score =  175 bits (444), Expect = 6e-46
 Identities = 95/226 (42%), Positives = 130/226 (57%), Gaps = 1/226 (0%)

Query: 349 DASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSG 408
           +  V ++DVTF+Y+   +PAL +VS  IP G   A+VG SGSGKST+ANL  RF+DVDSG
Sbjct: 295 NGEVDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSG 354

Query: 409 QVLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPG-XXXXXXXXXXXXXX 467
            + + G DVR+     L    +LV Q+ HLF +++A NI     G               
Sbjct: 355 SICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAH 414

Query: 468 XXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHL 527
              FI  +P G  TVIG  G  LSGG+            DAP+++LDEAT+  D E+E  
Sbjct: 415 AMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERA 474

Query: 528 IQKAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQE 573
           IQ A + L   KTV+++AHRLST+  AD+I+V+D G  +E G H +
Sbjct: 475 IQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRHAD 520


>3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score =  214 bits (545), Expect = 1e-57
 Identities = 140/470 (29%), Positives = 235/470 (50%), Gaps = 16/470 (3%)

Query: 745  MSFFNRRDTTDVADRIMGDVTAQESMLSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVM 804
            + +F+  D  ++  R+  DV+     +   +      +              W+L   ++
Sbjct: 124  IGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMAXXXXXXXXXXXXXWKLTLVIL 183

Query: 805  VTLP---LSAGVIALSRRHQSRLFERQNRVRLDALACVQDYLEGIKDMRACRAVGKDSAA 861
               P   LSAG+ A   +  S   +++      A A  ++ L  I+ + A     K+   
Sbjct: 184  AISPVLGLSAGIWA---KILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELER 240

Query: 862  MEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGGVDF-MVLLMFL 920
                + E KR+ ++  +  ++S+  A  ++ +   L    G  L+ S       VL +F 
Sbjct: 241  YNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFF 300

Query: 921  LIVSRVY--GPILALVSQLPNLLNLSTKTARI---KAVMDEPEARGSASADVPGHDLSFQ 975
             ++   +  G     +    N    + +  +I   K  +D     G    ++ G+ L F+
Sbjct: 301  SVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGN-LEFK 359

Query: 976  GVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSG 1032
             + F Y      ++L G++   + G+  ALVG SG GKST  QL  + ++P  G V   G
Sbjct: 360  NIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDG 419

Query: 1033 KDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIER 1092
            +DI   +       + +V Q+ VLF  T+A NIR GRE  + +E+ +A + A+  +FI +
Sbjct: 420  QDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMK 479

Query: 1093 LPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGT 1152
            LP  FDT++GE GA LSGG++QR++IARAL+++  ++LLDEAT++LD E+E ++Q A+  
Sbjct: 480  LPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDK 539

Query: 1153 LCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARL 1202
               G+T IVIAHRL TV NAD I   D G + E+GNH  L+ E G+Y +L
Sbjct: 540  AREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKL 589



 Score =  192 bits (489), Expect = 3e-51
 Identities = 103/241 (42%), Positives = 155/241 (64%), Gaps = 5/241 (2%)

Query: 971  DLSFQGVRFGYGDEE---VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR 1027
            ++ F GV F Y       VL G+S   ++G+  ALVG SG GKST  QL  +F++P +G 
Sbjct: 941  NVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGS 1000

Query: 1028 VLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREG--ASDEEVAEAARAAH 1085
            V   GK+I + + +   A + IV Q+ +LFD ++A NI  G      S EE+  AA+ A+
Sbjct: 1001 VFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEAN 1060

Query: 1086 CLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETL 1145
              +FI+ LP  ++T +G+ G  LSGG++QR++IARAL++   ++LLDEAT++LD E+E +
Sbjct: 1061 IHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKV 1120

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRL 1205
            +Q A+     G+T IVIAHRL T+ NAD IVV+ +G+V E G H+ LLA+ G+Y  +  +
Sbjct: 1121 VQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSV 1180

Query: 1206 Q 1206
            Q
Sbjct: 1181 Q 1181



 Score =  148 bits (373), Expect = 9e-38
 Identities = 87/239 (36%), Positives = 127/239 (53%), Gaps = 3/239 (1%)

Query: 349  DASVSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDS 407
            + +V    V F+Y      P L+ +SLE+  G   A+VG SG GKST+  L+ RF+D  +
Sbjct: 939  EGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMA 998

Query: 408  GQVLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXX 467
            G V + G +++++    L   L +V Q+  LF  S+AENI  G                 
Sbjct: 999  GSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKE 1058

Query: 468  XXX--FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE 525
                 FI+ LP  Y T +G +G  LSGG+               I++LDEAT+  D E+E
Sbjct: 1059 ANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESE 1118

Query: 526  HLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
             ++Q+A ++   G+T I++AHRLST+  AD IVV+  G+  E GTHQ+LLA  G Y  M
Sbjct: 1119 KVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSM 1177



 Score =  147 bits (370), Expect = 2e-37
 Identities = 108/388 (27%), Positives = 172/388 (44%), Gaps = 28/388 (7%)

Query: 212 GNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAY 271
           G  + E +  +R V AFG   +  +R ++ +++   L +   +    SM     ++  +Y
Sbjct: 215 GAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASY 274

Query: 272 LFVLPVGILLAPGAQDWPTXXXXXXXXXXXXHSISSVFTKILYVSEDGMLAQANIDR--- 328
                 G  L    +                  + +VF  +L  +     A  NI+    
Sbjct: 275 ALAFWYGTSLVISKE-------------YSIGQVLTVFFSVLIGAFSVGQASPNIEAFAN 321

Query: 329 -----------IDSVLGIEELSCPEAPKAPKDASVSLRDVTFSYEDDAE-PALRNVSLEI 376
                      ID+   I+  S           ++  +++ FSY    E   L+ ++L++
Sbjct: 322 ARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKV 381

Query: 377 PAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMGSLSLVFQDS 436
            +G   A+VG SG GKST   L+ R +D   G V + G D+R +    L   + +V Q+ 
Sbjct: 382 KSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEP 441

Query: 437 HLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXX 496
            LF  ++AENIR GR                   FI  LPH + T++G  G  LSGG+  
Sbjct: 442 VLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQ 501

Query: 497 XXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADK 556
                     +  I++LDEAT+  D E+E ++Q A ++   G+T I++AHRLSTV  AD 
Sbjct: 502 RIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADV 561

Query: 557 IVVLDGGRKVEEGTHQELLAASGTYAKM 584
           I   DGG  VE+G H EL+   G Y K+
Sbjct: 562 IAGFDGGVIVEQGNHDELMREKGIYFKL 589


>3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score =  214 bits (545), Expect = 1e-57
 Identities = 140/470 (29%), Positives = 235/470 (50%), Gaps = 16/470 (3%)

Query: 745  MSFFNRRDTTDVADRIMGDVTAQESMLSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVM 804
            + +F+  D  ++  R+  DV+     +   +      +              W+L   ++
Sbjct: 124  IGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMAXXXXXXXXXXXXXWKLTLVIL 183

Query: 805  VTLP---LSAGVIALSRRHQSRLFERQNRVRLDALACVQDYLEGIKDMRACRAVGKDSAA 861
               P   LSAG+ A   +  S   +++      A A  ++ L  I+ + A     K+   
Sbjct: 184  AISPVLGLSAGIWA---KILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELER 240

Query: 862  MEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGGVDF-MVLLMFL 920
                + E KR+ ++  +  ++S+  A  ++ +   L    G  L+ S       VL +F 
Sbjct: 241  YNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFF 300

Query: 921  LIVSRVY--GPILALVSQLPNLLNLSTKTARI---KAVMDEPEARGSASADVPGHDLSFQ 975
             ++   +  G     +    N    + +  +I   K  +D     G    ++ G+ L F+
Sbjct: 301  SVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGN-LEFK 359

Query: 976  GVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSG 1032
             + F Y      ++L G++   + G+  ALVG SG GKST  QL  + ++P  G V   G
Sbjct: 360  NIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDG 419

Query: 1033 KDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIER 1092
            +DI   +       + +V Q+ VLF  T+A NIR GRE  + +E+ +A + A+  +FI +
Sbjct: 420  QDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMK 479

Query: 1093 LPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGT 1152
            LP  FDT++GE GA LSGG++QR++IARAL+++  ++LLDEAT++LD E+E ++Q A+  
Sbjct: 480  LPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDK 539

Query: 1153 LCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARL 1202
               G+T IVIAHRL TV NAD I   D G + E+GNH  L+ E G+Y +L
Sbjct: 540  AREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKL 589



 Score =  192 bits (489), Expect = 3e-51
 Identities = 103/241 (42%), Positives = 155/241 (64%), Gaps = 5/241 (2%)

Query: 971  DLSFQGVRFGYGDEE---VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR 1027
            ++ F GV F Y       VL G+S   ++G+  ALVG SG GKST  QL  +F++P +G 
Sbjct: 941  NVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGS 1000

Query: 1028 VLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREG--ASDEEVAEAARAAH 1085
            V   GK+I + + +   A + IV Q+ +LFD ++A NI  G      S EE+  AA+ A+
Sbjct: 1001 VFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEAN 1060

Query: 1086 CLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETL 1145
              +FI+ LP  ++T +G+ G  LSGG++QR++IARAL++   ++LLDEAT++LD E+E +
Sbjct: 1061 IHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKV 1120

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRL 1205
            +Q A+     G+T IVIAHRL T+ NAD IVV+ +G+V E G H+ LLA+ G+Y  +  +
Sbjct: 1121 VQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSV 1180

Query: 1206 Q 1206
            Q
Sbjct: 1181 Q 1181



 Score =  148 bits (373), Expect = 9e-38
 Identities = 87/239 (36%), Positives = 127/239 (53%), Gaps = 3/239 (1%)

Query: 349  DASVSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDS 407
            + +V    V F+Y      P L+ +SLE+  G   A+VG SG GKST+  L+ RF+D  +
Sbjct: 939  EGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMA 998

Query: 408  GQVLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXX 467
            G V + G +++++    L   L +V Q+  LF  S+AENI  G                 
Sbjct: 999  GSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKE 1058

Query: 468  XXX--FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE 525
                 FI+ LP  Y T +G +G  LSGG+               I++LDEAT+  D E+E
Sbjct: 1059 ANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESE 1118

Query: 526  HLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
             ++Q+A ++   G+T I++AHRLST+  AD IVV+  G+  E GTHQ+LLA  G Y  M
Sbjct: 1119 KVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSM 1177



 Score =  147 bits (370), Expect = 2e-37
 Identities = 108/388 (27%), Positives = 172/388 (44%), Gaps = 28/388 (7%)

Query: 212 GNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAY 271
           G  + E +  +R V AFG   +  +R ++ +++   L +   +    SM     ++  +Y
Sbjct: 215 GAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASY 274

Query: 272 LFVLPVGILLAPGAQDWPTXXXXXXXXXXXXHSISSVFTKILYVSEDGMLAQANIDR--- 328
                 G  L    +                  + +VF  +L  +     A  NI+    
Sbjct: 275 ALAFWYGTSLVISKE-------------YSIGQVLTVFFSVLIGAFSVGQASPNIEAFAN 321

Query: 329 -----------IDSVLGIEELSCPEAPKAPKDASVSLRDVTFSYEDDAE-PALRNVSLEI 376
                      ID+   I+  S           ++  +++ FSY    E   L+ ++L++
Sbjct: 322 ARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKV 381

Query: 377 PAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMGSLSLVFQDS 436
            +G   A+VG SG GKST   L+ R +D   G V + G D+R +    L   + +V Q+ 
Sbjct: 382 KSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEP 441

Query: 437 HLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXX 496
            LF  ++AENIR GR                   FI  LPH + T++G  G  LSGG+  
Sbjct: 442 VLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQ 501

Query: 497 XXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADK 556
                     +  I++LDEAT+  D E+E ++Q A ++   G+T I++AHRLSTV  AD 
Sbjct: 502 RIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADV 561

Query: 557 IVVLDGGRKVEEGTHQELLAASGTYAKM 584
           I   DGG  VE+G H EL+   G Y K+
Sbjct: 562 IAGFDGGVIVEQGNHDELMREKGIYFKL 589


>3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 572

 Score =  208 bits (529), Expect = 8e-56
 Identities = 144/487 (29%), Positives = 245/487 (50%), Gaps = 21/487 (4%)

Query: 733  RLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESMLSSTLPQLIAGIVSTVVICAML 792
            R RL  H+  +P++FF+++ T  +  RI  D     S  S  L  ++    S + +  M+
Sbjct: 92   RRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMM 151

Query: 793  AFFDWRLACCVMVTLPL-SAGVIALSRRHQSRLFERQNRVRLDALACVQDYLEGIKDMRA 851
             ++ W+L+  ++V  P+ S  +  +S+R +S     QN +        +  L+G K++  
Sbjct: 152  FYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQNTMG-QVTTSAEQMLKGHKEVLI 210

Query: 852  CRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGGV 911
                  ++   ++   +++   M++  A  +S  +   I    +       A +L +   
Sbjct: 211  FGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLAL-------AFVLYAASF 263

Query: 912  DFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTAR-------IKAVMDEPEAR--GS 962
              ++  +    ++ V+  ++AL+  L +L N++ +  R       + A++D  + +  G 
Sbjct: 264  PSVMDSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQEKDEGK 323

Query: 963  ASADVPGHDLSFQGVRFGYGDEEV--LHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF 1020
               D    DL F+ V F Y   EV  L  ++     G+  ALVG SGSGKST A L  +F
Sbjct: 324  RVIDRATGDLEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRF 383

Query: 1021 WEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGR-EGASDEEVAE 1079
            ++ D G +L  G D+ E++  S    V++V Q+V LF+DTVANNI   R E  S E++ E
Sbjct: 384  YDIDEGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEE 443

Query: 1080 AARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLD 1139
            AAR A+ ++FI ++  G DT++GENG  LS               D+P+++LDEAT++LD
Sbjct: 444  AARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALD 503

Query: 1140 PENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
             E+E  IQ A+  L   +T +VIAHRL T+  A              G H  LLA+ G+Y
Sbjct: 504  TESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTHSELLAQHGVY 563

Query: 1200 ARLWRLQ 1206
            A+L ++Q
Sbjct: 564  AQLHKMQ 570



 Score =  163 bits (413), Expect = 2e-42
 Identities = 105/234 (44%), Positives = 141/234 (60%), Gaps = 1/234 (0%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           +  R+VTF+Y     PALRN++L+IPAG   A+VG SGSGKST+A+L+ RF+D+D G +L
Sbjct: 333 LEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHIL 392

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGR-PGXXXXXXXXXXXXXXXXX 470
           + G D+RE     L   ++LV Q+ HLF ++VA NI   R                    
Sbjct: 393 MDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMD 452

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQK 530
           FIN + +G  T+IG  GV LS               D+PI++LDEAT+  D E+E  IQ 
Sbjct: 453 FINKMDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQA 512

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           A + L   +T +++AHRLST+  A              GTH ELLA  G YA++
Sbjct: 513 ALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTHSELLAQHGVYAQL 566


>2ghiA [x.x.x] TRANSPORT PROTEIN
          Length = 255

 Score =  202 bits (513), Expect = 6e-54
 Identities = 103/241 (42%), Positives = 159/241 (65%), Gaps = 4/241 (1%)

Query: 969  GHDLSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDS 1025
            G ++ F  V F Y  +     L  ++F    G   ALVG +GSGKST A+L  +F++ + 
Sbjct: 14   GVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE- 72

Query: 1026 GRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAH 1085
            G +   GK++ +++  S  + + IV QD +LF++T+  NI  G+  A+DEEV +A ++A 
Sbjct: 73   GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQ 132

Query: 1086 CLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETL 1145
              +FIE LP+ +DT++G  G  LSGGERQR++IAR LLKD  +V+ DEAT+SLD + E L
Sbjct: 133  LYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYL 192

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRL 1205
             Q+AV  L   +T+I+IAHRL T+++A+ I++L+ G++ E+G HK LL  +G YA +W +
Sbjct: 193  FQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNM 252

Query: 1206 Q 1206
            Q
Sbjct: 253  Q 253



 Score =  169 bits (428), Expect = 4e-44
 Identities = 89/236 (37%), Positives = 140/236 (59%), Gaps = 2/236 (0%)

Query: 351 SVSLRDVTFSYEDDAEP-ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ++   DV FSY        L++++  IP+GT CA+VG +GSGKST+A L+ RF+D + G 
Sbjct: 16  NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GD 74

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXX 469
           + +GG +V +  ++ +   + +V QD+ LF E++  NI  G+                  
Sbjct: 75  IKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLY 134

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI  LP  + T++G++G+ LSGGE            D  IV+ DEAT+  D + E+L Q
Sbjct: 135 DFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQ 194

Query: 530 KAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKMW 585
           KA E L   +T+I++AHRLST+  A+ I++L+ G+ VE+GTH++LL  +G YA+MW
Sbjct: 195 KAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMW 250


>2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  199 bits (505), Expect = 5e-53
 Identities = 98/224 (43%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 970  HDLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR 1027
            HD++F+ +RF Y  +   +L  ++   ++GEV  +VG SGSGKST  +L  +F+ P++G+
Sbjct: 2    HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ 61

Query: 1028 VLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHC 1086
            VL  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A  
Sbjct: 62   VLIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGA 120

Query: 1087 LEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLI 1146
             +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ DEAT++LD E+E +I
Sbjct: 121  HDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVI 180

Query: 1147 QRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
             R +  +C G+TVI+IAHRL TV NAD+I+V++ G++ E+G HK
Sbjct: 181  MRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 224



 Score =  155 bits (392), Expect = 6e-40
 Identities = 81/221 (36%), Positives = 126/221 (57%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG SGSGKSTL  L+ RF+  ++GQVL
Sbjct: 4   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVL 63

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 64  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 123

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ DEAT+  D E+EH+I + 
Sbjct: 124 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRN 183

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++AHRLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 184 MHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 224


>2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  197 bits (502), Expect = 1e-52
 Identities = 97/224 (43%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 970  HDLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR 1027
            HD++F+ +RF Y  +   +L  ++   ++GEV  +VG SGSGKST  +L  +F+ P++G+
Sbjct: 2    HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ 61

Query: 1028 VLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHC 1086
            VL  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A  
Sbjct: 62   VLIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGA 120

Query: 1087 LEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLI 1146
             +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ D+AT++LD E+E +I
Sbjct: 121  HDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVI 180

Query: 1147 QRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
             R +  +C G+TVI+IAHRL TV NAD+I+V++ G++ E+G HK
Sbjct: 181  MRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 224



 Score =  154 bits (389), Expect = 1e-39
 Identities = 80/221 (36%), Positives = 126/221 (57%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG SGSGKSTL  L+ RF+  ++GQVL
Sbjct: 4   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVL 63

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 64  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 123

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ D+AT+  D E+EH+I + 
Sbjct: 124 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRN 183

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++AHRLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 184 MHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 224


>3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  197 bits (502), Expect = 1e-52
 Identities = 97/224 (43%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 970  HDLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR 1027
            HD++F+ +RF Y  +   +L  ++   ++GEV  +VG +GSGKST  +L  +F+ P++G+
Sbjct: 2    HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQ 61

Query: 1028 VLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHC 1086
            VL  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A  
Sbjct: 62   VLIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGA 120

Query: 1087 LEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLI 1146
             +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ DEAT++LD E+E +I
Sbjct: 121  HDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVI 180

Query: 1147 QRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
             R +  +C G+TVI+IAHRL TV NAD+I+V++ G++ E+G HK
Sbjct: 181  MRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 224



 Score =  154 bits (389), Expect = 1e-39
 Identities = 80/221 (36%), Positives = 126/221 (57%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG +GSGKSTL  L+ RF+  ++GQVL
Sbjct: 4   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVL 63

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 64  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 123

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ DEAT+  D E+EH+I + 
Sbjct: 124 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRN 183

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++AHRLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 184 MHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 224


>1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
          Length = 241

 Score =  196 bits (497), Expect = 4e-52
 Identities = 97/223 (43%), Positives = 155/223 (69%), Gaps = 4/223 (1%)

Query: 971  DLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            D++F+ +RF Y  +   +L  ++   ++GEV  +VG SGSGKST  +L  +F+ P++G+V
Sbjct: 1    DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQV 60

Query: 1029 LCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCL 1087
            L  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A   
Sbjct: 61   LIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 119

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ DEAT++LD E+E +I 
Sbjct: 120  DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIM 179

Query: 1148 RAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
            R +  +C G+TVI+IAHRL TV NAD+I+V++ G++ E+G HK
Sbjct: 180  RNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 222



 Score =  155 bits (392), Expect = 6e-40
 Identities = 81/221 (36%), Positives = 126/221 (57%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG SGSGKSTL  L+ RF+  ++GQVL
Sbjct: 2   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVL 61

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 62  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 121

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ DEAT+  D E+EH+I + 
Sbjct: 122 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRN 181

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++AHRLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 182 MHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 222


>2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  195 bits (495), Expect = 7e-52
 Identities = 97/224 (43%), Positives = 155/224 (69%), Gaps = 4/224 (1%)

Query: 970  HDLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR 1027
            HD++F+ +RF Y  +   +L  ++   ++GEV  +VG SGSGKST  +L  +F+ P++G+
Sbjct: 2    HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ 61

Query: 1028 VLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHC 1086
            VL  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A  
Sbjct: 62   VLIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGA 120

Query: 1087 LEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLI 1146
             +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ DEAT++LD E+E +I
Sbjct: 121  HDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVI 180

Query: 1147 QRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
             R +  +C G+TVI+IA RL TV NAD+I+V++ G++ E+G HK
Sbjct: 181  MRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK 224



 Score =  151 bits (382), Expect = 9e-39
 Identities = 80/221 (36%), Positives = 125/221 (56%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG SGSGKSTL  L+ RF+  ++GQVL
Sbjct: 4   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVL 63

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 64  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 123

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ DEAT+  D E+EH+I + 
Sbjct: 124 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRN 183

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++A RLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 184 MHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK 224


>2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score =  194 bits (494), Expect = 9e-52
 Identities = 96/223 (43%), Positives = 155/223 (69%), Gaps = 4/223 (1%)

Query: 971  DLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            D++F+ +RF Y  +   +L  ++   ++GEV  +VG SGSGKST  +L  +F+ P++G+V
Sbjct: 1    DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQV 60

Query: 1029 LCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCL 1087
            L  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A   
Sbjct: 61   LIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 119

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ D+AT++LD E+E +I 
Sbjct: 120  DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIM 179

Query: 1148 RAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
            R +  +C G+TVI+IAHRL TV NAD+I+V++ G++ E+G HK
Sbjct: 180  RNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 222



 Score =  154 bits (389), Expect = 1e-39
 Identities = 80/221 (36%), Positives = 126/221 (57%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG SGSGKSTL  L+ RF+  ++GQVL
Sbjct: 2   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVL 61

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 62  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 121

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ D+AT+  D E+EH+I + 
Sbjct: 122 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRN 181

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++AHRLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 182 MHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK 222


>1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score =  192 bits (487), Expect = 6e-51
 Identities = 96/223 (43%), Positives = 154/223 (69%), Gaps = 4/223 (1%)

Query: 971  DLSFQGVRFGYGDEE--VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            D++F+ +RF Y  +   +L  ++   ++GEV  +VG SGSGKST  +L  +F+ P++G+V
Sbjct: 1    DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQV 60

Query: 1029 LCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCL 1087
            L  G D+A  ++ +WL   V +V QD VL + ++ +NI +   G S E+V  AA+ A   
Sbjct: 61   LIDGHDLA-LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 119

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI  L +G++T++GE GA LSGG+RQR++IARAL+ +  +++ DEAT++LD E+E +I 
Sbjct: 120  DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIM 179

Query: 1148 RAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK 1190
            R +  +C G+TVI+IA RL TV NAD+I+V++ G++ E+G HK
Sbjct: 180  RNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK 222



 Score =  151 bits (382), Expect = 9e-39
 Identities = 80/221 (36%), Positives = 125/221 (56%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           ++ R++ F Y+ D+   L N++L I  G V  +VG SGSGKSTL  L+ RF+  ++GQVL
Sbjct: 2   ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVL 61

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           + G D+     + L   + +V QD+ L   S+ +NI    PG                 F
Sbjct: 62  IDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDF 121

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKA 531
           I+ L  GY T++G +G  LSGG+            +  I++ DEAT+  D E+EH+I + 
Sbjct: 122 ISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRN 181

Query: 532 FERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQ 572
             ++  G+TVI++A RLSTV  AD+I+V++ G+ VE+G H+
Sbjct: 182 MHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK 222


>1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 241

 Score =  188 bits (477), Expect = 8e-50
 Identities = 94/232 (40%), Positives = 145/232 (62%), Gaps = 2/232 (0%)

Query: 972  LSFQGVRFGYGD-EEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            LS + V F Y D E++L  +SF A+   + A  GPSG GKST   L  +F++P +G +  
Sbjct: 2    LSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITI 61

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGA-SDEEVAEAARAAHCLEF 1089
             G+ I   S E+W + +  V QD  +   T+  N+  G EG  +DE++ +    A    F
Sbjct: 62   DGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSF 121

Query: 1090 IERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRA 1149
            +E +P   +T +GE G  +SGG+RQRL+IARA L++  +++LDEATASLD E+E+++Q+A
Sbjct: 122  VENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKA 181

Query: 1150 VGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYAR 1201
            + +L  G+T +VIAHRL T+ +ADKI  ++ G++   G H  L+A   LYA+
Sbjct: 182  LDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAK 233



 Score =  144 bits (364), Expect = 1e-36
 Identities = 80/233 (34%), Positives = 124/233 (53%), Gaps = 2/233 (0%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           +S R V F+Y DD+E  LR++S E    ++ A  GPSG GKST+ +L+ RF+   +G++ 
Sbjct: 2   LSARHVDFAY-DDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEIT 60

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXX- 470
           + G  +  +  +     +  V QDS +   ++ EN+  G  G                  
Sbjct: 61  IDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARS 120

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQK 530
           F+  +P    T +G  GV +SGG+            +  I++LDEATA  D E+E ++QK
Sbjct: 121 FVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQK 180

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAK 583
           A + LM G+T +++AHRLST+V ADKI  ++ G+    G H EL+A    YAK
Sbjct: 181 ALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAK 233


>1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 242

 Score =  188 bits (477), Expect = 8e-50
 Identities = 94/232 (40%), Positives = 145/232 (62%), Gaps = 2/232 (0%)

Query: 972  LSFQGVRFGYGD-EEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            LS + V F Y D E++L  +SF A+   + A  GPSG GKST   L  +F++P +G +  
Sbjct: 2    LSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITI 61

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGA-SDEEVAEAARAAHCLEF 1089
             G+ I   S E+W + +  V QD  +   T+  N+  G EG  +DE++ +    A    F
Sbjct: 62   DGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSF 121

Query: 1090 IERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRA 1149
            +E +P   +T +GE G  +SGG+RQRL+IARA L++  +++LDEATASLD E+E+++Q+A
Sbjct: 122  VENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKA 181

Query: 1150 VGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYAR 1201
            + +L  G+T +VIAHRL T+ +ADKI  ++ G++   G H  L+A   LYA+
Sbjct: 182  LDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAK 233



 Score =  144 bits (364), Expect = 1e-36
 Identities = 80/233 (34%), Positives = 124/233 (53%), Gaps = 2/233 (0%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           +S R V F+Y DD+E  LR++S E    ++ A  GPSG GKST+ +L+ RF+   +G++ 
Sbjct: 2   LSARHVDFAY-DDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEIT 60

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXX- 470
           + G  +  +  +     +  V QDS +   ++ EN+  G  G                  
Sbjct: 61  IDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARS 120

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQK 530
           F+  +P    T +G  GV +SGG+            +  I++LDEATA  D E+E ++QK
Sbjct: 121 FVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQK 180

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAK 583
           A + LM G+T +++AHRLST+V ADKI  ++ G+    G H EL+A    YAK
Sbjct: 181 ALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAK 233


>2ghiB [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score =  182 bits (462), Expect = 5e-48
 Identities = 100/241 (41%), Positives = 156/241 (64%), Gaps = 9/241 (3%)

Query: 969  GHDLSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDS 1025
            G ++ F  V F Y  +     L  ++F    G   ALVG +GSGKST A+L  +F++ + 
Sbjct: 14   GVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE- 72

Query: 1026 GRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAH 1085
            G +   GK++ +++  S  + + IV QD +LF++T+  NI  G+  A+DEEV +A ++A 
Sbjct: 73   GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQ 132

Query: 1086 CLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETL 1145
              +FIE LP+ +DT++G N   LSGGERQR++IAR LLKD  +V+ DEAT+  D + E L
Sbjct: 133  LYDFIEALPKKWDTIVG-NKMKLSGGERQRIAIARCLLKDPKIVIFDEATS--DSKTEYL 189

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRL 1205
             Q+AV  L   +T+I+IAH  RT+++A+ I++L+ G++ E+G HK LL  +G YA +W +
Sbjct: 190  FQKAVEDLRKNRTLIIIAH--RTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNM 247

Query: 1206 Q 1206
            Q
Sbjct: 248  Q 248



 Score =  152 bits (383), Expect = 7e-39
 Identities = 87/236 (36%), Positives = 137/236 (58%), Gaps = 7/236 (2%)

Query: 351 SVSLRDVTFSYEDDAEP-ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ++   DV FSY        L++++  IP+GT CA+VG +GSGKST+A L+ RF+D + G 
Sbjct: 16  NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GD 74

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXX 469
           + +GG +V +  ++ +   + +V QD+ LF E++  NI  G+                  
Sbjct: 75  IKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLY 134

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI  LP  + T++G++ + LSGGE            D  IV+ DEAT  SD + E+L Q
Sbjct: 135 DFIEALPKKWDTIVGNK-MKLSGGERQRIAIARCLLKDPKIVIFDEAT--SDSKTEYLFQ 191

Query: 530 KAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKMW 585
           KA E L   +T+I++AHR  T+  A+ I++L+ G+ VE+GTH++LL  +G YA+MW
Sbjct: 192 KAVEDLRKNRTLIIIAHR--TISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMW 245


>2ghiC [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score =  181 bits (459), Expect = 1e-47
 Identities = 98/241 (40%), Positives = 155/241 (64%), Gaps = 9/241 (3%)

Query: 969  GHDLSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDS 1025
            G ++ F  V F Y  +     L  ++F    G   ALVG +GSGKST A+L  +F++ + 
Sbjct: 14   GVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE- 72

Query: 1026 GRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAH 1085
            G +   GK++ +++  S  + + IV QD +LF++T+  NI  G+  A+ EEV +A ++A 
Sbjct: 73   GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDAT-EEVIKATKSAQ 131

Query: 1086 CLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETL 1145
              +FIE LP+ +DT++G     +  GERQR++IAR LLKD  +V+ DEAT+SLD + E L
Sbjct: 132  LYDFIEALPKKWDTIVG----GMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYL 187

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRL 1205
             Q+AV  L   +T+I+IAHRL T+++A+ I++L+ G++ E+G HK LL  +G YA +W +
Sbjct: 188  FQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNM 247

Query: 1206 Q 1206
            Q
Sbjct: 248  Q 248



 Score =  150 bits (379), Expect = 2e-38
 Identities = 87/236 (36%), Positives = 136/236 (57%), Gaps = 7/236 (2%)

Query: 351 SVSLRDVTFSYEDDAEP-ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ++   DV FSY        L++++  IP+GT CA+VG +GSGKST+A L+ RF+D + G 
Sbjct: 16  NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GD 74

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXX 469
           + +GG +V +  ++ +   + +V QD+ LF E++  NI  G+                  
Sbjct: 75  IKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATEEVIKATKSAQLYD 134

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI  LP  + T++G  G+ L  GE            D  IV+ DEAT+  D + E+L Q
Sbjct: 135 -FIEALPKKWDTIVG--GMKL--GERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQ 189

Query: 530 KAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKMW 585
           KA E L   +T+I++AHRLST+  A+ I++L+ G+ VE+GTH++LL  +G YA+MW
Sbjct: 190 KAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMW 245


>1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 496

 Score =  176 bits (445), Expect = 4e-46
 Identities = 131/461 (28%), Positives = 218/461 (47%), Gaps = 60/461 (13%)

Query: 733  RLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESMLSSTLPQLIAGIVSTVVICAML 792
            R RL  H+  +P++FF+++ T  +  RI  D     S  S  L  ++    S + +  M+
Sbjct: 92   RRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMM 151

Query: 793  AFFDWRLACCVMVTLPL-SAGVIALSRRHQSRLFERQNRVRLDALACVQDYLEGIKDMRA 851
             ++ W+L+  ++V  P+ S  +  +S+R +S     QN   +  +    + L+G+K + A
Sbjct: 152  FYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQNT--MGQVTTSAERLQGMKMVSA 209

Query: 852  CRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGGV 911
                    +++   +++L               SLA A +       + + ++   +   
Sbjct: 210  --------SSISDPIIQL-------------IASLALAFVLYAASFPSVMDSLTAGT--- 245

Query: 912  DFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEARGSASADVPGHD 971
                       ++ V+  ++AL+  L +L N++ +  R                   G  
Sbjct: 246  -----------ITVVFSSMIALMRPLKSLTNVNAQFQR-------------------GMA 275

Query: 972  LSFQGVRFGYGDEEV--LHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVL 1029
              F+ V F Y   EV  L  ++     G+  ALVG SGSGKST A L  +F++ D G +L
Sbjct: 276  AEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHIL 335

Query: 1030 CSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGR-EGASDEEVAEAARAAHCLE 1088
              G D+ E++  S    V++V Q+V LF+DTVANNI   R E  S E++ EAAR A+ ++
Sbjct: 336  MDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMD 395

Query: 1089 FIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQR 1148
            FI ++  G DT++GENG  LS               D+P+++LDEAT++LD E+E  IQ 
Sbjct: 396  FINKMDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQA 455

Query: 1149 AVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNH 1189
            A+  L   +T +VIAHRL T+  A              G H
Sbjct: 456  ALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTH 496



 Score =  150 bits (378), Expect = 2e-38
 Identities = 98/222 (44%), Positives = 132/222 (59%), Gaps = 1/222 (0%)

Query: 351 SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           +   R+VTF+Y     PALRN++L+IPAG   A+VG SGSGKST+A+L+ RF+D+D G +
Sbjct: 275 AAEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHI 334

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGR-PGXXXXXXXXXXXXXXXX 469
           L+ G D+RE     L   ++LV Q+ HLF ++VA NI   R                   
Sbjct: 335 LMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAM 394

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FIN + +G  T+IG  GV LS               D+PI++LDEAT+  D E+E  IQ
Sbjct: 395 DFINKMDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQ 454

Query: 530 KAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTH 571
            A + L   +T +++AHRLST+  A              GTH
Sbjct: 455 AALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTH 496


>2ghiD [x.x.x] TRANSPORT PROTEIN
          Length = 224

 Score =  171 bits (433), Expect = 1e-44
 Identities = 95/238 (39%), Positives = 149/238 (62%), Gaps = 18/238 (7%)

Query: 969  GHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            G ++ F  V F Y     L  ++F    G   ALVG +GSGKST A+L  +F++ + G +
Sbjct: 5    GVNIEFSDVNFSY--HRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDI 61

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLE 1088
               GK++ +++  S  + + IV QD +LF++T+  NI  G+  A+DEEV +A ++A   +
Sbjct: 62   KIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYD 121

Query: 1089 FIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQR 1148
            FIE LP+ +DT++      LSGGERQR++IAR LLKD  +V+ D      D + E L Q+
Sbjct: 122  FIEALPKKWDTIV------LSGGERQRIAIARCLLKDPKIVIFD------DSKTEYLFQK 169

Query: 1149 AVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRLQ 1206
            AV      +T+I+IAHRL T+++A+ I++L+ G++ E+G HK LL  +G YA +W +Q
Sbjct: 170  AVED---NRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQ 224



 Score =  140 bits (352), Expect = 3e-35
 Identities = 83/235 (35%), Positives = 130/235 (55%), Gaps = 20/235 (8%)

Query: 351 SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           ++   DV FSY       L++++  IP+GT CA+VG +GSGKST+A L+ RF+D + G +
Sbjct: 7   NIEFSDVNFSYHR----TLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDI 61

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXX 470
            +GG +V +  ++ +   + +V QD+ LF E++  NI  G+                   
Sbjct: 62  KIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYD 121

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQK 530
           FI  LP  + T++      LSGGE            D  IV+ D      D + E+L QK
Sbjct: 122 FIEALPKKWDTIV------LSGGERQRIAIARCLLKDPKIVIFD------DSKTEYLFQK 169

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKMW 585
           A E     +T+I++AHRLST+  A+ I++L+ G+ VE+GTH++LL  +G YA+MW
Sbjct: 170 AVED---NRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMW 221


>2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 252

 Score =  153 bits (387), Expect = 2e-39
 Identities = 87/234 (37%), Positives = 133/234 (56%), Gaps = 6/234 (2%)

Query: 972  LSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y +    +VL G++F    G+VTALVGP+GSGKST A L    ++P  G+V
Sbjct: 12   VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 71

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  G+ + ++        V+ V Q+ +LF  +   NI  G     + EE+   A  +   
Sbjct: 72   LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI   PQG+DT +GE G  LSGG+RQ +++ARAL++   +++LD+AT++LD  N+  +Q
Sbjct: 132  DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 191

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
            R +      A +TV++I H+L     A  I+ L  G V E+G H  L+   G Y
Sbjct: 192  RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCY 245



 Score =  105 bits (263), Expect = 5e-25
 Identities = 72/237 (30%), Positives = 112/237 (47%), Gaps = 4/237 (1%)

Query: 352 VSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +      L+ ++  +  G V A+VGP+GSGKST+A L+   +    G+V
Sbjct: 12  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 71

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V Q+  LF  S  ENI  G                    
Sbjct: 72  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI+G P GY T +G  G  LSGG+               +++LD+AT+  D  N+  +Q
Sbjct: 132 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 191

Query: 530 KAFERL--MAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           +        A +TV+++ H+LS    A  I+ L  G   E+GTH +L+   G Y  M
Sbjct: 192 RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 248


>2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 255

 Score =  153 bits (387), Expect = 2e-39
 Identities = 87/234 (37%), Positives = 133/234 (56%), Gaps = 6/234 (2%)

Query: 972  LSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y +    +VL G++F    G+VTALVGP+GSGKST A L    ++P  G+V
Sbjct: 16   VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 75

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  G+ + ++        V+ V Q+ +LF  +   NI  G     + EE+   A  +   
Sbjct: 76   LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 135

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI   PQG+DT +GE G  LSGG+RQ +++ARAL++   +++LD+AT++LD  N+  +Q
Sbjct: 136  DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 195

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
            R +      A +TV++I H+L     A  I+ L  G V E+G H  L+   G Y
Sbjct: 196  RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCY 249



 Score =  105 bits (263), Expect = 5e-25
 Identities = 72/237 (30%), Positives = 112/237 (47%), Gaps = 4/237 (1%)

Query: 352 VSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +      L+ ++  +  G V A+VGP+GSGKST+A L+   +    G+V
Sbjct: 16  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 75

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V Q+  LF  S  ENI  G                    
Sbjct: 76  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 135

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI+G P GY T +G  G  LSGG+               +++LD+AT+  D  N+  +Q
Sbjct: 136 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 195

Query: 530 KAFERL--MAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           +        A +TV+++ H+LS    A  I+ L  G   E+GTH +L+   G Y  M
Sbjct: 196 RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 252


>2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 251

 Score =  149 bits (377), Expect = 3e-38
 Identities = 86/234 (36%), Positives = 131/234 (55%), Gaps = 6/234 (2%)

Query: 972  LSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y +    +VL G++F    G+VTALVGP+GSGKST A L    ++P  G+V
Sbjct: 12   VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 71

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  G+ + ++        V+ V Q+ +LF  +   NI  G     + EE+   A  +   
Sbjct: 72   LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI   PQG+DT +GE G  LSGG+RQ +++ARAL++   +++LD AT++LD  N+  +Q
Sbjct: 132  DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 191

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
            R +      A +TV++I  +L     A  I+ L  G V E+G H  L+   G Y
Sbjct: 192  RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCY 245



 Score =  102 bits (253), Expect = 8e-24
 Identities = 71/237 (29%), Positives = 110/237 (46%), Gaps = 4/237 (1%)

Query: 352 VSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +      L+ ++  +  G V A+VGP+GSGKST+A L+   +    G+V
Sbjct: 12  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 71

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V Q+  LF  S  ENI  G                    
Sbjct: 72  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI+G P GY T +G  G  LSGG+               +++LD AT+  D  N+  +Q
Sbjct: 132 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 191

Query: 530 KAFERL--MAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           +        A +TV+++  +LS    A  I+ L  G   E+GTH +L+   G Y  M
Sbjct: 192 RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 248


>1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1
          Length = 251

 Score =  149 bits (375), Expect = 6e-38
 Identities = 88/242 (36%), Positives = 139/242 (57%), Gaps = 9/242 (3%)

Query: 972  LSFQGVRFGYG---DEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y    D  VL G++F  R GEVTALVGP+GSGKST A L    ++P  G++
Sbjct: 12   VQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQL 71

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  GK + ++        V+ V Q+  +F  ++  NI  G  +  + EE+  AA  +   
Sbjct: 72   LLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAH 131

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
             FI  LPQG+DT + E G+ LSGG+RQ +++ARAL++   V++LD+AT++LD  ++  ++
Sbjct: 132  SFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVE 191

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRL 1205
            + +        ++V++I   L  V  AD I+ L+ G + E G H+ L+ + G Y   W +
Sbjct: 192  QLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCY---WAM 248

Query: 1206 QQ 1207
             Q
Sbjct: 249  VQ 250



 Score =  106 bits (265), Expect = 3e-25
 Identities = 74/239 (30%), Positives = 118/239 (49%), Gaps = 8/239 (3%)

Query: 352 VSLRDVTFSYEDDAEP-ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +  +   L+ ++  +  G V A+VGP+GSGKST+A L+   +    GQ+
Sbjct: 12  VQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQL 71

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V Q+  +F  S+ ENI  G                    
Sbjct: 72  LLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAH 131

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPEN----E 525
            FI+GLP GY T +   G  LSGG+               +++LD+AT+  D  +    E
Sbjct: 132 SFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVE 191

Query: 526 HLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
            L+ ++ ER    ++V+++   LS V  AD I+ L+GG   E GTHQ+L+   G Y  M
Sbjct: 192 QLLYESPERY--SRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAM 248


>2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 250

 Score =  148 bits (374), Expect = 7e-38
 Identities = 87/234 (37%), Positives = 132/234 (56%), Gaps = 8/234 (3%)

Query: 972  LSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y +    +VL G++F    G+VTALVGP+GSGKST A L    ++P  G+V
Sbjct: 13   VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 72

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  G+ + ++        V+ V Q  +LF  +   NI  G     + EE+   A  +   
Sbjct: 73   LLDGEPLVQYDHHYLHTQVAAVGQ--LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 130

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI   PQG+DT +GE G  LSGG+RQ +++ARAL++   +++LD+AT++LD  N+  +Q
Sbjct: 131  DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 190

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
            R +      A +TV++I H+L     A  I+ L  G V E+G H  L+   G Y
Sbjct: 191  RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCY 244



 Score =  100 bits (249), Expect = 2e-23
 Identities = 72/237 (30%), Positives = 111/237 (46%), Gaps = 6/237 (2%)

Query: 352 VSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +      L+ ++  +  G V A+VGP+GSGKST+A L+   +    G+V
Sbjct: 13  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 72

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V Q   LF  S  ENI  G                    
Sbjct: 73  LLDGEPLVQYDHHYLHTQVAAVGQ--LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 130

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI+G P GY T +G  G  LSGG+               +++LD+AT+  D  N+  +Q
Sbjct: 131 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 190

Query: 530 KAFERL--MAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           +        A +TV+++ H+LS    A  I+ L  G   E+GTH +L+   G Y  M
Sbjct: 191 RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 247


>2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 254

 Score =  145 bits (365), Expect = 8e-37
 Identities = 84/234 (35%), Positives = 130/234 (55%), Gaps = 6/234 (2%)

Query: 972  LSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y +    +VL G++F    G+VTALVGP+GSGKST A L    ++P  G+V
Sbjct: 14   VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 73

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  G+ + ++        V+ V Q+ +LF  +   NI  G     + EE+   A  +   
Sbjct: 74   LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 133

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI   PQG+DT +GE G  L+ G+RQ +++ARAL++   +++LD AT++LD  N+  +Q
Sbjct: 134  DFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 193

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
            R +      A +TV++I  +L     A  I+ L  G V E+G H  L+   G Y
Sbjct: 194  RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCY 247



 Score = 97.4 bits (241), Expect = 2e-22
 Identities = 69/237 (29%), Positives = 109/237 (45%), Gaps = 4/237 (1%)

Query: 352 VSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +      L+ ++  +  G V A+VGP+GSGKST+A L+   +    G+V
Sbjct: 14  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 73

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V Q+  LF  S  ENI  G                    
Sbjct: 74  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 133

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI+G P GY T +G  G  L+ G+               +++LD AT+  D  N+  +Q
Sbjct: 134 DFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 193

Query: 530 KAFERL--MAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           +        A +TV+++  +LS    A  I+ L  G   E+GTH +L+   G Y  M
Sbjct: 194 RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 250


>2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 248

 Score =  132 bits (332), Expect = 5e-33
 Identities = 81/234 (34%), Positives = 125/234 (53%), Gaps = 13/234 (5%)

Query: 972  LSFQGVRFGYGDE---EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            + FQ V F Y +    +VL G++F    G+VTALVGP+GSGKST A L    ++P  G+V
Sbjct: 14   VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 73

Query: 1029 LCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCL 1087
            L  G+ + ++       H  +     +LF  +   NI  G     + EE+   A  +   
Sbjct: 74   LLDGEPLVQYDHH--YLHTQVAAVGPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 1088 EFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQ 1147
            +FI   PQG+DT +      LSGG+RQ +++ARAL++   +++LD AT++LD  N+  +Q
Sbjct: 132  DFISGFPQGYDTEV-----QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 186

Query: 1148 RAV--GTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLY 1199
            R +      A +TV++I  +L     A  I+ L  G V E+G H  L+   G Y
Sbjct: 187  RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCY 240



 Score = 86.3 bits (212), Expect = 4e-19
 Identities = 69/237 (29%), Positives = 106/237 (44%), Gaps = 11/237 (4%)

Query: 352 VSLRDVTFSYEDDAE-PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V  +DV+F+Y +      L+ ++  +  G V A+VGP+GSGKST+A L+   +    G+V
Sbjct: 14  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 73

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRG-RPGXXXXXXXXXXXXXXXX 469
           L+ G  + +     L   ++ V     LF  S  ENI  G                    
Sbjct: 74  LLDGEPLVQYDHHYLHTQVAAV--GPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
            FI+G P GY T      V LSGG+               +++LD AT+  D  N+  +Q
Sbjct: 132 DFISGFPQGYDT-----EVQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 186

Query: 530 KAFERL--MAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKM 584
           +        A +TV+++  +LS    A  I+ L  G   E+GTH +L+   G Y  M
Sbjct: 187 RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 243


>2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
          Length = 230

 Score =  102 bits (255), Expect = 5e-24
 Identities = 64/225 (28%), Positives = 114/225 (50%), Gaps = 17/225 (7%)

Query: 983  DEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEES 1042
            D   L+G++F   EG + A+VG  G GKS+         +   G V   G  +A   +++
Sbjct: 16   DPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS-VAYVPQQA 74

Query: 1043 WLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLG 1102
            W+ +            D++  NI  G +   +       +A   L  +E LP G  T +G
Sbjct: 75   WIQN------------DSLRENILFGCQ-LEEPYYRSVIQACALLPDLEILPSGDRTEIG 121

Query: 1103 ENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE-NETLIQRAVGT--LCAGKTV 1159
            E G +LSGG++QR+S+ARA+  +A + L D+  +++D    + + +  +G   +   KT 
Sbjct: 122  EKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTR 181

Query: 1160 IVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWR 1204
            I++ H +  +   D I+V+  G+++E G+++ LLA DG +A   R
Sbjct: 182  ILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLR 226



 Score = 94.7 bits (234), Expect = 1e-21
 Identities = 69/241 (28%), Positives = 112/241 (46%), Gaps = 17/241 (7%)

Query: 351 SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           S+++R+ TF++     P L  ++  IP G + AVVG  G GKS+L + +    D   G V
Sbjct: 2   SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHV 61

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXX 470
            +              GS++ V Q + +  +S+ ENI  G                    
Sbjct: 62  AI-------------KGSVAYVPQQAWIQNDSLRENILFGCQ-LEEPYYRSVIQACALLP 107

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPE-NEHLIQ 529
            +  LP G  T IG +GV+LSGG+            +A I + D+  +  D    +H+ +
Sbjct: 108 DLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFE 167

Query: 530 KAF--ERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKMWRQ 587
                + ++  KT I+V H +S +   D I+V+ GG+  E G++QELLA  G +A+  R 
Sbjct: 168 NVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRT 227

Query: 588 Y 588
           Y
Sbjct: 228 Y 228


>2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 361

 Score = 97.4 bits (241), Expect = 2e-22
 Identities = 69/227 (30%), Positives = 116/227 (51%), Gaps = 23/227 (10%)

Query: 971  DLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            ++  + +   +G+   L+ ++   ++GE  AL+GPSGSGKST     A  ++P SG++  
Sbjct: 2    EIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYF 61

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNI------RIGREGASDEEVAEAARA 1083
              KD+ E   +    +V +VFQ+  L+   TV  NI      R       D++V E A+ 
Sbjct: 62   DEKDVTELPPKD--RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKM 119

Query: 1084 AHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE 1143
             H  + + R P             LSGG++QR++IARAL+K+  V+LLDE  ++LD    
Sbjct: 120  LHIDKLLNRYPW-----------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLR 168

Query: 1144 TLIQRAVGTLC--AGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
              ++  +  L    G T + + H +   +A AD+I V+  G + + G
Sbjct: 169  LEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVG 215



 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 56/217 (25%), Positives = 92/217 (42%), Gaps = 23/217 (10%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL N++L+I  G   A++GPSGSGKSTL   +A  +   SG++     DV E+   +   
Sbjct: 17  ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD--R 74

Query: 428 SLSLVFQDSHLF-RESVAENI------RRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYA 480
           ++ LVFQ+  L+   +V +NI      R+                      +N  P    
Sbjct: 75  NVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPW--- 131

Query: 481 TVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLM--AG 538
                    LSGG+            +  +++LDE  +  D      ++   +RL    G
Sbjct: 132 --------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELG 183

Query: 539 KTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            T + V H +   +  AD+I V+  G  ++ GT  E+
Sbjct: 184 ITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEV 220


>2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 362

 Score = 97.4 bits (241), Expect = 2e-22
 Identities = 69/227 (30%), Positives = 116/227 (51%), Gaps = 23/227 (10%)

Query: 971  DLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            ++  + +   +G+   L+ ++   ++GE  AL+GPSGSGKST     A  ++P SG++  
Sbjct: 3    EIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYF 62

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNI------RIGREGASDEEVAEAARA 1083
              KD+ E   +    +V +VFQ+  L+   TV  NI      R       D++V E A+ 
Sbjct: 63   DEKDVTELPPKD--RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKM 120

Query: 1084 AHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE 1143
             H  + + R P             LSGG++QR++IARAL+K+  V+LLDE  ++LD    
Sbjct: 121  LHIDKLLNRYPW-----------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLR 169

Query: 1144 TLIQRAVGTLC--AGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
              ++  +  L    G T + + H +   +A AD+I V+  G + + G
Sbjct: 170  LEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVG 216



 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 56/217 (25%), Positives = 92/217 (42%), Gaps = 23/217 (10%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL N++L+I  G   A++GPSGSGKSTL   +A  +   SG++     DV E+   +   
Sbjct: 18  ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD--R 75

Query: 428 SLSLVFQDSHLF-RESVAENI------RRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYA 480
           ++ LVFQ+  L+   +V +NI      R+                      +N  P    
Sbjct: 76  NVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPW--- 132

Query: 481 TVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLM--AG 538
                    LSGG+            +  +++LDE  +  D      ++   +RL    G
Sbjct: 133 --------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELG 184

Query: 539 KTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            T + V H +   +  AD+I V+  G  ++ GT  E+
Sbjct: 185 ITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEV 221


>3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
          Length = 348

 Score = 92.4 bits (228), Expect = 6e-21
 Identities = 66/205 (32%), Positives = 105/205 (51%), Gaps = 14/205 (6%)

Query: 987  LHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAH 1046
            L  +S     GE   ++GP+G+GK+   +L A F  PDSGR+L  GKD+ + S E     
Sbjct: 16   LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEK--HD 73

Query: 1047 VSIVFQDVVLFDD-TVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
            ++ V+Q+  LF    V  N+  G      ++       A  L+ IE L       L  N 
Sbjct: 74   IAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLK-IEHL-------LDRNP 125

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGK--TVIVIA 1163
             +LSGGE+QR+++ARAL+ +  ++LLDE  ++LDP  +   +  +  L      TV+ I 
Sbjct: 126  LTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHIT 185

Query: 1164 H-RLRTVANADKIVVLDSGRVAEEG 1187
            H +      AD+I V+  G++ + G
Sbjct: 186  HDQTEARIMADRIAVVMDGKLIQVG 210



 Score = 59.3 bits (142), Expect = 6e-11
 Identities = 51/211 (24%), Positives = 95/211 (45%), Gaps = 14/211 (6%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           +L N+SL++ +G    ++GP+G+GK+    L+A F   DSG++L+ G DV ++  ++   
Sbjct: 15  SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEK--H 72

Query: 428 SLSLVFQDSHLF-RESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
            ++ V+Q+  LF   +V +N+  G                      + L     T     
Sbjct: 73  DIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLT----- 127

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAGK--TVIMV 544
              LSGGE            +  I++LDE  +  DP  +   ++    L      TV+ +
Sbjct: 128 ---LSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHI 184

Query: 545 AH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            H +    + AD+I V+  G+ ++ G  +E+
Sbjct: 185 THDQTEARIMADRIAVVMDGKLIQVGKPEEI 215


>1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
          Length = 367

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 75/229 (32%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 1    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 60

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGRE--GASDE-------EVAEAA 1081
             K + +         V +VFQ   L+   +VA N+  G +  GA  E       +VAE  
Sbjct: 61   EKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL 118

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
            + AH L+   R P+           +LSGG+RQR++I R L+ +  V LLDE  ++LD  
Sbjct: 119  QLAHLLD---RKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAA 164

Query: 1142 NETLIQRAVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
                ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 165  LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 213



 Score = 60.5 bits (145), Expect = 3e-11
 Identities = 61/227 (26%), Positives = 99/227 (43%), Gaps = 13/227 (5%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG + 
Sbjct: 1   VQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 58

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXX 470
           +G   + +    E    + +VFQ   L+   SVAEN+  G                    
Sbjct: 59  IGEKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAE 116

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQK 530
            +       A ++  +   LSGG+            +  + +LDE  +  D      ++ 
Sbjct: 117 VLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRI 171

Query: 531 AFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 172 EISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 218


>2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 223

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 62/201 (30%), Positives = 99/201 (49%), Gaps = 15/201 (7%)

Query: 982  GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEE 1041
            G   VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ 
Sbjct: 15   GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQF 73

Query: 1042 SWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVL 1101
            SW+               T+  NI  G     +       +A    E I +  +  + VL
Sbjct: 74   SWI------------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 120

Query: 1102 GENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVI 1160
            GE G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I
Sbjct: 121  GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 180

Query: 1161 VIAHRLRTVANADKIVVLDSG 1181
            ++  ++  +  ADKI++L  G
Sbjct: 181  LVTSKMEHLKKADKILILHEG 201



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 57/224 (25%), Positives = 98/224 (43%), Gaps = 15/224 (6%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V + +VT  +E+   P L++++ +I  G + AV G +G+GK++L  ++            
Sbjct: 3   VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------ 50

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           +G ++  E G+ +  G +S   Q S +   ++ ENI  G                     
Sbjct: 51  MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEED 108

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQK 530
           I+        V+G  G+ LSGG+            DA + +LD    + D   E  + + 
Sbjct: 109 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 168

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 169 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 212


>2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 219

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 62/201 (30%), Positives = 99/201 (49%), Gaps = 15/201 (7%)

Query: 982  GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEE 1041
            G   VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ 
Sbjct: 16   GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQF 74

Query: 1042 SWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVL 1101
            SW+               T+  NI  G     +       +A    E I +  +  + VL
Sbjct: 75   SWI------------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 121

Query: 1102 GENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVI 1160
            GE G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I
Sbjct: 122  GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 181

Query: 1161 VIAHRLRTVANADKIVVLDSG 1181
            ++  ++  +  ADKI++L  G
Sbjct: 182  LVTSKMEHLKKADKILILHEG 202



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 57/224 (25%), Positives = 98/224 (43%), Gaps = 15/224 (6%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V + +VT  +E+   P L++++ +I  G + AV G +G+GK++L  ++            
Sbjct: 4   VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------ 51

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           +G ++  E G+ +  G +S   Q S +   ++ ENI  G                     
Sbjct: 52  MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEED 109

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQK 530
           I+        V+G  G+ LSGG+            DA + +LD    + D   E  + + 
Sbjct: 110 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 169

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 170 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 213


>2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 226

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 62/201 (30%), Positives = 99/201 (49%), Gaps = 15/201 (7%)

Query: 982  GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEE 1041
            G   VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ 
Sbjct: 19   GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQF 77

Query: 1042 SWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVL 1101
            SW+               T+  NI  G     +       +A    E I +  +  + VL
Sbjct: 78   SWI------------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 124

Query: 1102 GENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVI 1160
            GE G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I
Sbjct: 125  GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 184

Query: 1161 VIAHRLRTVANADKIVVLDSG 1181
            ++  ++  +  ADKI++L  G
Sbjct: 185  LVTSKMEHLKKADKILILHEG 205



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 57/224 (25%), Positives = 98/224 (43%), Gaps = 15/224 (6%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V + +VT  +E+   P L++++ +I  G + AV G +G+GK++L  ++            
Sbjct: 7   VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------ 54

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           +G ++  E G+ +  G +S   Q S +   ++ ENI  G                     
Sbjct: 55  MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEED 112

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQK 530
           I+        V+G  G+ LSGG+            DA + +LD    + D   E  + + 
Sbjct: 113 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 172

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 173 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 216


>3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 75/229 (32%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGRE--GASDE-------EVAEAA 1081
             K + +         V +VFQ   L+   +VA N+  G +  GA  E       +VAE  
Sbjct: 63   EKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL 120

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
            + AH L+   R P+           +LSGG+RQR++I R L+ +  V LLDE  ++LD  
Sbjct: 121  QLAHLLD---RKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAA 166

Query: 1142 NETLIQRAVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
                ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 167  LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 215



 Score = 63.5 bits (153), Expect = 3e-12
 Identities = 63/229 (27%), Positives = 101/229 (44%), Gaps = 13/229 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXX 468
           + +G   + +    E    + +VFQ   L+   SVAEN+  G                  
Sbjct: 59  LFIGEKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 469 XXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLI 528
              +       A ++  +   LSGG+            +  + +LDE  +  D      +
Sbjct: 117 AEVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQM 171

Query: 529 QKAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +    RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 172 RIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 220


>2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 75/229 (32%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGRE--GASDE-------EVAEAA 1081
             K + +         V +VFQ   L+   +VA N+  G +  GA  E       +VAE  
Sbjct: 63   EKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL 120

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
            + AH L+   R P+           +LSGG+RQR++I R L+ +  V LLDE  ++LD  
Sbjct: 121  QLAHLLD---RKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAA 166

Query: 1142 NETLIQRAVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
                ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 167  LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 215



 Score = 63.5 bits (153), Expect = 3e-12
 Identities = 63/229 (27%), Positives = 101/229 (44%), Gaps = 13/229 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXX 468
           + +G   + +    E    + +VFQ   L+   SVAEN+  G                  
Sbjct: 59  LFIGEKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 469 XXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLI 528
              +       A ++  +   LSGG+            +  + +LDE  +  D      +
Sbjct: 117 AEVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQM 171

Query: 529 QKAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +    RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 172 RIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 220


>2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 374

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 75/229 (32%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGRE--GASDE-------EVAEAA 1081
             K + +         V +VFQ   L+   +VA N+  G +  GA  E       +VAE  
Sbjct: 63   EKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL 120

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
            + AH L+   R P+           +LSGG+RQR++I R L+ +  V LLDE  ++LD  
Sbjct: 121  QLAHLLD---RKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAA 166

Query: 1142 NETLIQRAVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
                ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 167  LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 215



 Score = 63.5 bits (153), Expect = 3e-12
 Identities = 63/229 (27%), Positives = 101/229 (44%), Gaps = 13/229 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXX 468
           + +G   + +    E    + +VFQ   L+   SVAEN+  G                  
Sbjct: 59  LFIGEKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 469 XXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLI 528
              +       A ++  +   LSGG+            +  + +LDE  +  D      +
Sbjct: 117 AEVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQM 171

Query: 529 QKAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +    RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 172 RIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 220


>2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 224

 Score = 89.4 bits (220), Expect = 5e-20
 Identities = 65/214 (30%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 971  DLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            ++  + V   +G   VL  ++F    G++ A+ G +G+GK++   +     EP  G++  
Sbjct: 6    EVVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKH 65

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLE 1088
            SG+ I+  S+ SW+               T+  NI     G S +E       +A    E
Sbjct: 66   SGR-ISFCSQFSWI------------MPGTIKENII----GVSYDEYRYRSVIKACQLEE 108

Query: 1089 FIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQ 1147
             I +  +  + VLGE G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +
Sbjct: 109  DISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE 168

Query: 1148 RAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSG 1181
              V  L A KT I++  ++  +  ADKI++L  G
Sbjct: 169  SCVCKLMANKTRILVTSKMEHLKKADKILILHEG 202



 Score = 56.6 bits (135), Expect = 4e-10
 Identities = 52/209 (24%), Positives = 89/209 (42%), Gaps = 16/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 20  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 66

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI                        I+        V+G  
Sbjct: 67  GRISFCSQFSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 124

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
           G+ LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 125 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 184

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 185 SKMEHLKKADKILILHEGSSYFYGTFSEL 213


>2oukB [x.x.x] PROTEIN ARTP
          Length = 241

 Score = 89.0 bits (219), Expect = 7e-20
 Identities = 74/224 (33%), Positives = 111/224 (49%), Gaps = 23/224 (10%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKST---CAQLAAKFWEPDSGRVLCSGK---- 1033
            +G  EVL G++   REGEV  ++GPSGSGKST   C  L   F          + K    
Sbjct: 12   FGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDT 71

Query: 1034 DIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIG--REGASDEEVAEAARAAHCLEFI 1090
            ++ +  EE     V +VFQ   LF   TV NNI +   +      E AEA      +E +
Sbjct: 72   NLNKVREE-----VGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAK----AMELL 122

Query: 1091 ERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAV 1150
            +++  G          SLSGG+ QR++IARAL  +  ++L DE T++LDPE    +   +
Sbjct: 123  DKV--GLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVM 180

Query: 1151 GTLC-AGKTVIVIAHRLRTVAN-ADKIVVLDSGRVAEEGNHKTL 1192
              L   G T++V+ H +       D+++ +D G + EEG  + L
Sbjct: 181  KQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDL 224



 Score = 52.0 bits (123), Expect = 9e-09
 Identities = 55/216 (25%), Positives = 90/216 (41%), Gaps = 19/216 (8%)

Query: 369 LRNVSLEIPAGTVCAVVGPSGSGKSTLA---NLVARFWDVDSGQVLVGGVDVREMGQDEL 425
           L+ +++ I  G V  V+GPSGSGKST     NL+  F            +  ++   +++
Sbjct: 18  LKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXN-LKAKDTNLNKV 76

Query: 426 MGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLP---HGYAT 481
              + +VFQ  +LF   +V  NI                          GL    H Y  
Sbjct: 77  REEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPD 136

Query: 482 VIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLM-AGKT 540
                   LSGG+            +  I++ DE T+  DPE    +    ++L   G T
Sbjct: 137 -------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMT 189

Query: 541 VIMVAHRLSTV--VGADKIVVLDGGRKVEEGTHQEL 574
           +++V H +     VG D+++ +DGG  +EEG  ++L
Sbjct: 190 MVVVTHEMGFAREVG-DRVLFMDGGYIIEEGKPEDL 224


>2oljA [x.x.x] AMINO ACID ABC TRANSPORTER
          Length = 242

 Score = 89.0 bits (219), Expect = 7e-20
 Identities = 74/224 (33%), Positives = 111/224 (49%), Gaps = 23/224 (10%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKST---CAQLAAKFWEPDSGRVLCSGK---- 1033
            +G  EVL G++   REGEV  ++GPSGSGKST   C  L   F          + K    
Sbjct: 13   FGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDT 72

Query: 1034 DIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIG--REGASDEEVAEAARAAHCLEFI 1090
            ++ +  EE     V +VFQ   LF   TV NNI +   +      E AEA      +E +
Sbjct: 73   NLNKVREE-----VGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAK----AMELL 123

Query: 1091 ERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAV 1150
            +++  G          SLSGG+ QR++IARAL  +  ++L DE T++LDPE    +   +
Sbjct: 124  DKV--GLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVM 181

Query: 1151 GTLC-AGKTVIVIAHRLRTVAN-ADKIVVLDSGRVAEEGNHKTL 1192
              L   G T++V+ H +       D+++ +D G + EEG  + L
Sbjct: 182  KQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDL 225



 Score = 52.0 bits (123), Expect = 9e-09
 Identities = 55/216 (25%), Positives = 90/216 (41%), Gaps = 19/216 (8%)

Query: 369 LRNVSLEIPAGTVCAVVGPSGSGKSTLA---NLVARFWDVDSGQVLVGGVDVREMGQDEL 425
           L+ +++ I  G V  V+GPSGSGKST     NL+  F            +  ++   +++
Sbjct: 19  LKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXN-LKAKDTNLNKV 77

Query: 426 MGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLP---HGYAT 481
              + +VFQ  +LF   +V  NI                          GL    H Y  
Sbjct: 78  REEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPD 137

Query: 482 VIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLM-AGKT 540
                   LSGG+            +  I++ DE T+  DPE    +    ++L   G T
Sbjct: 138 -------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMT 190

Query: 541 VIMVAHRLSTV--VGADKIVVLDGGRKVEEGTHQEL 574
           +++V H +     VG D+++ +DGG  +EEG  ++L
Sbjct: 191 MVVVTHEMGFAREVG-DRVLFMDGGYIIEEGKPEDL 225


>2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 88.6 bits (218), Expect = 9e-20
 Identities = 74/229 (32%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGRE--GASDE-------EVAEAA 1081
             K + +         V +VFQ   L+   +VA N+  G +  GA  E       +VAE  
Sbjct: 63   EKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL 120

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
            + AH L+   R P+           +LSGG+RQR++I R L+ +  V LLD+  ++LD  
Sbjct: 121  QLAHLLD---RKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAA 166

Query: 1142 NETLIQRAVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
                ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 167  LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 215



 Score = 62.4 bits (150), Expect = 7e-12
 Identities = 62/229 (27%), Positives = 101/229 (44%), Gaps = 13/229 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXX 468
           + +G   + +    E    + +VFQ   L+   SVAEN+  G                  
Sbjct: 59  LFIGEKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 469 XXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLI 528
              +       A ++  +   LSGG+            +  + +LD+  +  D      +
Sbjct: 117 AEVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQM 171

Query: 529 QKAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +    RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 172 RIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 220


>2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score = 88.6 bits (218), Expect = 9e-20
 Identities = 74/229 (32%), Positives = 113/229 (49%), Gaps = 29/229 (12%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGRE--GASDE-------EVAEAA 1081
             K + +         V +VFQ   L+   +VA N+  G +  GA  E       +VAE  
Sbjct: 63   EKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL 120

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
            + AH L+   R P+           +LSGG+RQR++I R L+ +  V LLD+  ++LD  
Sbjct: 121  QLAHLLD---RKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAA 166

Query: 1142 NETLIQRAVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
                ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 167  LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 215



 Score = 62.4 bits (150), Expect = 7e-12
 Identities = 62/229 (27%), Positives = 101/229 (44%), Gaps = 13/229 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXX 468
           + +G   + +    E    + +VFQ   L+   SVAEN+  G                  
Sbjct: 59  LFIGEKRMNDTPPAE--RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 469 XXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLI 528
              +       A ++  +   LSGG+            +  + +LD+  +  D      +
Sbjct: 117 AEVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQM 171

Query: 529 QKAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +    RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 172 RIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 220


>1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 254

 Score = 88.6 bits (218), Expect = 9e-20
 Identities = 75/227 (33%), Positives = 113/227 (49%), Gaps = 28/227 (12%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +G+ + L GVS    +G+VT ++GP+GSGKST   +   F + D GRV    KDI    E
Sbjct: 14   FGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN-KE 72

Query: 1041 ESWLAHVSIV--FQ-DVVLFDDTVANNIRIGR--EGAS-------------DEEVAEAAR 1082
             + L H  IV  FQ    L + TV  N+ IG    G S             +EE+ E  +
Sbjct: 73   PAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVE--K 130

Query: 1083 AAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE- 1141
            A   LEF+ +L   +D   GE    LSGG+ + + I RAL+ +  ++++DE  A + P  
Sbjct: 131  AFKILEFL-KLSHLYDRKAGE----LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGL 185

Query: 1142 NETLIQRAVGTLCAGKTVIVIAHRLRTVAN-ADKIVVLDSGRVAEEG 1187
               +    +     G T ++I HRL  V N  D + V+ +G++  EG
Sbjct: 186  AHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEG 232



 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 60/223 (26%), Positives = 89/223 (39%), Gaps = 22/223 (9%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL  VS+ +  G V  ++GP+GSGKSTL N++  F   D G+V     D+      EL  
Sbjct: 19  ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYH 78

Query: 428 -SLSLVFQDSHLFRE-SVAENIRRGR--PG-----------XXXXXXXXXXXXXXXXXFI 472
             +   FQ     +E +V EN+  G   PG                            F+
Sbjct: 79  YGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFL 138

Query: 473 NGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEH-LIQKA 531
             L H Y    G     LSGG+            +  ++V+DE  A   P   H +    
Sbjct: 139 K-LSHLYDRKAG----ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV 193

Query: 532 FERLMAGKTVIMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQE 573
            E    G T +++ HRL  V+   D + V+  G+ + EG  +E
Sbjct: 194 LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEE 236


>1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 61/197 (30%), Positives = 98/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 35   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI- 92

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    E I +  +  + VLGE G
Sbjct: 93   -----------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG 140

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++  
Sbjct: 141  ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 200

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 201  KMEHLKKADKILILHEG 217



 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 53/209 (25%), Positives = 90/209 (43%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 34  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 80

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I+        V+G  
Sbjct: 81  GRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 139

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
           G+ LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 140 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 199

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 200 SKMEHLKKADKILILHEGSSYFYGTFSEL 228


>1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 270

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 61/197 (30%), Positives = 98/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 39   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI- 96

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    E I +  +  + VLGE G
Sbjct: 97   -----------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG 144

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++  
Sbjct: 145  ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 204

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 205  KMEHLKKADKILILHEG 221



 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 53/209 (25%), Positives = 90/209 (43%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 38  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 84

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I+        V+G  
Sbjct: 85  GRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 143

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
           G+ LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 144 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 203

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 204 SKMEHLKKADKILILHEGSSYFYGTFSEL 232


>1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 61/197 (30%), Positives = 98/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 36   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI- 93

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    E I +  +  + VLGE G
Sbjct: 94   -----------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG 141

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++  
Sbjct: 142  ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 201

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 202  KMEHLKKADKILILHEG 218



 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 53/209 (25%), Positives = 90/209 (43%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 35  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 81

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I+        V+G  
Sbjct: 82  GRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 140

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
           G+ LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 141 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 200

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 201 SKMEHLKKADKILILHEGSSYFYGTFSEL 229


>2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 216

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 64/203 (31%), Positives = 101/203 (49%), Gaps = 20/203 (9%)

Query: 982  GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEE 1041
            G   VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ 
Sbjct: 17   GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQF 75

Query: 1042 SWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLEFIERLPQGFDT 1099
            SW+               T+  NI     G S +E       +A    E I +  +  + 
Sbjct: 76   SWI------------MPGTIKENII----GVSYDEYRYRSVIKACQLEEDISKFAEKDNI 119

Query: 1100 VLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKT 1158
            VLGE G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT
Sbjct: 120  VLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT 179

Query: 1159 VIVIAHRLRTVANADKIVVLDSG 1181
             I++  ++  +  ADKI++L  G
Sbjct: 180  RILVTSKMEHLKKADKILILHEG 202



 Score = 63.2 bits (152), Expect = 4e-12
 Identities = 56/224 (25%), Positives = 97/224 (43%), Gaps = 16/224 (7%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V + +VT  +E+   P L++++ +I  G + AV G +G+GK++L  ++            
Sbjct: 5   VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------ 52

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           +G ++  E G+ +  G +S   Q S +   ++ ENI                        
Sbjct: 53  MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEED 109

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQK 530
           I+        V+G  G+ LSGG+            DA + +LD    + D   E  + + 
Sbjct: 110 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 169

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 170 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 213


>2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 263

 Score = 87.8 bits (216), Expect = 2e-19
 Identities = 68/216 (31%), Positives = 108/216 (50%), Gaps = 13/216 (6%)

Query: 983  DEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEES 1042
            +++ L  VS V  EGE   + G +GSGKST  Q+ A   EP SG VL  G+    +    
Sbjct: 19   EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIR- 77

Query: 1043 WLAHVSIVFQ--DVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCLEFIERLPQGFDT 1099
               ++ I FQ  +   F + V + +    +    D +     + A  +EF+      FD+
Sbjct: 78   --RNIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKA--MEFV---GLDFDS 130

Query: 1100 VLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGT-LCAGKT 1158
                    LSGGE++R++IA  ++ +  +++LDE    LD E +T + R V      GKT
Sbjct: 131  FKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKT 190

Query: 1159 VIVIAHRLRTVAN-ADKIVVLDSGRVAEEGNHKTLL 1193
            VI+I+H + TV N  D++VVL+ G+   +G     L
Sbjct: 191  VILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFL 226



 Score = 72.8 bits (177), Expect = 5e-15
 Identities = 67/219 (30%), Positives = 96/219 (43%), Gaps = 25/219 (11%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL NVSL I  G    V G +GSGKSTL  +VA   +  SG VL  G   R+ G  E+  
Sbjct: 22  ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE--RKKGY-EIRR 78

Query: 428 SLSLVFQ--DSHLFRESV-------AENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHG 478
           ++ + FQ  +   F E V        +N    R                   F + +P  
Sbjct: 79  NIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPF- 137

Query: 479 YATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMA- 537
                      LSGGE            +  I++LDE     D E +  + +  E+    
Sbjct: 138 ----------FLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTL 187

Query: 538 GKTVIMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQELL 575
           GKTVI+++H + TV+   D++VVL+ G+KV +GT  E L
Sbjct: 188 GKTVILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFL 226


>2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 266

 Score = 87.8 bits (216), Expect = 2e-19
 Identities = 68/216 (31%), Positives = 108/216 (50%), Gaps = 13/216 (6%)

Query: 983  DEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEES 1042
            +++ L  VS V  EGE   + G +GSGKST  Q+ A   EP SG VL  G+    +    
Sbjct: 19   EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIR- 77

Query: 1043 WLAHVSIVFQ--DVVLFDDTVANNIRIG-REGASDEEVAEAARAAHCLEFIERLPQGFDT 1099
               ++ I FQ  +   F + V + +    +    D +     + A  +EF+      FD+
Sbjct: 78   --RNIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKA--MEFV---GLDFDS 130

Query: 1100 VLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGT-LCAGKT 1158
                    LSGGE++R++IA  ++ +  +++LDE    LD E +T + R V      GKT
Sbjct: 131  FKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKT 190

Query: 1159 VIVIAHRLRTVAN-ADKIVVLDSGRVAEEGNHKTLL 1193
            VI+I+H + TV N  D++VVL+ G+   +G     L
Sbjct: 191  VILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFL 226



 Score = 72.8 bits (177), Expect = 5e-15
 Identities = 67/219 (30%), Positives = 96/219 (43%), Gaps = 25/219 (11%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL NVSL I  G    V G +GSGKSTL  +VA   +  SG VL  G   R+ G  E+  
Sbjct: 22  ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE--RKKGY-EIRR 78

Query: 428 SLSLVFQ--DSHLFRESV-------AENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHG 478
           ++ + FQ  +   F E V        +N    R                   F + +P  
Sbjct: 79  NIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPF- 137

Query: 479 YATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMA- 537
                      LSGGE            +  I++LDE     D E +  + +  E+    
Sbjct: 138 ----------FLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTL 187

Query: 538 GKTVIMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQELL 575
           GKTVI+++H + TV+   D++VVL+ G+KV +GT  E L
Sbjct: 188 GKTVILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFL 226


>1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
          Length = 253

 Score = 87.4 bits (215), Expect = 2e-19
 Identities = 74/227 (32%), Positives = 113/227 (49%), Gaps = 28/227 (12%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +G+ + L GVS    +G+VT ++GP+GSGKST   +   F + D GRV    KDI    E
Sbjct: 13   FGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN-KE 71

Query: 1041 ESWLAHVSIV--FQ-DVVLFDDTVANNIRIG--REGAS-------------DEEVAEAAR 1082
             + L H  IV  FQ    L + TV  N+ IG    G S             +EE+ E  +
Sbjct: 72   PAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVE--K 129

Query: 1083 AAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE- 1141
            A   LEF+ +L   +D   GE    LSGG+ + + I RAL+ +  ++++D+  A + P  
Sbjct: 130  AFKILEFL-KLSHLYDRKAGE----LSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGL 184

Query: 1142 NETLIQRAVGTLCAGKTVIVIAHRLRTVAN-ADKIVVLDSGRVAEEG 1187
               +    +     G T ++I HRL  V N  D + V+ +G++  EG
Sbjct: 185  AHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEG 231



 Score = 57.0 bits (136), Expect = 3e-10
 Identities = 59/223 (26%), Positives = 89/223 (39%), Gaps = 22/223 (9%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL  VS+ +  G V  ++GP+GSGKSTL N++  F   D G+V     D+      EL  
Sbjct: 18  ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYH 77

Query: 428 -SLSLVFQDSHLFRE-SVAENIRRG--RPG-----------XXXXXXXXXXXXXXXXXFI 472
             +   FQ     +E +V EN+  G   PG                            F+
Sbjct: 78  YGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKILEFL 137

Query: 473 NGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEH-LIQKA 531
             L H Y    G     LSGG+            +  ++V+D+  A   P   H +    
Sbjct: 138 K-LSHLYDRKAG----ELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHV 192

Query: 532 FERLMAGKTVIMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQE 573
            E    G T +++ HRL  V+   D + V+  G+ + EG  +E
Sbjct: 193 LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEE 235


>1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 253

 Score = 87.4 bits (215), Expect = 2e-19
 Identities = 75/227 (33%), Positives = 113/227 (49%), Gaps = 28/227 (12%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +G+ + L GVS    +G+VT ++GP+GSGKST   +   F + D GRV    KDI    E
Sbjct: 14   FGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN-KE 72

Query: 1041 ESWLAHVSIV--FQ-DVVLFDDTVANNIRIG--REGAS-------------DEEVAEAAR 1082
             + L H  IV  FQ    L + TV  N+ IG    G S             +EE+ E  +
Sbjct: 73   PAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVE--K 130

Query: 1083 AAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE- 1141
            A   LEF+ +L   +D   GE    LSGG+ + + I RAL+ +  ++++DE  A + P  
Sbjct: 131  AFKILEFL-KLSHLYDRKAGE----LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGL 185

Query: 1142 NETLIQRAVGTLCAGKTVIVIAHRLRTVAN-ADKIVVLDSGRVAEEG 1187
               +    +     G T ++I HRL  V N  D + V+ +G++  EG
Sbjct: 186  AHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEG 232



 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 60/223 (26%), Positives = 89/223 (39%), Gaps = 22/223 (9%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL  VS+ +  G V  ++GP+GSGKSTL N++  F   D G+V     D+      EL  
Sbjct: 19  ALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYH 78

Query: 428 -SLSLVFQDSHLFRE-SVAENIRRG--RPG-----------XXXXXXXXXXXXXXXXXFI 472
             +   FQ     +E +V EN+  G   PG                            F+
Sbjct: 79  YGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKILEFL 138

Query: 473 NGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEH-LIQKA 531
             L H Y    G     LSGG+            +  ++V+DE  A   P   H +    
Sbjct: 139 K-LSHLYDRKAG----ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV 193

Query: 532 FERLMAGKTVIMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQE 573
            E    G T +++ HRL  V+   D + V+  G+ + EG  +E
Sbjct: 194 LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEE 236


>1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 34   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 91

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 92   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 139

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 140  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 199

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 200  KMEHLRKADKILILHQG 216



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 33  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 79

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 80  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 198

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 199 SKMEHLRKADKILILHQGSSYFYGTFSEL 227


>1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 256

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 29   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 86

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 87   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 134

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 135  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 194

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 195  KMEHLRKADKILILHQG 211



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 28  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 74

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 75  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 133

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 134 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 193

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 194 SKMEHLRKADKILILHQGSSYFYGTFSEL 222


>1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 273

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 46   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 103

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 104  -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 151

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 152  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 211

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 212  KMEHLRKADKILILHQG 228



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 45  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 91

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 92  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 150

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 151 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 210

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 211 SKMEHLRKADKILILHQGSSYFYGTFSEL 239


>1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 44   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 101

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 102  -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 149

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 150  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 209

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 210  KMEHLRKADKILILHQG 226



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 43  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 89

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 90  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 148

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 149 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 208

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 209 SKMEHLRKADKILILHQGSSYFYGTFSEL 237


>1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 44   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 101

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 102  -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 149

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 150  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 209

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 210  KMEHLRKADKILILHQG 226



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 43  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 89

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 90  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 148

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 149 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 208

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 209 SKMEHLRKADKILILHQGSSYFYGTFSEL 237


>1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 263

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 33   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 90

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 91   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 138

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 139  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 198

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 199  KMEHLRKADKILILHQG 215



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 32  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 78

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 79  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 137

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 138 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 197

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 198 SKMEHLRKADKILILHQGSSYFYGTFSEL 226


>1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 35   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 92

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 93   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 140

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 141  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 200

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 201  KMEHLRKADKILILHQG 217



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 34  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 80

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 81  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 199

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 200 SKMEHLRKADKILILHQGSSYFYGTFSEL 228


>1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 35   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 92

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 93   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 140

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 141  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 200

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 201  KMEHLRKADKILILHQG 217



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 34  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 80

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 81  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 199

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 200 SKMEHLRKADKILILHQGSSYFYGTFSEL 228


>1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 34   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 91

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 92   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 139

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 140  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 199

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 200  KMEHLRKADKILILHQG 216



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 33  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 79

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 80  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 198

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 199 SKMEHLRKADKILILHQGSSYFYGTFSEL 227


>1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 37   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 94

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 95   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 142

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 143  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 202

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 203  KMEHLRKADKILILHQG 219



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 36  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 82

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 83  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 141

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 142 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 201

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 202 SKMEHLRKADKILILHQGSSYFYGTFSEL 230


>1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 37   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 94

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 95   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 142

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 143  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 202

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 203  KMEHLRKADKILILHQG 219



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 36  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 82

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 83  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 141

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 142 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 201

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 202 SKMEHLRKADKILILHQGSSYFYGTFSEL 230


>1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 36   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 93

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 94   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 141

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 142  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 201

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 202  KMEHLRKADKILILHQG 218



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 35  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 81

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 82  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 140

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 141 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 200

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 201 SKMEHLRKADKILILHQGSSYFYGTFSEL 229


>1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 34   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 91

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 92   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 139

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 140  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 199

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 200  KMEHLRKADKILILHQG 216



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 33  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 79

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 80  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 198

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 199 SKMEHLRKADKILILHQGSSYFYGTFSEL 227


>1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 36   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 93

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 94   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 141

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 142  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 201

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 202  KMEHLRKADKILILHQG 218



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 35  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 81

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 82  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 140

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 141 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 200

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 201 SKMEHLRKADKILILHQGSSYFYGTFSEL 229


>1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 37   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 94

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 95   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 142

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 143  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 202

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 203  KMEHLRKADKILILHQG 219



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 36  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 82

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 83  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 141

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 142 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 201

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 202 SKMEHLRKADKILILHQGSSYFYGTFSEL 230


>1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 87.0 bits (214), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 35   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 92

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 93   -----------MPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 140

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 141  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 200

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 201  KMEHLRKADKILILHQG 217



 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 34  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 80

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 81  GRVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 199

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 200 SKMEHLRKADKILILHQGSSYFYGTFSEL 228


>1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 260

 Score = 86.7 bits (213), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 30   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 87

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI I      +       +A    + I +  +  +TVLGE G
Sbjct: 88   -----------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 135

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 136  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 195

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 196  KMEHLRKADKILILHQG 212



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 29  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 75

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 76  GRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 134

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 135 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 194

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 195 SKMEHLRKADKILILHQGSSYFYGTFSEL 223


>1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 86.7 bits (213), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 35   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 92

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI I      +       +A    + I +  +  +TVLGE G
Sbjct: 93   -----------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 140

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 141  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 200

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 201  KMEHLRKADKILILHQG 217



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 34  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 80

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 81  GRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 199

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 200 SKMEHLRKADKILILHQGSSYFYGTFSEL 228


>1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 86.7 bits (213), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 35   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 92

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI I      +       +A    + I +  +  +TVLGE G
Sbjct: 93   -----------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 140

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 141  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 200

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 201  KMEHLRKADKILILHQG 217



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 34  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 80

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 81  GRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 139

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 140 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 199

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 200 SKMEHLRKADKILILHQGSSYFYGTFSEL 228


>1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 86.7 bits (213), Expect = 3e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 34   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 91

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI I      +       +A    + I +  +  +TVLGE G
Sbjct: 92   -----------MPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 139

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 140  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 199

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 200  KMEHLRKADKILILHQG 216



 Score = 65.5 bits (158), Expect = 8e-13
 Identities = 58/209 (27%), Positives = 89/209 (42%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 33  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 79

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I        TV+G  
Sbjct: 80  GRVSFCSQFSWIMPGTIKENIISG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 198

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 199 SKMEHLRKADKILILHQGSSYFYGTFSEL 227


>1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 85.9 bits (211), Expect = 6e-19
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++    +GE+ A+ G +GSGK++   L     E   G +  SG+ ++  S+ SW+ 
Sbjct: 34   VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCSQFSWI- 91

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    + I +  +  +TVLGE G
Sbjct: 92   -----------MPGTIKENIIRG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG 139

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDP-ENETLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD    E + +  V  L A KT I++  
Sbjct: 140  VTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS 199

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 200  KMEHLRKADKILILHQG 216



 Score = 67.8 bits (164), Expect = 2e-13
 Identities = 59/209 (28%), Positives = 90/209 (43%), Gaps = 15/209 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L+N++L I  G + A+ G +GSGK++L  L+            +G ++  E G  +  
Sbjct: 33  PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI------------LGELEASE-GIIKHS 79

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI RG                     I        TV+G  
Sbjct: 80  GRVSFCSQFSWIMPGTIKENIIRG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEG 138

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP-ENEHLIQKAFERLMAGKTVIMVA 545
           GV LSGG+            DA + +LD    + D    E + +    +LMA KT I+V 
Sbjct: 139 GVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVT 198

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 199 SKMEHLRKADKILILHQGSSYFYGTFSEL 227


>2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 358

 Score = 83.6 bits (205), Expect = 3e-18
 Identities = 63/214 (29%), Positives = 102/214 (47%), Gaps = 17/214 (7%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +G  + + GVSF  ++GE  AL+GPSG GK+T   + A  ++P SG +     D+     
Sbjct: 12   FGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFD--DVLVNDI 69

Query: 1041 ESWLAHVSIVFQDVVLFDD-TVANNIRI---GREGASDEEVAEAARAAHCLEFIERLPQG 1096
                  V +VFQ+  L+   TV  NI      R  + DE        A  L         
Sbjct: 70   PPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLL-------- 121

Query: 1097 FDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLC-- 1154
             D +L      LSGG++QR+++ARAL+K   V+L DE  ++LD     +++  +  L   
Sbjct: 122  IDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQE 181

Query: 1155 AGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
             G T + + H +   +  A +I V + G++ + G
Sbjct: 182  LGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYG 215



 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 49/214 (22%), Positives = 86/214 (40%), Gaps = 17/214 (7%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           A+  VS E+  G   A++GPSG GK+T   ++A  +   SG++    V V ++       
Sbjct: 17  AVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDI--PPKYR 74

Query: 428 SLSLVFQDSHLF-RESVAENIR---RGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVI 483
            + +VFQ+  L+   +V ENI    R R                     N        ++
Sbjct: 75  EVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDN--------LL 126

Query: 484 GSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLM--AGKTV 541
             +   LSGG+               +++ DE  +  D     +++   + L    G T 
Sbjct: 127 DRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITS 186

Query: 542 IMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           + V H +   +  A +I V + G+ V+ GT  E+
Sbjct: 187 VYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEV 220


>2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 254

 Score = 82.8 bits (203), Expect = 5e-18
 Identities = 58/197 (29%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 21   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI- 78

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    E I +  +  + VLGE G
Sbjct: 79   -----------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG 126

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVIAH 1164
             +LS G++ ++S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++  
Sbjct: 127  ITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 186

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 187  KMEHLKKADKILILHEG 203



 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 56/225 (24%), Positives = 97/225 (43%), Gaps = 16/225 (7%)

Query: 352 VSLRDVTFSYEDD-AEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           V + +VT  +E+    P L++++ +I  G + AV G +G+GK++L  ++           
Sbjct: 4   VVMENVTAFWEEGLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI----------- 52

Query: 411 LVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXX 470
            +G ++  E G+ +  G +S   Q S +   ++ ENI  G                    
Sbjct: 53  -MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEE 109

Query: 471 FINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQ 529
            I+        V+G  G+ LS G+            DA + +LD    + D   E  + +
Sbjct: 110 DISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE 169

Query: 530 KAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
               +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 170 SCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 214


>1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 246

 Score = 81.6 bits (200), Expect = 1e-17
 Identities = 60/204 (29%), Positives = 101/204 (49%), Gaps = 20/204 (9%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            + +  VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+
Sbjct: 10   FWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQ 68

Query: 1041 ESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLEFIERLPQGFD 1098
             SW+               T+  NI     G S +E       +A    E I +  +  +
Sbjct: 69   FSWI------------MPGTIKENII----GVSYDEYRYRSVIKACQLEEDISKFAEKDN 112

Query: 1099 TVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGK 1157
             VLGE G +LS G++ ++S+ARA+ KDA + LLD     LD   E  + +  V  L A K
Sbjct: 113  IVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANK 172

Query: 1158 TVIVIAHRLRTVANADKIVVLDSG 1181
            T I++  ++  +  ADKI++L  G
Sbjct: 173  TRILVTSKMEHLKKADKILILHEG 196



 Score = 54.3 bits (129), Expect = 2e-09
 Identities = 55/224 (24%), Positives = 95/224 (42%), Gaps = 19/224 (8%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V + +VT  +E    P L++++ +I  G + AV G +G+GK++L  ++            
Sbjct: 2   VVMENVTAFWET---PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------ 46

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           +G ++  E G+ +  G +S   Q S +   ++ ENI                        
Sbjct: 47  MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEED 103

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQK 530
           I+        V+G  G+ LS G+            DA + +LD    + D   E  + + 
Sbjct: 104 ISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 163

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 164 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 207


>1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 232

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 64/212 (30%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 987  LHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA- 1045
            L  V+   +EGE  +++GPSGSGKST   +     +P  G V        +  ++     
Sbjct: 21   LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKI 80

Query: 1046 ---HVSIVFQDVVLFDD-TVANNIRIG-----REGASDEEVAEAARAAHCLEFIERLPQG 1096
                +  VFQ   L    T   N+ +      R   S EE     RA  CL+  E L + 
Sbjct: 81   RRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEE--RRKRALECLKMAE-LEER 137

Query: 1097 FDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCA- 1155
            F          LSGG++QR++IARAL  + P++L D+ T +LD +    I + +  L   
Sbjct: 138  F---ANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEE 194

Query: 1156 -GKTVIVIAHRLRTVANADKIVVLDSGRVAEE 1186
             GKTV+V+ H +      ++I+ L  G V  E
Sbjct: 195  DGKTVVVVTHDINVARFGERIIYLKDGEVERE 226



 Score = 65.9 bits (159), Expect = 6e-13
 Identities = 59/242 (24%), Positives = 100/242 (41%), Gaps = 42/242 (17%)

Query: 352 VSLRDVTFSYEDDAEP--ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           + L++VT +Y+   E   AL+NV+L I  G   +++GPSGSGKST+ N++        G+
Sbjct: 2   IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGE 61

Query: 410 VLVGGVDVREMGQDEL----MGSLSLVFQDSHL-----------------FRESVAENIR 448
           V +  +   ++  DEL       +  VFQ  +L                 +R +++   R
Sbjct: 62  VYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEER 121

Query: 449 RGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDA 508
           R R                   F N  P+            LSGG+            + 
Sbjct: 122 RKR------ALECLKMAELEERFANHKPN-----------QLSGGQQQRVAIARALANNP 164

Query: 509 PIVVLDEATAFSDPENEHLIQKAFERLMA--GKTVIMVAHRLSTVVGADKIVVLDGGRKV 566
           PI++ D+ T   D +    I +  ++L    GKTV++V H ++     ++I+ L  G   
Sbjct: 165 PIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVE 224

Query: 567 EE 568
            E
Sbjct: 225 RE 226


>1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 230

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 64/212 (30%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 987  LHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA- 1045
            L  V+   +EGE  +++GPSGSGKST   +     +P  G V        +  ++     
Sbjct: 21   LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKI 80

Query: 1046 ---HVSIVFQDVVLFDD-TVANNIRIG-----REGASDEEVAEAARAAHCLEFIERLPQG 1096
                +  VFQ   L    T   N+ +      R   S EE     RA  CL+  E L + 
Sbjct: 81   RRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEE--RRKRALECLKMAE-LEER 137

Query: 1097 FDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCA- 1155
            F          LSGG++QR++IARAL  + P++L D+ T +LD +    I + +  L   
Sbjct: 138  F---ANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEE 194

Query: 1156 -GKTVIVIAHRLRTVANADKIVVLDSGRVAEE 1186
             GKTV+V+ H +      ++I+ L  G V  E
Sbjct: 195  DGKTVVVVTHDINVARFGERIIYLKDGEVERE 226



 Score = 65.9 bits (159), Expect = 6e-13
 Identities = 59/242 (24%), Positives = 100/242 (41%), Gaps = 42/242 (17%)

Query: 352 VSLRDVTFSYEDDAEP--ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           + L++VT +Y+   E   AL+NV+L I  G   +++GPSGSGKST+ N++        G+
Sbjct: 2   IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGE 61

Query: 410 VLVGGVDVREMGQDEL----MGSLSLVFQDSHL-----------------FRESVAENIR 448
           V +  +   ++  DEL       +  VFQ  +L                 +R +++   R
Sbjct: 62  VYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEER 121

Query: 449 RGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDA 508
           R R                   F N  P+            LSGG+            + 
Sbjct: 122 RKR------ALECLKMAELEERFANHKPN-----------QLSGGQQQRVAIARALANNP 164

Query: 509 PIVVLDEATAFSDPENEHLIQKAFERLMA--GKTVIMVAHRLSTVVGADKIVVLDGGRKV 566
           PI++ D+ T   D +    I +  ++L    GKTV++V H ++     ++I+ L  G   
Sbjct: 165 PIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVE 224

Query: 567 EE 568
            E
Sbjct: 225 RE 226


>2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 249

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 62/199 (31%), Positives = 99/199 (49%), Gaps = 22/199 (11%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 28   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI- 85

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLEFIERLPQGFDTVLGE 1103
                          T+  NI     G S +E       +A    E I +  +  + VLG 
Sbjct: 86   -----------MPGTIKENII----GVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG- 129

Query: 1104 NGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVI 1162
             G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++
Sbjct: 130  -GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV 188

Query: 1163 AHRLRTVANADKIVVLDSG 1181
              ++  +  ADKI++L  G
Sbjct: 189  TSKMEHLKKADKILILHEG 207



 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 18/209 (8%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 27  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 73

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q+S +   ++ ENI                        I+        V+G  
Sbjct: 74  GRISFCSQNSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG-- 129

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
           G+ LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 130 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 189

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 190 SKMEHLKKADKILILHEGSSYFYGTFSEL 218


>2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 231

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 62/199 (31%), Positives = 99/199 (49%), Gaps = 22/199 (11%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 14   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI- 71

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLEFIERLPQGFDTVLGE 1103
                          T+  NI     G S +E       +A    E I +  +  + VLG 
Sbjct: 72   -----------MPGTIKENII----GVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG- 115

Query: 1104 NGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVI 1162
             G +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++
Sbjct: 116  -GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV 174

Query: 1163 AHRLRTVANADKIVVLDSG 1181
              ++  +  ADKI++L  G
Sbjct: 175  TSKMEHLKKADKILILHEG 193



 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 51/207 (24%), Positives = 89/207 (42%), Gaps = 18/207 (8%)

Query: 369 LRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMGS 428
           L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  G 
Sbjct: 15  LKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHSGR 61

Query: 429 LSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGV 488
           +S   Q+S +   ++ ENI                        I+        V+G  G+
Sbjct: 62  ISFCSQNSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG--GI 117

Query: 489 HLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVAHR 547
            LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V  +
Sbjct: 118 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 177

Query: 548 LSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +  +  ADKI++L  G     GT  EL
Sbjct: 178 MEHLKKADKILILHEGSSYFYGTFSEL 204


>1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 268

 Score = 80.9 bits (198), Expect = 2e-17
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 17/197 (8%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 38   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI- 95

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G     +       +A    E I +  +  + VLGE  
Sbjct: 96   -----------MPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE-- 141

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++  
Sbjct: 142  ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 201

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 202  KMEHLKKADKILILHEG 218



 Score = 53.1 bits (126), Expect = 4e-09
 Identities = 52/209 (24%), Positives = 89/209 (42%), Gaps = 17/209 (8%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 37  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 83

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     I+        V+G  
Sbjct: 84  GRISFCSQFSWIMPGTIKENIIAG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE- 141

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
            + LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 142 -ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 200

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 201 SKMEHLKKADKILILHEGSSYFYGTFSEL 229


>3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
          Length = 343

 Score = 80.5 bits (197), Expect = 2e-17
 Identities = 73/268 (27%), Positives = 119/268 (44%), Gaps = 32/268 (11%)

Query: 985  EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWL 1044
            + L+ VS     G++  ++G SG+GKST  +       P  G VL  G+++   SE    
Sbjct: 19   QALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT 78

Query: 1045 A---HVSIVFQDVVLFDD-TVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTV 1100
                 + ++FQ   L    TV  N+ +  E  +  +     R    L  +     G    
Sbjct: 79   KARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-----GLGDK 133

Query: 1101 LGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTL--CAGKT 1158
                 ++LSGG++QR++IARAL  +  V+L DEAT++LDP     I   +  +    G T
Sbjct: 134  HDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLT 193

Query: 1159 VIVIAHRLRTVAN-ADKIVVLDSGRVAEE-------GNHKTLLAEDGLYARLW------- 1203
            +++I H +  V    D + V+ +G + E+        + KT LA+  + + L        
Sbjct: 194  ILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDY 253

Query: 1204 --RLQQESSSWTVPADR----GDAADVP 1225
              RLQ E  +  VP  R    G + D P
Sbjct: 254  QERLQAEPFTDCVPMLRLEFTGQSVDAP 281



 Score = 63.2 bits (152), Expect = 4e-12
 Identities = 54/216 (25%), Positives = 91/216 (42%), Gaps = 12/216 (5%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           AL NVSL +PAG +  V+G SG+GKSTL   V        G VLV G ++  + + EL  
Sbjct: 20  ALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTK 79

Query: 428 S---LSLVFQDSHLF-RESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVI 483
           +   + ++FQ  +L    +V  N+                        +     G     
Sbjct: 80  ARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-----GLGDKH 134

Query: 484 GSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERL--MAGKTV 541
            S   +LSGG+            +  +++ DEAT+  DP     I +  + +    G T+
Sbjct: 135 DSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTI 194

Query: 542 IMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQELLA 576
           +++ H +  V    D + V+  G  +E+ T  E+ +
Sbjct: 195 LLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFS 230


>2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 215

 Score = 80.1 bits (196), Expect = 3e-17
 Identities = 60/201 (29%), Positives = 97/201 (48%), Gaps = 18/201 (8%)

Query: 982  GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEE 1041
            G   VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ 
Sbjct: 18   GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQF 76

Query: 1042 SWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVL 1101
            SW+               T+  NI  G     +       +A    E I +  +  + VL
Sbjct: 77   SWI------------MPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 123

Query: 1102 GENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVI 1160
            G    +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I
Sbjct: 124  G---ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 180

Query: 1161 VIAHRLRTVANADKIVVLDSG 1181
            ++  ++  +  ADKI++L  G
Sbjct: 181  LVTSKMEHLKKADKILILHEG 201



 Score = 58.5 bits (140), Expect = 1e-10
 Identities = 56/224 (25%), Positives = 97/224 (43%), Gaps = 18/224 (8%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVL 411
           V + +VT  +E+   P L++++ +I  G + AV G +G+GK++L  ++            
Sbjct: 6   VVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------ 53

Query: 412 VGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXF 471
           +G ++  E G+ +  G +S   Q S +   ++ ENI  G                     
Sbjct: 54  MGELEPSE-GKIKHSGRISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEED 111

Query: 472 INGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQK 530
           I+        V+G   + LSGG+            DA + +LD    + D   E  + + 
Sbjct: 112 ISKFAEKDNIVLG---ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 168

Query: 531 AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              +LMA KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 169 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 212


>1b0uA [c.37.1] HISTIDINE PERMEASE
          Length = 258

 Score = 80.1 bits (196), Expect = 3e-17
 Identities = 69/228 (30%), Positives = 114/228 (50%), Gaps = 27/228 (11%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDI----- 1035
            YG  EVL GVS  AR G+V          KST  +      +P  G ++ +G++I     
Sbjct: 12   YGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLVRD 71

Query: 1036 ----AEFSEESWL----AHVSIVFQDVVLFDD-TVANNIR---IGREGASDEEVAEAARA 1083
                 + ++++ L      +++VFQ   L+   TV  N+    I   G S  +  E A  
Sbjct: 72   KDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERA-- 129

Query: 1084 AHCLEFIERLPQGFDT-VLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPEN 1142
               L+++ ++  G D    G+    LSGG++QR+SIARAL  +  V+L DE T++LDPE 
Sbjct: 130  ---LKYLAKV--GIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPEL 184

Query: 1143 ETLIQRAVGTLC-AGKTVIVIAHRLRTVAN-ADKIVVLDSGRVAEEGN 1188
               + R +  L   GKT++V+ H +    + +  ++ L  G++ EEG+
Sbjct: 185  VGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGD 232



 Score = 40.0 bits (92), Expect = 4e-05
 Identities = 47/222 (21%), Positives = 84/222 (37%), Gaps = 19/222 (8%)

Query: 369 LRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDE---- 424
           L+ VSL+  AG V          KST    +        G ++V G ++  +   +    
Sbjct: 18  LKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLK 77

Query: 425 ---------LMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFING 474
                    L   L++VFQ  +L+   +V EN+                          G
Sbjct: 78  VADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVG 137

Query: 475 LPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFER 534
           +        G   VHLSGG+            +  +++ DE T+  DPE    + +  ++
Sbjct: 138 IDE---RAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQ 194

Query: 535 LM-AGKTVIMVAHRLSTVVG-ADKIVVLDGGRKVEEGTHQEL 574
           L   GKT+++V H +      +  ++ L  G+  EEG  +++
Sbjct: 195 LAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQV 236


>2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 79.3 bits (194), Expect = 5e-17
 Identities = 62/211 (29%), Positives = 102/211 (48%), Gaps = 23/211 (10%)

Query: 974  FQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGK 1033
            F+  +    +  VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+
Sbjct: 21   FEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR 80

Query: 1034 DIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLEFIE 1091
             I+  S+ SW+               T+  NI     G S +E       +A    E I 
Sbjct: 81   -ISFCSQNSWI------------MPGTIKENII----GVSYDEYRYRSVIKACQLEEDIS 123

Query: 1092 RLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAV 1150
            +  +  + VLG    +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V
Sbjct: 124  KFAEKDNIVLG---ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCV 180

Query: 1151 GTLCAGKTVIVIAHRLRTVANADKIVVLDSG 1181
              L A KT I++  ++  +  ADKI++L  G
Sbjct: 181  CKLMANKTRILVTSKMEHLKKADKILILHEG 211



 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 51/209 (24%), Positives = 89/209 (42%), Gaps = 19/209 (9%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 32  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 78

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q+S +   ++ ENI                        I+        V+G  
Sbjct: 79  GRISFCSQNSWIMPGTIKENIIG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG-- 134

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
            + LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 135 -ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 193

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 194 SKMEHLKKADKILILHEGSSYFYGTFSEL 222


>1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
          Length = 372

 Score = 77.8 bits (190), Expect = 2e-16
 Identities = 59/223 (26%), Positives = 111/223 (49%), Gaps = 27/223 (12%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +G+   +  +S   ++GE   L+GPSG GK+T  ++ A   EP  G++    K +A+  +
Sbjct: 13   FGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEK 72

Query: 1041 ESWL----AHVSIVFQDVVLFDD-TVANNI-------RIGREGASDEEVAEAARAAHCLE 1088
              ++      +++VFQ   L+   TV +NI       ++ R+   D+ V E A      E
Sbjct: 73   GIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQ-EIDQRVREVAELLGLTE 131

Query: 1089 FIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQR 1148
             + R P+            LSGG+RQR+++ RA+++   V L+DE  ++LD +    ++ 
Sbjct: 132  LLNRKPR-----------ELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRA 180

Query: 1149 AVGTL--CAGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEGN 1188
             +  L    G T I + H ++  +   D+I V++ G + + G+
Sbjct: 181  ELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGS 223



 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 47/220 (21%), Positives = 89/220 (40%), Gaps = 23/220 (10%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVG---------GVDVR 418
           A+R +SLE+  G    ++GPSG GK+T   ++A   +   GQ+ +G         G+ V 
Sbjct: 18  AVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVP 77

Query: 419 EMGQDELMGSLSLVFQDSHLF-RESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPH 477
              +D     +++VFQ   L+   +V +NI                        +     
Sbjct: 78  PKDRD-----IAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELL----- 127

Query: 478 GYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERL-- 535
           G   ++  +   LSGG+               + ++DE  +  D +    ++   ++L  
Sbjct: 128 GLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQR 187

Query: 536 MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
             G T I V H ++  +   D+I V++ G   + G+  E+
Sbjct: 188 QLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEV 227


>2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 344

 Score = 77.8 bits (190), Expect = 2e-16
 Identities = 68/205 (33%), Positives = 98/205 (47%), Gaps = 52/205 (25%)

Query: 996  EGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDVV 1055
            EGE    VGPSG GKST  ++ A                            V +VFQ   
Sbjct: 20   EGEFVVFVGPSGCGKSTLLRMIAGL-------------------------GVGMVFQSYA 54

Query: 1056 LFDD-TVANNIRIGRE--GASDE-------EVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
            L+   +VA N+  G +  GA  E       +VAE  + AH L   +R P+          
Sbjct: 55   LYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLL---DRKPK---------- 101

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTL--CAGKTVIVIA 1163
             +LSGG+RQR++I R L+ +  V LLDE  ++LD      ++  +  L    G+T+I + 
Sbjct: 102  -ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVT 160

Query: 1164 H-RLRTVANADKIVVLDSGRVAEEG 1187
            H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 161  HDQVEAMTLADKIVVLDAGRVAQVG 185



 Score = 50.4 bits (119), Expect = 3e-08
 Identities = 60/229 (26%), Positives = 90/229 (39%), Gaps = 43/229 (18%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT S         ++++L+I  G     VGPSG GKSTL  ++A         
Sbjct: 1   ASVQLQNVTVS---------KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL------- 44

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXX 468
                              + +VFQ   L+   SVAEN+  G                  
Sbjct: 45  ------------------GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 86

Query: 469 XXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLI 528
              +       A ++  +   LSGG+            +  + +LDE  +  D      +
Sbjct: 87  AEVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQM 141

Query: 529 QKAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           +    RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 142 RIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 190


>2d2fA [x.x.x] SUFC PROTEIN
          Length = 246

 Score = 77.4 bits (189), Expect = 2e-16
 Identities = 65/220 (29%), Positives = 104/220 (47%), Gaps = 13/220 (5%)

Query: 984  EEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVLCSGKDIAEFS-E 1040
            E +L GV+ V  +GEV AL+GP+G+GKST  ++ A    +  + G +L  G++I E S +
Sbjct: 15   ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPD 74

Query: 1041 ESWLAHVSIVFQ-DVVLFDDTVANNIRIGREGASDEEVAEA---ARAAHCLEFIERLPQG 1096
            E     + + FQ  V +   T+AN +R+  +     EV  A    +    LE ++     
Sbjct: 75   ERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESY 134

Query: 1097 FDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCA- 1155
                L E     SGGE++R  I + L+ +    +LDE  + LD +   ++ R V  +   
Sbjct: 135  LSRYLNE---GFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGP 191

Query: 1156 --GKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLL 1193
              G  VI    R+      DK+ V+  GRV   G  +  L
Sbjct: 192  NFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELAL 231



 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 13/229 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDS 407
           + + +RD+  S   D E  L+ V+L +P G V A++GP+G+GKSTL  ++A    + V+ 
Sbjct: 1   SQLEIRDLWASI--DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVER 58

Query: 408 GQVLVGGVDVREMGQDE-LMGSLSLVFQ-DSHLFRESVAENIRRGRPGXXXXXXXXXXXX 465
           G++L+ G ++ E+  DE     L L FQ    +   ++A  +R                 
Sbjct: 59  GEILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFW 118

Query: 466 XXXXXFINGL--PHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPE 523
                 +  L     Y +   +EG   SGGE            +    VLDE  +  D +
Sbjct: 119 TKVKKALELLDWDESYLSRYLNEG--FSGGEKKRNEILQLLVLEPTYAVLDETDSGLDID 176

Query: 524 NEHLIQKAFERLMA---GKTVIMVAHRLSTVVGADKIVVLDGGRKVEEG 569
              ++ +    +     G  VI    R+   +  DK+ V+  GR V  G
Sbjct: 177 ALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATG 225


>2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 363

 Score = 77.4 bits (189), Expect = 2e-16
 Identities = 66/204 (32%), Positives = 101/204 (49%), Gaps = 31/204 (15%)

Query: 996  EGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDVV 1055
            EGE    VGPSG GKST  ++ A      SG +    K + +         +  ++  + 
Sbjct: 20   EGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVALYPHL- 78

Query: 1056 LFDDTVANNIRIGRE--GASDE-------EVAEAARAAHCLEFIERLPQGFDTVLGENGA 1106
                +VA N+  G +  GA  E       +VAE  + AH L+   R P+           
Sbjct: 79   ----SVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD---RKPK----------- 120

Query: 1107 SLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTL--CAGKTVIVIAH 1164
            +LSGG+RQR++I R L+ +  V LLDE  ++LD      ++  +  L    G+T+I + H
Sbjct: 121  ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH 180

Query: 1165 -RLRTVANADKIVVLDSGRVAEEG 1187
             ++  +  ADKIVVLD+GRVA+ G
Sbjct: 181  DQVEAMTLADKIVVLDAGRVAQVG 204



 Score = 60.1 bits (144), Expect = 3e-11
 Identities = 63/228 (27%), Positives = 97/228 (42%), Gaps = 22/228 (9%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT S         ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTVS---------KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 51

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXX 469
           + +G   + +    E    + +V    HL   SVAEN+  G                   
Sbjct: 52  LFIGEKRMNDTPPAE--RGVGMVALYPHL---SVAENMSFGLKLAGAKKEVINQRVNQVA 106

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
             +       A ++  +   LSGG+            +  + +LDE  +  D      ++
Sbjct: 107 EVLQ-----LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMR 161

Query: 530 KAFERL--MAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
               RL    G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 162 IEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 209


>2d2eA [x.x.x] SUFC PROTEIN
          Length = 239

 Score = 75.9 bits (185), Expect = 6e-16
 Identities = 63/219 (28%), Positives = 102/219 (46%), Gaps = 16/219 (7%)

Query: 984  EEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVLCSGKDIAEFS-E 1040
            E +L GV+ V  +GEV AL+GP+G+GKST  ++ A    +  + G +L  G++I E S +
Sbjct: 15   ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPD 74

Query: 1041 ESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEA---ARAAHCLEFIERLPQGF 1097
            E     + + FQ  V+   T+AN +R+  +     EV  A    +    LE ++      
Sbjct: 75   ERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYL 134

Query: 1098 DTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCA-- 1155
               L E       GE++R  I + L+ +    +LDE  + LD +   ++ R V  +    
Sbjct: 135  SRYLNE-------GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPN 187

Query: 1156 -GKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLL 1193
             G  VI    R+      DK+ V+  GRV   G  +  L
Sbjct: 188  FGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELAL 226



 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 5/88 (5%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDS 407
           + + +RD+  S   D E  L+ V+L +P G V A++GP+G+GKSTL  ++A    + V+ 
Sbjct: 1   SQLEIRDLWASI--DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVER 58

Query: 408 GQVLVGGVDVREMGQDE-LMGSLSLVFQ 434
           G++L+ G ++ E+  DE     L L FQ
Sbjct: 59  GEILLDGENILELSPDERARKGLFLAFQ 86


>2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 253

 Score = 75.9 bits (185), Expect = 6e-16
 Identities = 60/199 (30%), Positives = 97/199 (48%), Gaps = 24/199 (12%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 30   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQNSWI- 87

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVA--EAARAAHCLEFIERLPQGFDTVLGE 1103
                          T+  NI     G S +E       +A    E I +  +  + VL  
Sbjct: 88   -----------MPGTIKENII----GVSYDEYRYRSVIKACQLEEDISKFAEKDNIVL-- 130

Query: 1104 NGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVI 1162
               +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++
Sbjct: 131  --ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV 188

Query: 1163 AHRLRTVANADKIVVLDSG 1181
              ++  +  ADKI++L  G
Sbjct: 189  TSKMEHLKKADKILILHEG 207



 Score = 48.9 bits (115), Expect = 8e-08
 Identities = 49/209 (23%), Positives = 87/209 (41%), Gaps = 20/209 (9%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 29  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 75

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q+S +   ++ ENI                        +      +A      
Sbjct: 76  GRISFCSQNSWIMPGTIKENI------IGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV 129

Query: 487 GVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLMAGKTVIMVA 545
            + LSGG+            DA + +LD    + D   E  + +    +LMA KT I+V 
Sbjct: 130 LITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 189

Query: 546 HRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
            ++  +  ADKI++L  G     GT  EL
Sbjct: 190 SKMEHLKKADKILILHEGSSYFYGTFSEL 218


>3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
          Length = 251

 Score = 75.5 bits (184), Expect = 8e-16
 Identities = 65/233 (27%), Positives = 106/233 (45%), Gaps = 15/233 (6%)

Query: 972  LSFQGVRFGYGD-EEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            L  + + + Y D    L G++   + GEVTA++G +G GKST  Q      +P SGR+L 
Sbjct: 5    LKVEELNYNYSDGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILF 64

Query: 1031 SGKDIAEFSEESWL---AHVSIVFQDV--VLFDDTVANNIRIGREGASDEEVAEAARAAH 1085
              K I ++S +  +     + IVFQD    LF  +V  ++  G       E     R  +
Sbjct: 65   DNKPI-DYSRKGIMKLRESIGIVFQDPDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDN 123

Query: 1086 CLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETL 1145
             L+       G + +  +    LS G+++R++IA  L+ +  V++LDE TA LDP   + 
Sbjct: 124  ALK-----RTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSE 178

Query: 1146 IQRAVGTL---CAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAE 1195
            I + +  +                      D + V+  GRV  +GN K + AE
Sbjct: 179  IMKLLVEMQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEVFAE 231



 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 55/245 (22%), Positives = 97/245 (39%), Gaps = 15/245 (6%)

Query: 348 KDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDS 407
           +D  + + ++ ++Y D    AL+ +++ I  G V A++G +G GKSTL           S
Sbjct: 1   EDYILKVEELNYNYSDGTH-ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSS 59

Query: 408 GQVLVGG--VDVREMGQDELMGSLSLVFQ--DSHLFRESVAENIRRGRPGXXXXXXXXXX 463
           G++L     +D    G  +L  S+ +VFQ  D+ LF  SV +++  G             
Sbjct: 60  GRILFDNKPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQDVSFGAVNMKLPEDEIRK 119

Query: 464 XXXXXXXFINGLPHGYATVIGSEGVH-LSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDP 522
                    N L       +  +  H LS G+            +  +++LDE TA  DP
Sbjct: 120 RVD------NALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDP 173

Query: 523 ENEHLIQK---AFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASG 579
                I K     ++ +               +  D + V+  GR + +G  +E+ A   
Sbjct: 174 MGVSEIMKLLVEMQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEVFAEKE 233

Query: 580 TYAKM 584
              K+
Sbjct: 234 VIRKV 238


>2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
          Length = 223

 Score = 73.9 bits (180), Expect = 2e-15
 Identities = 54/214 (25%), Positives = 99/214 (46%), Gaps = 23/214 (10%)

Query: 985  EVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWL 1044
            E+L G+S   ++GE  +++G SGSGKST   +      P  G+V   GK++ +++ E  L
Sbjct: 17   EILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV-DYTNEKEL 75

Query: 1045 A-----HVSIVFQ------DVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERL 1093
            +      +  VFQ      ++   ++ +   +++G+     +E     R  + L  +   
Sbjct: 76   SLLRNRKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKE-----RGEYLLSEL--- 127

Query: 1094 PQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTL 1153
              G    L      LSGGE+QR++IARAL  +  ++  DE T +LD  N   +      +
Sbjct: 128  --GLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKI 185

Query: 1154 CAGKT-VIVIAHRLRTVANADKIVVLDSGRVAEE 1186
              G T ++++ H         + + +  G+V  E
Sbjct: 186  NEGGTSIVMVTHERELAELTHRTLEMKDGKVVGE 219



 Score = 49.3 bits (116), Expect = 6e-08
 Identities = 51/213 (23%), Positives = 81/213 (38%), Gaps = 21/213 (9%)

Query: 369 LRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM-- 426
           L+ +SL +  G   +++G SGSGKSTL  ++        G+V + G +V    + EL   
Sbjct: 19  LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELSLL 78

Query: 427 --GSLSLVFQDSHLFRESVA-ENI-----RRGRPGXXXXXXXXXXXXXXXXXFINGLPHG 478
               L  VFQ  +L  E  A EN+     + G+P                         G
Sbjct: 79  RNRKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSEL----------G 128

Query: 479 YATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAG 538
               +  +   LSGGE            +  ++  DE T   D  N   +   F ++  G
Sbjct: 129 LGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEG 188

Query: 539 KT-VIMVAHRLSTVVGADKIVVLDGGRKVEEGT 570
            T ++MV H         + + +  G+ V E T
Sbjct: 189 GTSIVMVTHERELAELTHRTLEMKDGKVVGEIT 221


>3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 350

 Score = 73.2 bits (178), Expect = 4e-15
 Identities = 63/208 (30%), Positives = 94/208 (45%), Gaps = 15/208 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWL- 1044
            VL+ +S     GE+  ++G SG GK+T  +  A F +PDSG +  SGK I  FS+ + L 
Sbjct: 18   VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI--FSKNTNLP 75

Query: 1045 ---AHVSIVFQDVVLFDD-TVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTV 1100
                 +  + Q+ VLF   TV  NI  G          E  R    LE       G   +
Sbjct: 76   VRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-----TGISEL 130

Query: 1101 LGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQR-AVGTLCA-GKT 1158
             G     LSGG             D  ++LLDE  ++LD +    I+   +  L A GK+
Sbjct: 131  AGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKS 190

Query: 1159 VIVIAH-RLRTVANADKIVVLDSGRVAE 1185
             + ++H R   +  AD+I V+  GR+ +
Sbjct: 191  AVFVSHDREEALQYADRIAVMKQGRILQ 218



 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 65/217 (29%), Positives = 100/217 (46%), Gaps = 17/217 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDV--REMGQDE 424
           P L ++SL +  G +  ++G SG GK+TL   +A F   DSG++ + G  +  +      
Sbjct: 17  PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPV 76

Query: 425 LMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVI 483
               L  + Q+  LF   +V  NI  G                           G + + 
Sbjct: 77  RERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELT-----GISELA 131

Query: 484 GSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMA-----G 538
           G     LSGG             D  +++LDE  +  D   E L ++  E ++A     G
Sbjct: 132 GRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALD---EQLRRQIREDMIAALRANG 188

Query: 539 KTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           K+ + V+H R   +  AD+I V+  GR ++  +  EL
Sbjct: 189 KSAVFVSHDREEALQYADRIAVMKQGRILQTASPHEL 225


>3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 343

 Score = 73.2 bits (178), Expect = 4e-15
 Identities = 63/208 (30%), Positives = 94/208 (45%), Gaps = 15/208 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWL- 1044
            VL+ +S     GE+  ++G SG GK+T  +  A F +PDSG +  SGK I  FS+ + L 
Sbjct: 18   VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI--FSKNTNLP 75

Query: 1045 ---AHVSIVFQDVVLFDD-TVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTV 1100
                 +  + Q+ VLF   TV  NI  G          E  R    LE       G   +
Sbjct: 76   VRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-----TGISEL 130

Query: 1101 LGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQR-AVGTLCA-GKT 1158
             G     LSGG             D  ++LLDE  ++LD +    I+   +  L A GK+
Sbjct: 131  AGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKS 190

Query: 1159 VIVIAH-RLRTVANADKIVVLDSGRVAE 1185
             + ++H R   +  AD+I V+  GR+ +
Sbjct: 191  AVFVSHDREEALQYADRIAVMKQGRILQ 218



 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 65/217 (29%), Positives = 100/217 (46%), Gaps = 17/217 (7%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDV--REMGQDE 424
           P L ++SL +  G +  ++G SG GK+TL   +A F   DSG++ + G  +  +      
Sbjct: 17  PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPV 76

Query: 425 LMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVI 483
               L  + Q+  LF   +V  NI  G                           G + + 
Sbjct: 77  RERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELT-----GISELA 131

Query: 484 GSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMA-----G 538
           G     LSGG             D  +++LDE  +  D   E L ++  E ++A     G
Sbjct: 132 GRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALD---EQLRRQIREDMIAALRANG 188

Query: 539 KTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           K+ + V+H R   +  AD+I V+  GR ++  +  EL
Sbjct: 189 KSAVFVSHDREEALQYADRIAVMKQGRILQTASPHEL 225


>1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 342

 Score = 72.8 bits (177), Expect = 5e-15
 Identities = 73/263 (27%), Positives = 106/263 (40%), Gaps = 33/263 (12%)

Query: 972  LSFQGVRFGY-GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            + F GV   Y G    + GVSF  REGE+  L+GPSGSGK+T  +L A    P  G V  
Sbjct: 2    IEFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWI 61

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIG------REGASDEEVAEAARA 1083
             GK + +   +    +V +VFQ+  LF   TV +N+  G       +   D  V E  R 
Sbjct: 62   GGKRVTDLPPQK--RNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRF 119

Query: 1084 AHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE 1143
                 +  R P             LSGG                    DE  A++D    
Sbjct: 120  MRLESYANRFPH-----------ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAID---- 164

Query: 1144 TLIQRAVGTLC------AGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEGNHKTLLAED 1196
            T I+R + T         G T + + H +   +  AD+++VL  G V + G  + +  + 
Sbjct: 165  TQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKP 224

Query: 1197 GLYARLWRLQQESSSWTVPADRG 1219
            G    +     ES+ WT     G
Sbjct: 225  GTLF-VASFIGESNVWTRAVQNG 246



 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 67/223 (30%), Positives = 102/223 (45%), Gaps = 23/223 (10%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           ++R VS +I  G +  ++GPSGSGK+T+  L+A       G V +GG  V ++   +   
Sbjct: 17  SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK--R 74

Query: 428 SLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFI------NGLPHGYA 480
           ++ LVFQ+  LF+  +V +N+  G                    F+      N  PH   
Sbjct: 75  NVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPH--- 131

Query: 481 TVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERL--MAG 538
                    LSGG                    DE  A  D +    ++    ++    G
Sbjct: 132 --------ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMG 183

Query: 539 KTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQELLAASGT 580
            T + V H +   +  AD+++VL  G   + GT +E+    GT
Sbjct: 184 VTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGT 226


>1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 345

 Score = 72.8 bits (177), Expect = 5e-15
 Identities = 73/263 (27%), Positives = 106/263 (40%), Gaps = 33/263 (12%)

Query: 972  LSFQGVRFGY-GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            + F GV   Y G    + GVSF  REGE+  L+GPSGSGK+T  +L A    P  G V  
Sbjct: 5    IEFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWI 64

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIG------REGASDEEVAEAARA 1083
             GK + +   +    +V +VFQ+  LF   TV +N+  G       +   D  V E  R 
Sbjct: 65   GGKRVTDLPPQK--RNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRF 122

Query: 1084 AHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE 1143
                 +  R P             LSGG                    DE  A++D    
Sbjct: 123  MRLESYANRFPH-----------ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAID---- 167

Query: 1144 TLIQRAVGTLC------AGKTVIVIAH-RLRTVANADKIVVLDSGRVAEEGNHKTLLAED 1196
            T I+R + T         G T + + H +   +  AD+++VL  G V + G  + +  + 
Sbjct: 168  TQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKP 227

Query: 1197 GLYARLWRLQQESSSWTVPADRG 1219
            G    +     ES+ WT     G
Sbjct: 228  GTLF-VASFIGESNVWTRAVQNG 249



 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 67/223 (30%), Positives = 102/223 (45%), Gaps = 23/223 (10%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           ++R VS +I  G +  ++GPSGSGK+T+  L+A       G V +GG  V ++   +   
Sbjct: 20  SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK--R 77

Query: 428 SLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFI------NGLPHGYA 480
           ++ LVFQ+  LF+  +V +N+  G                    F+      N  PH   
Sbjct: 78  NVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPH--- 134

Query: 481 TVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERL--MAG 538
                    LSGG                    DE  A  D +    ++    ++    G
Sbjct: 135 --------ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMG 186

Query: 539 KTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQELLAASGT 580
            T + V H +   +  AD+++VL  G   + GT +E+    GT
Sbjct: 187 VTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGT 229


>1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 225

 Score = 72.8 bits (177), Expect = 5e-15
 Identities = 68/228 (29%), Positives = 102/228 (44%), Gaps = 22/228 (9%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFV---AREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRV 1028
            +  + V   Y  EE+++ +  V    +EGE  + +GPSGSGKST   +     +P  G V
Sbjct: 1    IKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVS-IGPSGSGKSTL-NIIGCLDKPTEGEV 58

Query: 1029 LCSGKDIAEFSEESWLA----HVSIVFQDVVLFDD-TVANNIRIGR----EGASDEEVAE 1079
                    +  ++         +  VFQ   L    T   N+ +       GAS EE   
Sbjct: 59   YIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEE--R 116

Query: 1080 AARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLD 1139
              RA  CL+    L + F          LSGG++QR++IARAL  + P++L DE T +LD
Sbjct: 117  RKRALECLK--AELEERF---ANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALD 171

Query: 1140 PENETLIQRAVG-TLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEE 1186
             +    IQ         GKTV+V+ H +      ++I+ L  G V  E
Sbjct: 172  SKTGEKIQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVERE 219



 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 64/234 (27%), Positives = 99/234 (42%), Gaps = 32/234 (13%)

Query: 352 VSLRDVTFSYE-DDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQV 410
           + L++VT +Y+ ++   AL+NV+L I  G   ++ GPSGSGKSTL N++        G+V
Sbjct: 1   IKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEGEV 58

Query: 411 LVGGVDVREMGQDEL----MGSLSLVFQDSHLFRESVA-ENIR-------RGRPG-XXXX 457
            +  +   ++  DEL       +  VFQ  +L     A EN+        RG  G     
Sbjct: 59  YIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEERRK 118

Query: 458 XXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEAT 517
                        F N  P+            LSGG+            + PI++ DE T
Sbjct: 119 RALECLKAELEERFANHKPN-----------QLSGGQQQRVAIARALANNPPIILADEPT 167

Query: 518 AFSDP---ENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVLDGGRKVEE 568
              D    E   L++K  E    GKTV++V H ++     ++I+ L  G    E
Sbjct: 168 GALDSKTGEKIQLLKKLNEE--DGKTVVVVTHDINVARFGERIIYLKDGEVERE 219


>1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 71.6 bits (174), Expect = 1e-14
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 26/197 (13%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            VL  ++F    G++ A+ G +G+GK++   +     EP  G++  SG+ I+  S+ SW+ 
Sbjct: 38   VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCSQFSWI- 95

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
                          T+  NI  G    S +E    +    C     +L +    ++    
Sbjct: 96   -----------MPGTIKENIIAG---VSYDEYRYRSVIKAC-----QLEEDISKIV---- 132

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENE-TLIQRAVGTLCAGKTVIVIAH 1164
             +LSGG+R R+S+ARA+ KDA + LLD     LD   E  + +  V  L A KT I++  
Sbjct: 133  LTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 192

Query: 1165 RLRTVANADKIVVLDSG 1181
            ++  +  ADKI++L  G
Sbjct: 193  KMEHLKKADKILILHEG 209



 Score = 50.4 bits (119), Expect = 3e-08
 Identities = 52/218 (23%), Positives = 92/218 (42%), Gaps = 44/218 (20%)

Query: 367 PALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELM 426
           P L++++ +I  G + AV G +G+GK++L  ++            +G ++  E G+ +  
Sbjct: 37  PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI------------MGELEPSE-GKIKHS 83

Query: 427 GSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSE 486
           G +S   Q S +   ++ ENI  G                     ++   + Y +VI + 
Sbjct: 84  GRISFCSQFSWIMPGTIKENIIAG---------------------VSYDEYRYRSVIKAC 122

Query: 487 GVH---------LSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENE-HLIQKAFERLM 536
            +          LSGG+            DA + +LD    + D   E  + +    +LM
Sbjct: 123 QLEEDISKIVLTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM 182

Query: 537 AGKTVIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           A KT I+V  ++  +  ADKI++L  G     GT  EL
Sbjct: 183 ANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL 220


>2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
          Length = 240

 Score = 70.9 bits (172), Expect = 2e-14
 Identities = 63/204 (30%), Positives = 98/204 (48%), Gaps = 27/204 (13%)

Query: 1002 LVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFDD-T 1060
            L+GP+G+GKS   +L A   +PD G V  +G DI     E     +  V QD  LF   +
Sbjct: 29   LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPER--RGIGFVPQDYALFPHLS 86

Query: 1061 VANNIRIG-------REGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGER 1113
            V  NI  G               +AE    AH L+   R P           A LSGGER
Sbjct: 87   VYRNIAYGLXXXXXXXXXXXXXXMAEKLGIAHLLD---RKP-----------ARLSGGER 132

Query: 1114 QRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCA--GKTVIVIAHRLRTVAN 1171
            QR+++ARAL+    ++LLDE  +++D + + ++   +  +       ++ + H L   A 
Sbjct: 133  QRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAM 192

Query: 1172 -ADKIVVLDSGRVAEEGNHKTLLA 1194
             AD++ V+ +GR+ E+G  K L +
Sbjct: 193  LADEVAVMLNGRIVEKGKLKELFS 216



 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 67/220 (30%), Positives = 101/220 (45%), Gaps = 16/220 (7%)

Query: 365 AEPALRNVSLEIP---AGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMG 421
           AE  L N  L +        C ++GP+G+GKS    L+A     D G+V + G D+  + 
Sbjct: 7   AEKRLGNFRLNVDFEMGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLP 66

Query: 422 QDELMGSLSLVFQDSHLFRE-SVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYA 480
            +     +  V QD  LF   SV  NI  G                           G A
Sbjct: 67  PER--RGIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXXMAEKL-------GIA 117

Query: 481 TVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQK--AFERLMAG 538
            ++  +   LSGGE               +++LDE  +  D + + ++ +   F +    
Sbjct: 118 HLLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFD 177

Query: 539 KTVIMVAHRL-STVVGADKIVVLDGGRKVEEGTHQELLAA 577
             ++ V H L    + AD++ V+  GR VE+G  +EL +A
Sbjct: 178 VPILHVTHDLIEAAMLADEVAVMLNGRIVEKGKLKELFSA 217


>3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 593

 Score = 69.3 bits (168), Expect = 6e-14
 Identities = 64/213 (30%), Positives = 95/213 (44%), Gaps = 40/213 (18%)

Query: 995  REGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDV 1054
            R+GEV  +VGP+G GK+T  ++ A   EP  G+V              W           
Sbjct: 366  RKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKV-------------EW----------- 401

Query: 1055 VLFDDTVANN---IRIGREGASDEEVAEAARAAHCLEFIER---LPQGFDTVLGENGASL 1108
               D TVA     I+   EG   E +++   +     F +     P G   +   N   L
Sbjct: 402  ---DLTVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFYKTELLKPLGIIDLYDRNVEDL 458

Query: 1109 SGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCA--GKTVIVIAHRL 1166
            SGGE QR++IA  LL+DA + LLDE +A LD E    + RA+  L     KT +V+ H +
Sbjct: 459  SGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDV 518

Query: 1167 RTVAN-ADKIVVLDSGRVAEEGNHKTLLAEDGL 1198
              +   +D+++V +     E G H   L   G+
Sbjct: 519  LMIDYVSDRLIVFE----GEPGRHGRALPPMGM 547



 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 49/201 (24%), Positives = 81/201 (40%), Gaps = 52/201 (25%)

Query: 993  VAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQ 1052
            + ++G V  +VGP+G+GK+T  ++ A    P+    LC   D       SW  +V   F+
Sbjct: 99   IVKDGMVVGIVGPNGTGKTTAVKILAGQLIPN----LCEDND-------SW-DNVIRAFR 146

Query: 1053 DVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGE--------- 1103
                      N ++   E   + E+    +     ++++ LP+     + E         
Sbjct: 147  ---------GNELQNYFERLKNGEIRPVVKP----QYVDLLPKAVKGKVRELLXXXXXXX 193

Query: 1104 -----------------NGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLI 1146
                                 LSGGE QR++IA ALL+ A     DE ++ LD      +
Sbjct: 194  XXXXXXXXXXXXXXXDRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKV 253

Query: 1147 QRAVGTLC-AGKTVIVIAHRL 1166
             R +  L   GK V+V+ H L
Sbjct: 254  ARVIRRLANEGKAVLVVEHDL 274



 Score = 44.3 bits (103), Expect = 2e-06
 Identities = 57/258 (22%), Positives = 98/258 (37%), Gaps = 48/258 (18%)

Query: 328 RIDSVLGIEELSCPEAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGP 387
           ++   + +E  +  E P+  KD          S++ + EP       EI  G V  +VGP
Sbjct: 331 KLSERVDVERETLVEYPRLVKDYG--------SFKLEVEPG------EIRKGEVIGIVGP 376

Query: 388 SGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMGSLSLVFQDSHLFRE---SVA 444
           +G GK+T   ++A                V E  + ++   L++ ++  ++  E   +V 
Sbjct: 377 NGIGKTTFVKMLA---------------GVEEPTEGKVEWDLTVAYKPQYIKAEYEGTVY 421

Query: 445 ENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXX 504
           E + +                          P G   +       LSGGE          
Sbjct: 422 ELLSKIDSSKLNSNFYKTELLK---------PLGIIDLYDRNVEDLSGGELQRVAIAATL 472

Query: 505 XXDAPIVVLDEATAFSDPENEHLIQKAFERLMA--GKTVIMVAHRLSTV-VGADKIVVLD 561
             DA I +LDE +A+ D E    + +A   LM    KT ++V H +  +   +D+++V +
Sbjct: 473 LRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLIVFE 532

Query: 562 GGRKVEEGTHQELLAASG 579
           G    E G H   L   G
Sbjct: 533 G----EPGRHGRALPPMG 546


>2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 247

 Score = 68.6 bits (166), Expect = 1e-13
 Identities = 64/233 (27%), Positives = 104/233 (44%), Gaps = 21/233 (9%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVL 1029
            LS + +     D+ +L G+S     GEV A++GP+GSGKST +   A  + +E   G V 
Sbjct: 2    LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 1030 CSGKDIAEFSEESWLAH-VSIVFQDVV--------LFDDTVANNIRI--GREGASDEEVA 1078
              GKD+   S E      + + FQ  V         F  T  N +R   G+E     +  
Sbjct: 62   FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 1079 EAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
            +        E I  L    D +        SGGE++R  I +  + +  + +LDE+ + L
Sbjct: 122  DLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGL 176

Query: 1139 DPENETLIQRAVGTLCAGK-TVIVIAH--RLRTVANADKIVVLDSGRVAEEGN 1188
            D +   ++   V +L  GK + I++ H  R+      D + VL  GR+ + G+
Sbjct: 177  DIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGD 229



 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 63/231 (27%), Positives = 100/231 (43%), Gaps = 17/231 (7%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDSGQ 409
           +S++D+  S ED A   LR +SL++  G V A++GP+GSGKSTL+  +A    ++V  G 
Sbjct: 2   LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 410 VLVGGVDVREMGQDELMG-SLSLVFQ-------DSHLFRESVAENIRRGRPGXXXXXXXX 461
           V   G D+  +  ++  G  + + FQ        S+ F    A N  R   G        
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 462 XXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSD 521
                     +  +P    T   S  V  SGGE            +  + +LDE+ +  D
Sbjct: 120 FQDLMEEKIALLKMPEDLLT--RSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLD 177

Query: 522 PENEHLIQKAFERLMAGK-TVIMVAH--RLSTVVGADKIVVLDGGRKVEEG 569
            +   ++      L  GK + I+V H  R+   +  D + VL  GR V+ G
Sbjct: 178 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 228


>2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 68.6 bits (166), Expect = 1e-13
 Identities = 64/233 (27%), Positives = 104/233 (44%), Gaps = 21/233 (9%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVL 1029
            LS + +     D+ +L G+S     GEV A++GP+GSGKST +   A  + +E   G V 
Sbjct: 2    LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 1030 CSGKDIAEFSEESWLAH-VSIVFQDVV--------LFDDTVANNIRI--GREGASDEEVA 1078
              GKD+   S E      + + FQ  V         F  T  N +R   G+E     +  
Sbjct: 62   FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 1079 EAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
            +        E I  L    D +        SGGE++R  I +  + +  + +LDE+ + L
Sbjct: 122  DLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGL 176

Query: 1139 DPENETLIQRAVGTLCAGK-TVIVIAH--RLRTVANADKIVVLDSGRVAEEGN 1188
            D +   ++   V +L  GK + I++ H  R+      D + VL  GR+ + G+
Sbjct: 177  DIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGD 229



 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 63/231 (27%), Positives = 100/231 (43%), Gaps = 17/231 (7%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDSGQ 409
           +S++D+  S ED A   LR +SL++  G V A++GP+GSGKSTL+  +A    ++V  G 
Sbjct: 2   LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 410 VLVGGVDVREMGQDELMG-SLSLVFQ-------DSHLFRESVAENIRRGRPGXXXXXXXX 461
           V   G D+  +  ++  G  + + FQ        S+ F    A N  R   G        
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 462 XXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSD 521
                     +  +P    T   S  V  SGGE            +  + +LDE+ +  D
Sbjct: 120 FQDLMEEKIALLKMPEDLLT--RSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLD 177

Query: 522 PENEHLIQKAFERLMAGK-TVIMVAH--RLSTVVGADKIVVLDGGRKVEEG 569
            +   ++      L  GK + I+V H  R+   +  D + VL  GR V+ G
Sbjct: 178 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 228


>2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 66.2 bits (160), Expect = 5e-13
 Identities = 65/232 (28%), Positives = 103/232 (44%), Gaps = 21/232 (9%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVL 1029
            LS + +     D+ +L G+S     GEV A++GP+GSGKST +   A  + +E   G V 
Sbjct: 2    LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 1030 CSGKDIAEFSEESWLAH-VSIVFQDVV--------LFDDTVANNIRI--GREGASDEEVA 1078
              GKD+   S E      + + FQ  V         F  T  N +R   G+E     +  
Sbjct: 62   FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 1079 EAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
            +        E I  L    D +        SGGE++R  I +  + +  + +LDE+  SL
Sbjct: 122  DLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESD-SL 175

Query: 1139 DPENETLIQRAVGTLCAGKT--VIVIAHRLRTVANADKIVVLDSGRVAEEGN 1188
            D +   ++   V +L  GK   +IV  +R+      D + VL  GR+ + G+
Sbjct: 176  DIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSGD 227



 Score = 55.8 bits (133), Expect = 6e-10
 Identities = 61/230 (26%), Positives = 99/230 (43%), Gaps = 17/230 (7%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDSGQ 409
           +S++D+  S ED A   LR +SL++  G V A++GP+GSGKSTL+  +A    ++V  G 
Sbjct: 2   LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 410 VLVGGVDVREMGQDELMG-SLSLVFQ-------DSHLFRESVAENIRRGRPGXXXXXXXX 461
           V   G D+  +  ++  G  + + FQ        S+ F    A N  R   G        
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 462 XXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSD 521
                     +  +P    T   S  V  SGGE            +  + +LDE+ +  D
Sbjct: 120 FQDLMEEKIALLKMPEDLLT--RSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSL-D 176

Query: 522 PENEHLIQKAFERLMAGKT--VIMVAHRLSTVVGADKIVVLDGGRKVEEG 569
            +   ++      L  GK   +I+  +R+   +  D + VL  GR V+ G
Sbjct: 177 IDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSG 226


>1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BINDING
            PROTEIN
          Length = 353

 Score = 65.9 bits (159), Expect = 6e-13
 Identities = 48/211 (22%), Positives = 98/211 (46%), Gaps = 17/211 (8%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +G+   ++ ++   ++GE   L+GPSG GK+T  ++ A   EP  GR+    +D+     
Sbjct: 16   FGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPP 75

Query: 1041 ESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTV 1100
            +    ++S+VFQ + ++++ +A  ++   +   D+ V  AA      E + R P      
Sbjct: 76   KD--RNISMVFQHMTVYEN-IAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYP------ 126

Query: 1101 LGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTL---CAGK 1157
                 A LSGG             +  V+L+DE  ++LD +    ++  +  L       
Sbjct: 127  -----AQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVT 181

Query: 1158 TVIVIAHRLRTVANADKIVVLDSGRVAEEGN 1188
            T+ V   ++  +   D+I V++ G++ + G+
Sbjct: 182  TIYVTHDQVEAMTMGDRIAVMNRGQLLQIGS 212



 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 54/210 (25%), Positives = 100/210 (47%), Gaps = 17/210 (8%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           A+  ++L I  G    ++GPSG GK+T   ++A   +   G++  G  DV  +   +   
Sbjct: 21  AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKD--R 78

Query: 428 SLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEG 487
           ++S+VFQ   ++ E++A  +++                      +N  P           
Sbjct: 79  NISMVFQHMTVY-ENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYP----------- 126

Query: 488 VHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLM--AGKTVIMVA 545
             LSGG             +  ++++DE  +  D +    ++   ++L      T I V 
Sbjct: 127 AQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVT 186

Query: 546 H-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
           H ++  +   D+I V++ G+ ++ G+  E+
Sbjct: 187 HDQVEAMTMGDRIAVMNRGQLLQIGSPTEV 216


>2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
          Length = 361

 Score = 63.9 bits (154), Expect = 2e-12
 Identities = 59/218 (27%), Positives = 100/218 (45%), Gaps = 28/218 (12%)

Query: 981  YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSE 1040
            +GD   +  +S   ++GE   L+GPSG GK+T  ++A    EP  G++      +A+  +
Sbjct: 14   FGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAG-LEEPTRGQIYIEDNLVADPEK 72

Query: 1041 ESWLAHVS---IVFQDVVLFDDTVANNIR--IGREGASDEEVAEAARAAHCLEFIERLPQ 1095
              ++        VFQ   L+  TV +NI   +       +E+ +  R        E    
Sbjct: 73   GVFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVR--------EVAEL 124

Query: 1096 GFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENET------LIQRA 1149
            G   +L      LSGG+RQR+++ RA+++  P V LDE  ++LD +          +QR 
Sbjct: 125  GLTELLNRKPRELSGGQRQRVALGRAIIR-RPKVFLDEPLSNLDAKLRVKRAELKKLQRQ 183

Query: 1150 VGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEG 1187
            +G      T I + H  +  A  D+I V + G + + G
Sbjct: 184  LGV-----TTIYVTHD-QVEATGDRIAV-NKGELQQVG 214


>2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 243

 Score = 63.5 bits (153), Expect = 3e-12
 Identities = 64/233 (27%), Positives = 103/233 (44%), Gaps = 22/233 (9%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVL 1029
            LS + +     D+ +L G+S     GEV A++GP+GSGKST +   A  + +E   G V 
Sbjct: 2    LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 1030 CSGKDIAEFSEESWLAH-VSIVFQDVV--------LFDDTVANNIRI--GREGASDEEVA 1078
              GKD+   S E      + + FQ  V         F  T  N +R   G+E     +  
Sbjct: 62   FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 1079 EAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
            +        E I  L    D +        SGGE++R  I +  + +  + +LDE+   L
Sbjct: 122  DLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESD-GL 175

Query: 1139 DPENETLIQRAVGTLCAGK-TVIVIAH--RLRTVANADKIVVLDSGRVAEEGN 1188
            D +   ++   V +L  GK + I++ H  R+      D + VL  GR+ + G+
Sbjct: 176  DIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGD 228



 Score = 54.7 bits (130), Expect = 1e-09
 Identities = 63/231 (27%), Positives = 99/231 (42%), Gaps = 18/231 (7%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDSGQ 409
           +S++D+  S ED A   LR +SL++  G V A++GP+GSGKSTL+  +A    ++V  G 
Sbjct: 2   LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 410 VLVGGVDVREMGQDELMG-SLSLVFQ-------DSHLFRESVAENIRRGRPGXXXXXXXX 461
           V   G D+  +  ++  G  + + FQ        S+ F    A N  R   G        
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 462 XXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSD 521
                     +  +P    T   S  V  SGGE            +  + +LDE+    D
Sbjct: 120 FQDLMEEKIALLKMPEDLLT--RSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGL-D 176

Query: 522 PENEHLIQKAFERLMAGK-TVIMVAH--RLSTVVGADKIVVLDGGRKVEEG 569
            +   ++      L  GK + I+V H  R+   +  D + VL  GR V+ G
Sbjct: 177 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 227


>1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 353

 Score = 62.8 bits (151), Expect = 5e-12
 Identities = 57/205 (27%), Positives = 93/205 (45%), Gaps = 37/205 (18%)

Query: 979  FGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR-------VLCS 1031
            F  G    L  V+     GE   ++GPSG+GK+T  ++ A    P +G        V  +
Sbjct: 13   FKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASN 72

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVA--------NNIRIGREGASD--EEVAEAA 1081
            GK I    +      + +VFQ   L+ +  A         N+++ +E      EEVA+  
Sbjct: 73   GKLIVPPEDRK----IGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKIL 128

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
               H L    R               LSGG++QR+++ARAL+KD  ++LLDE  ++LD  
Sbjct: 129  DIHHVLNHFPR--------------ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDAR 174

Query: 1142 NETLIQRAVGTLCA--GKTVIVIAH 1164
                 +  V  + +  G T++V++H
Sbjct: 175  MRDSARALVKEVQSRLGVTLLVVSH 199


>1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 62.8 bits (151), Expect = 5e-12
 Identities = 57/205 (27%), Positives = 93/205 (45%), Gaps = 37/205 (18%)

Query: 979  FGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR-------VLCS 1031
            F  G    L  V+     GE   ++GPSG+GK+T  ++ A    P +G        V  +
Sbjct: 13   FKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASN 72

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVA--------NNIRIGREGASD--EEVAEAA 1081
            GK I    +      + +VFQ   L+ +  A         N+++ +E      EEVA+  
Sbjct: 73   GKLIVPPEDRK----IGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKIL 128

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
               H L    R               LSGG++QR+++ARAL+KD  ++LLDE  ++LD  
Sbjct: 129  DIHHVLNHFPR--------------ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDAR 174

Query: 1142 NETLIQRAVGTLCA--GKTVIVIAH 1164
                 +  V  + +  G T++V++H
Sbjct: 175  MRDSARALVKEVQSRLGVTLLVVSH 199


>2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 241

 Score = 61.2 bits (147), Expect = 2e-11
 Identities = 64/233 (27%), Positives = 102/233 (43%), Gaps = 24/233 (10%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAA--KFWEPDSGRVL 1029
            LS + +     D+ +L G+S     GEV A++GP+GSGKST +   A  + +E   G V 
Sbjct: 2    LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 1030 CSGKDIAEFSEESWLAH-VSIVFQDVV--------LFDDTVANNIRI--GREGASDEEVA 1078
              GKD+   S E      + + FQ  V         F  T  N +R   G+E     +  
Sbjct: 62   FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 1079 EAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
            +        E I  L    D +        SGGE++R  I +  + +  + +LDE   S 
Sbjct: 122  DLME-----EKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE---SD 173

Query: 1139 DPENETLIQRAVGTLCAGK-TVIVIAH--RLRTVANADKIVVLDSGRVAEEGN 1188
            D +   ++   V +L  GK + I++ H  R+      D + VL  GR+ + G+
Sbjct: 174  DIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGD 226



 Score = 54.3 bits (129), Expect = 2e-09
 Identities = 63/231 (27%), Positives = 99/231 (42%), Gaps = 20/231 (8%)

Query: 352 VSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVA--RFWDVDSGQ 409
           +S++D+  S ED A   LR +SL++  G V A++GP+GSGKSTL+  +A    ++V  G 
Sbjct: 2   LSIKDLHVSVEDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 410 VLVGGVDVREMGQDELMG-SLSLVFQ-------DSHLFRESVAENIRRGRPGXXXXXXXX 461
           V   G D+  +  ++  G  + + FQ        S+ F    A N  R   G        
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 462 XXXXXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSD 521
                     +  +P    T   S  V  SGGE            +  + +LDE+    D
Sbjct: 120 FQDLMEEKIALLKMPEDLLT--RSVNVGFSGGEKKRNDILQMAVLEPELCILDES---DD 174

Query: 522 PENEHLIQKAFERLMAGK-TVIMVAH--RLSTVVGADKIVVLDGGRKVEEG 569
            +   ++      L  GK + I+V H  R+   +  D + VL  GR V+ G
Sbjct: 175 IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 225


>1yqtA [x.x.x] RNASE L INHIBITOR
          Length = 507

 Score = 60.8 bits (146), Expect = 2e-11
 Identities = 69/241 (28%), Positives = 99/241 (41%), Gaps = 50/241 (20%)

Query: 995  REGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDV 1054
            ++GEV  +VGP+G GK+T  +LA    EP  G++              W           
Sbjct: 286  KKGEVIGIVGPNGIGKTTFVKLAG-VEEPTEGKI-------------EW----------- 320

Query: 1055 VLFDDTVANN---IRIGREGASDEEVAEAARAAHCLEFIER---LPQGFDTVLGENGASL 1108
               D TVA     I+   EG   E +++   +     F +     P G   +       L
Sbjct: 321  ---DLTVAYKPQYIKADYEGTVYELLSKIDASKLNSNFYKTELLKPLGIIDLYDREVNEL 377

Query: 1109 SGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAG-KTVIVIAHRLR 1167
            SGGE QR++IA  LL+DA + LLDE +A LD E    + RA+  L    KT +V+ H   
Sbjct: 378  SGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEH--- 434

Query: 1168 TVANADKIVVLDSGRVAEEGNHKTLLAEDGLYARLWRLQQESSSWTVPADRGDAADVPTG 1227
                 D ++   S R+  EG       E G Y R     +E + +          D  TG
Sbjct: 435  -----DVLIDYVSDRLVFEG-------EPGKYGRALPPGREGNRFLASIGITFRRDPDTG 482

Query: 1228 R 1228
            R
Sbjct: 483  R 483



 Score = 45.4 bits (106), Expect = 9e-07
 Identities = 54/201 (26%), Positives = 85/201 (42%), Gaps = 33/201 (16%)

Query: 993  VAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQ 1052
            V +EG V  +VGP+G+GKST  ++ A    P+    LC   D       SW   +     
Sbjct: 20   VVKEG-VVGIVGPNGTGKSTAVKILAGQLIPN----LCGDND-------SWDGVIRAFRG 67

Query: 1053 DVV--LFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDT----------- 1099
            + +   F+      IR   +    + + +A +     + IE L +  +T           
Sbjct: 68   NELQNYFEKLKNGEIRPVVKPQYVDLIPKAVKG----KVIELLKKADETGKXXXXXXXXX 123

Query: 1100 ---VLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLC-A 1155
                       LSGGE QR++IA ALL++A     DE ++ LD        RA+  L   
Sbjct: 124  XXXXXXREIQHLSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEE 183

Query: 1156 GKTVIVIAHRLRTVANADKIV 1176
            GK+V+V+ H L  +     I+
Sbjct: 184  GKSVLVVEHDLAVLDYLSDII 204



 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 42/188 (22%), Positives = 70/188 (37%), Gaps = 29/188 (15%)

Query: 375 EIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMGSLSLVFQ 434
           EI  G V  +VGP+G GK+T   L                  V E  + ++   L++ ++
Sbjct: 284 EIKKGEVIGIVGPNGIGKTTFVKLAG----------------VEEPTEGKIEWDLTVAYK 327

Query: 435 DSHL---FRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHLS 491
             ++   +  +V E + +                          P G   +   E   LS
Sbjct: 328 PQYIKADYEGTVYELLSKIDASKLNSNFYKTELLK---------PLGIIDLYDREVNELS 378

Query: 492 GGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAG-KTVIMVAHRLST 550
           GGE            DA I +LDE +A+ D E    + +A   L    KT ++V H +  
Sbjct: 379 GGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDVLI 438

Query: 551 VVGADKIV 558
              +D++V
Sbjct: 439 DYVSDRLV 446


>2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 251

 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 60/233 (25%), Positives = 109/233 (46%), Gaps = 18/233 (7%)

Query: 972  LSFQGVRFGYGDEEVL-HGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLC 1030
            LS + + F Y  E  L   ++F   +G++ A++G +G GKST   L      P  G++  
Sbjct: 4    LSVENLGFYYQAENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI-- 61

Query: 1031 SGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFI 1090
                   F  + + +  +    D+VL   +   N    +  + D +VA  A     L+++
Sbjct: 62   EVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTHIN-TFAKPKSHDYQVAMQA-----LDYL 115

Query: 1091 ERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAV 1150
                     +      SLSGG+RQ + IARA+  +  ++LLDE T++LD  N+ ++   +
Sbjct: 116  -----NLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLL 170

Query: 1151 GTLCAGK--TVIVIAHR-LRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYA 1200
              L   +  TV+   H+  + VA A+K ++L+     + G  + +L  + L A
Sbjct: 171  IDLAQSQNMTVVFTTHQPNQVVAIANKTLLLNKQNF-KFGETRNILTSENLTA 222


>1ji0A [c.37.1] ABC TRANSPORTER
          Length = 231

 Score = 59.3 bits (142), Expect = 6e-11
 Identities = 59/225 (26%), Positives = 102/225 (45%), Gaps = 14/225 (6%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            L  Q +   YG    + G+      G++  L+G +G+GK+T     A       G+++ +
Sbjct: 6    LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFN 65

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDD-TVANNIRIGREGASDEEVAEAARAAHCLEFI 1090
            G+DI           +++V +   +F + TV  N+     GA + +  E  +    LE+I
Sbjct: 66   GQDITNKPAHVINRGIALVPEGRRIFPELTVYENL-----GAYNRKDKEGIK--RDLEWI 118

Query: 1091 ERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAV 1150
              L       L + G +LSGGE Q+L+I RAL +     LLDE +  L P   + +   +
Sbjct: 119  FSLFPRLKERLKQLGGTLSGGE-QQLAIGRALSRPK---LLDEPSLGLAPILVSEVFEVI 174

Query: 1151 GTLCAGKTVIVIAHR--LRTVANADKIVVLDSGRVAEEGNHKTLL 1193
              +    T I++  +  L  +  A    VL++G++  EG    LL
Sbjct: 175  QKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELL 219



 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 20/81 (24%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 368 ALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREMGQDELMG 427
           A++ + L++P G +  ++G +G+GK+T  + +A       G+++  G D+       +  
Sbjct: 20  AIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINR 79

Query: 428 SLSLVFQDSHLFRE-SVAENI 447
            ++LV +   +F E +V EN+
Sbjct: 80  GIALVPEGRRIFPELTVYENL 100


>1l7vC [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
          Length = 224

 Score = 58.9 bits (141), Expect = 8e-11
 Identities = 56/207 (27%), Positives = 93/207 (44%), Gaps = 23/207 (11%)

Query: 995  REGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVF-QD 1053
            R GE+  LVGP+G+GKST   L A+      G +  +G+ +  +S      H + +  Q 
Sbjct: 22   RAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQ 78

Query: 1054 VVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGER 1113
               F   V + + + +   +  E+      A  L          D  LG +   LSGGE 
Sbjct: 79   TPPFATPVWHYLTLHQHDKTRTELLNDVAGALAL----------DDKLGRSTNQLSGGEW 128

Query: 1114 QRLSIARALLKDAP-------VVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRL 1166
            QR+ +A  +L+  P       ++LLDE   SLD   ++ + + +  LC     IV +H L
Sbjct: 129  QRVRLAAVVLQITPQANPAGQLLLLDEPN-SLDVAQQSALDKILSALCQQGLAIVSSHDL 187

Query: 1167 -RTVANADKIVVLDSGRVAEEGNHKTL 1192
              T+ +A +  +L  G++A     + L
Sbjct: 188  NHTLRHAHRAWLLKGGKLASGRREEVL 214


>2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 248

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 58/232 (25%), Positives = 108/232 (46%), Gaps = 20/232 (8%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            LS + + F Y   +    ++F   +G++ A++G +G GKST   L      P  G++   
Sbjct: 5    LSVENLGFYY---QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI--E 59

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIE 1091
                  F  + + +  +    D+VL   +   N    +  + D +VA  A     L+++ 
Sbjct: 60   VYQSIGFVPQFFSSPFAYSVLDIVLMGRSTHIN-TFAKPKSHDYQVAMQA-----LDYL- 112

Query: 1092 RLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVG 1151
                    +      SLSGG+RQ + IARA+  +  ++LLDE T++LD  N+ ++   + 
Sbjct: 113  ----NLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLI 168

Query: 1152 TLCAGK--TVIVIAHR-LRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYA 1200
             L   +  TV+   H+  + VA A+K ++L+     + G  + +L  + L A
Sbjct: 169  DLAQSQNMTVVFTTHQPNQVVAIANKTLLLNKQNF-KFGETRNILTSENLTA 219


>1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER
          Length = 200

 Score = 57.4 bits (137), Expect = 2e-10
 Identities = 38/194 (19%), Positives = 89/194 (45%), Gaps = 13/194 (6%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            L  + +  GY D+ VL  ++    +G V    GP+G GK+T  +  + + +P  G ++ +
Sbjct: 3    LEIRDLSVGY-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYN 61

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIE 1091
            G  I +   + +     I+    +  +D +     +     +  E+ +A  +   L+  +
Sbjct: 62   GVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKK 121

Query: 1092 RLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVG 1151
            +L              LS G  +R+ +A  LL +A + +LD+   ++D +++  + +++ 
Sbjct: 122  KL------------GELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSIL 169

Query: 1152 TLCAGKTVIVIAHR 1165
             +   K +++I+ R
Sbjct: 170  EILKEKGIVIISSR 183



 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 35/198 (17%), Positives = 82/198 (41%), Gaps = 15/198 (7%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           + + +RD++  Y+   +P L  +++ I  G V    GP+G GK+TL   ++ +     G+
Sbjct: 1   SKLEIRDLSVGYD---KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGE 57

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXX 469
           ++  GV +      ++ G +  + ++  + R+   E+  +                    
Sbjct: 58  IIYNGVPI-----TKVKGKIFFLPEEIIVPRKISVEDYLKA-------VASLYGVKVNKN 105

Query: 470 XFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQ 529
             ++ L       +  +   LS G             +A I VLD+     D +++H + 
Sbjct: 106 EIMDALESVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVL 165

Query: 530 KAFERLMAGKTVIMVAHR 547
           K+   ++  K +++++ R
Sbjct: 166 KSILEILKEKGIVIISSR 183


>2qi9C [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
          Length = 240

 Score = 55.5 bits (132), Expect = 8e-10
 Identities = 61/226 (26%), Positives = 99/226 (43%), Gaps = 27/226 (11%)

Query: 995  REGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIVF-QD 1053
            R GE+  LVGP+G+GKST   L A+      G +  +G+ +  +S      H + +  Q 
Sbjct: 22   RAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQ 78

Query: 1054 VVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGER 1113
               F   V + + + +   +  E+      A  L          D  LG +   LSGGE 
Sbjct: 79   TPPFATPVWHYLTLHQHDKTRTELLNDVAGALAL----------DDKLGRSTNQLSGGEW 128

Query: 1114 QRLSIARALLKDAP-------VVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRL 1166
            QR+ +A  +L+  P       ++LLDE   SLD   ++ + + +  L      IV +H L
Sbjct: 129  QRVRLAAVVLQITPQANPAGQLLLLDEPN-SLDVAQQSALDKILSALSQQGLAIVSSHDL 187

Query: 1167 -RTVANADKIVVLDSGRVAEEGNHKTLLAEDGL---YARLWRLQQE 1208
              T+ +A +  +L  G++A  G  + +L    L   Y    RL  E
Sbjct: 188  NHTLRHAHRAWLLKGGKLA-SGRREEVLTPPNLAQAYGNFRRLDIE 232


>2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 330

 Score = 54.7 bits (130), Expect = 1e-09
 Identities = 59/219 (26%), Positives = 88/219 (40%), Gaps = 51/219 (23%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIE 1091
             K + +         V +VFQ   L       N R+        +VAE            
Sbjct: 63   EKRMNDTPPAE--RGVGMVFQSYAL----EVINQRVN-------QVAEV----------- 98

Query: 1092 RLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVG 1151
                                    L+I R L+ +  V LLDE  ++LD      ++  + 
Sbjct: 99   ------------------------LAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEIS 134

Query: 1152 TLCA--GKTVIVIAH-RLRTVANADKIVVLDSGRVAEEG 1187
             L    G+T+I + H ++  +  ADKIVVLD+GRVA+ G
Sbjct: 135  RLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVG 173



 Score = 48.9 bits (115), Expect = 8e-08
 Identities = 62/231 (26%), Positives = 94/231 (40%), Gaps = 59/231 (25%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVGGVDVREMGQDELMGSLSLVFQDSHL-----FRESVAENIRRGRPGXXXXXXXXXXX 464
           + +G   + +    E    + +VFQ   L         VAE +  GR             
Sbjct: 59  LFIGEKRMNDTPPAE--RGVGMVFQSYALEVINQRVNQVAEVLAIGR------------- 103

Query: 465 XXXXXXFINGLPHGYATVIGSEGVHLSGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPEN 524
                           T++    V L                D P+  LD A      + 
Sbjct: 104 ----------------TLVAEPSVFL---------------LDEPLSNLDAALRV---QM 129

Query: 525 EHLIQKAFERLMAGKTVIMVAH-RLSTVVGADKIVVLDGGRKVEEGTHQEL 574
              I +  +RL  G+T+I V H ++  +  ADKIVVLD GR  + G   EL
Sbjct: 130 RIEISRLHKRL--GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLEL 178


>2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 835

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 10/97 (10%)

Query: 1101 LGENGASLSGGERQRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AG 1156
            LG+    LSGGE QR+ +A  L +      V +LDE T  L P +   +QR +  L  AG
Sbjct: 717  LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 776

Query: 1157 KTVIVIAHRLRTVANADKIVVL------DSGRVAEEG 1187
             TVI + H+++ VA +D ++ +      D GR+  +G
Sbjct: 777  NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQG 813



 Score = 46.6 bits (109), Expect = 4e-07
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 483 IGSEGVHLSGGEXXXXXXXXXXXXDA---PIVVLDEATAFSDPENEHLIQKAFERLM-AG 538
           +G     LSGGE                  + VLDE T    P +   +Q+   +L+ AG
Sbjct: 717 LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 776

Query: 539 KTVIMVAHRLSTVVGADKIVVL------DGGRKVEEGTHQELLAASGT 580
            TVI V H++  V  +D ++ +      DGGR V +GT  E+  A+G+
Sbjct: 777 NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQGTPAEVAQAAGS 824


>2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 806

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 10/97 (10%)

Query: 1101 LGENGASLSGGERQRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AG 1156
            LG+    LSGGE QR+ +A  L +      V +LDE T  L P +   +QR +  L  AG
Sbjct: 688  LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 747

Query: 1157 KTVIVIAHRLRTVANADKIVVL------DSGRVAEEG 1187
             TVI + H+++ VA +D ++ +      D GR+  +G
Sbjct: 748  NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQG 784



 Score = 46.6 bits (109), Expect = 4e-07
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 483 IGSEGVHLSGGEXXXXXXXXXXXXDA---PIVVLDEATAFSDPENEHLIQKAFERLM-AG 538
           +G     LSGGE                  + VLDE T    P +   +Q+   +L+ AG
Sbjct: 688 LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 747

Query: 539 KTVIMVAHRLSTVVGADKIVVL------DGGRKVEEGTHQELLAASGT 580
            TVI V H++  V  +D ++ +      DGGR V +GT  E+  A+G+
Sbjct: 748 NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQGTPAEVAQAAGS 795


>2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 814

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 10/97 (10%)

Query: 1101 LGENGASLSGGERQRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AG 1156
            LG+    LSGGE QR+ +A  L +      V +LDE T  L P +   +QR +  L  AG
Sbjct: 696  LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 755

Query: 1157 KTVIVIAHRLRTVANADKIVVL------DSGRVAEEG 1187
             TVI + H+++ VA +D ++ +      D GR+  +G
Sbjct: 756  NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQG 792



 Score = 46.6 bits (109), Expect = 4e-07
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 483 IGSEGVHLSGGEXXXXXXXXXXXXDA---PIVVLDEATAFSDPENEHLIQKAFERLM-AG 538
           +G     LSGGE                  + VLDE T    P +   +Q+   +L+ AG
Sbjct: 696 LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 755

Query: 539 KTVIMVAHRLSTVVGADKIVVL------DGGRKVEEGTHQELLAASGT 580
            TVI V H++  V  +D ++ +      DGGR V +GT  E+  A+G+
Sbjct: 756 NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQGTPAEVAQAAGS 803


>2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 813

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 10/97 (10%)

Query: 1101 LGENGASLSGGERQRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AG 1156
            LG+    LSGGE QR+ +A  L +      V +LDE T  L P +   +QR +  L  AG
Sbjct: 695  LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 754

Query: 1157 KTVIVIAHRLRTVANADKIVVL------DSGRVAEEG 1187
             TVI + H+++ VA +D ++ +      D GR+  +G
Sbjct: 755  NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQG 791



 Score = 46.6 bits (109), Expect = 4e-07
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 483 IGSEGVHLSGGEXXXXXXXXXXXXDA---PIVVLDEATAFSDPENEHLIQKAFERLM-AG 538
           +G     LSGGE                  + VLDE T    P +   +Q+   +L+ AG
Sbjct: 695 LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 754

Query: 539 KTVIMVAHRLSTVVGADKIVVL------DGGRKVEEGTHQELLAASGT 580
            TVI V H++  V  +D ++ +      DGGR V +GT  E+  A+G+
Sbjct: 755 NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQGTPAEVAQAAGS 802


>2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 815

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 10/97 (10%)

Query: 1101 LGENGASLSGGERQRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AG 1156
            LG+    LSGGE QR+ +A  L +      V +LDE T  L P +   +QR +  L  AG
Sbjct: 697  LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 756

Query: 1157 KTVIVIAHRLRTVANADKIVVL------DSGRVAEEG 1187
             TVI + H+++ VA +D ++ +      D GR+  +G
Sbjct: 757  NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQG 793



 Score = 46.6 bits (109), Expect = 4e-07
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 483 IGSEGVHLSGGEXXXXXXXXXXXXDA---PIVVLDEATAFSDPENEHLIQKAFERLM-AG 538
           +G     LSGGE                  + VLDE T    P +   +Q+   +L+ AG
Sbjct: 697 LGQPATELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAG 756

Query: 539 KTVIMVAHRLSTVVGADKIVVL------DGGRKVEEGTHQELLAASGT 580
            TVI V H++  V  +D ++ +      DGGR V +GT  E+  A+G+
Sbjct: 757 NTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVAQGTPAEVAQAAGS 804


>1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 51/220 (23%), Positives = 98/220 (44%), Gaps = 21/220 (9%)

Query: 982  GDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEE 1041
            G +E+L                 P+G+GK+T  ++ +   +P SG V   GK++ E   E
Sbjct: 13   GKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHE 72

Query: 1042 -----SWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQ- 1095
                 S+L   +  ++++             G E         A+ ++   E +ER  + 
Sbjct: 73   VRKLISYLPEEAGAYRNMQ------------GIEYLRFVAGFYASSSSEIEEMVERATEI 120

Query: 1096 -GFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPENETLIQRAVGTLC 1154
             G    + +  ++ S G  ++L IARAL+ +  + +LDE T+ LD  N   +++ +    
Sbjct: 121  AGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQAS 180

Query: 1155 -AGKTVIVIAHRLRTVA-NADKIVVLDSGRVAEEGNHKTL 1192
              G T++V +H +  V    D+I ++ +G + E G  + L
Sbjct: 181  QEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEEL 220


>2ix3A [x.x.x] ELONGATION FACTOR 3
          Length = 972

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 80/326 (24%), Positives = 134/326 (41%), Gaps = 42/326 (12%)

Query: 843  LEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRV--ELAVDVSVSLASAILRSGVGLTAC 900
            L  +K +R    VG+D A  E +       T++V  EL  D +V+    I+   V   A 
Sbjct: 310  LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVVNELLKDETVAPRFKIV---VEYIAA 366

Query: 901  VGAVLLASGGVDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEAR 960
            +GA L+    +D       +      Y  I     +  ++L+   K    +AV + P   
Sbjct: 367  IGADLIDERIIDQQAWFTHIT----PYMTIFLHEKKAKDILDEFRK----RAVDNIPVGP 418

Query: 961  GSASADVPGHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF 1020
                 +  G DL        YG + +L+      +      + GP+G GKST  +  A  
Sbjct: 419  NFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA-- 476

Query: 1021 WEPDSGRVLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAE 1079
                +G+V   G    E     ++ H +     D  + D    + +   +E   D+    
Sbjct: 477  ----NGQV--DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGT-KEAIKDK---- 525

Query: 1080 AARAAHCLEFIERLPQGF-DTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
                   +EF      GF D ++    ++LSGG + +L++ARA+L++A ++LLDE T  L
Sbjct: 526  ------LIEF------GFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHL 573

Query: 1139 DPENETLIQRAVGTLCAGKTVIVIAH 1164
            D  N   +   + T   G T I I+H
Sbjct: 574  DTVNVAWLVNYLNT--CGITSITISH 597



 Score = 42.7 bits (99), Expect = 6e-06
 Identities = 21/69 (30%), Positives = 39/69 (56%)

Query: 342 EAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVAR 401
           E  K  + A V + ++ F Y   ++P + +++ +    +  AV+GP+G+GKSTL N++  
Sbjct: 656 EGVKTKQKAIVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTG 715

Query: 402 FWDVDSGQV 410
                SG+V
Sbjct: 716 ELLPTSGEV 724


>2iwhB [x.x.x] ELONGATION FACTOR 3A
          Length = 980

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 80/326 (24%), Positives = 134/326 (41%), Gaps = 42/326 (12%)

Query: 843  LEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRV--ELAVDVSVSLASAILRSGVGLTAC 900
            L  +K +R    VG+D A  E +       T++V  EL  D +V+    I+   V   A 
Sbjct: 314  LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVVNELLKDETVAPRFKIV---VEYIAA 370

Query: 901  VGAVLLASGGVDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEAR 960
            +GA L+    +D       +      Y  I     +  ++L+   K    +AV + P   
Sbjct: 371  IGADLIDERIIDQQAWFTHIT----PYMTIFLHEKKAKDILDEFRK----RAVDNIPVGP 422

Query: 961  GSASADVPGHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF 1020
                 +  G DL        YG + +L+      +      + GP+G GKST  +  A  
Sbjct: 423  NFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA-- 480

Query: 1021 WEPDSGRVLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAE 1079
                +G+V   G    E     ++ H +     D  + D    + +   +E   D+    
Sbjct: 481  ----NGQV--DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGT-KEAIKDK---- 529

Query: 1080 AARAAHCLEFIERLPQGF-DTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASL 1138
                   +EF      GF D ++    ++LSGG + +L++ARA+L++A ++LLDE T  L
Sbjct: 530  ------LIEF------GFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHL 577

Query: 1139 DPENETLIQRAVGTLCAGKTVIVIAH 1164
            D  N   +   + T   G T I I+H
Sbjct: 578  DTVNVAWLVNYLNT--CGITSITISH 601



 Score = 42.7 bits (99), Expect = 6e-06
 Identities = 21/69 (30%), Positives = 39/69 (56%)

Query: 342 EAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVAR 401
           E  K  + A V + ++ F Y   ++P + +++ +    +  AV+GP+G+GKSTL N++  
Sbjct: 660 EGVKTKQKAIVKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTG 719

Query: 402 FWDVDSGQV 410
                SG+V
Sbjct: 720 ELLPTSGEV 728


>2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 54/214 (25%), Positives = 88/214 (41%), Gaps = 15/214 (7%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLA 1045
            +L  +S+   +G+   L G +G+GK+T   +   +    SG V   GK    +S E+   
Sbjct: 16   ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK--PGYSAETVRQ 73

Query: 1046 HVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENG 1105
            H+  V   ++         I +   GA D+E+   A     L    +  Q          
Sbjct: 74   HIGFVSHSLLEKFQEGERVIDVVISGAIDDEIRNEAHQLLKLVGSAKAQQYI-------- 125

Query: 1106 ASLSGGERQRLSIARALLKDAPVVLLDEATASLD--PENETLIQRAVGTLCAGKTVIVIA 1163
              LS GE+QR+ IARA L    V++LDE  A LD                      I + 
Sbjct: 126  GYLSTGEKQRV-IARA-LGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVT 183

Query: 1164 HRLRTV-ANADKIVVLDSGRVAEEGNHKTLLAED 1196
            H +  + AN  KI++L  G+  ++G  + +L  +
Sbjct: 184  HFIEEITANFSKILLLKDGQSIQQGAVEDILTSE 217


>2ix8A [x.x.x] ELONGATION FACTOR 3A
          Length = 953

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 45/325 (13%)

Query: 843  LEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRV--ELAVDVSVSLASAILRSGVGLTAC 900
            L  +K +R    VG+D A  E +       T++V  EL  D +V+    I+   V   A 
Sbjct: 303  LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVVNELLKDETVAPRFKIV---VEYIAA 359

Query: 901  VGAVLLASGGVDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEAR 960
            +GA L+    +D       +   +     I     +  ++L+   K    +AV + P   
Sbjct: 360  IGADLIDERIIDQQAWFTHITPYT-----IFLHEKKAKDILDEFRK----RAVDNIPVGP 410

Query: 961  GSASADVPGHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF 1020
                 +  G DL        YG + +L+      +      + GP+G GKST   +A   
Sbjct: 411  NFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIA--- 467

Query: 1021 WEPDSGRVLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAE 1079
                +G+V   G    E     ++ H +     D  + D    + +   +E   D+    
Sbjct: 468  ----NGQV--DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGT-KEAIKDK---- 516

Query: 1080 AARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLD 1139
                   +EF      GF   +    A LSGG + +L++ARA+L++A ++LLDE T  LD
Sbjct: 517  ------LIEF------GFTDEIAPISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLD 562

Query: 1140 PENETLIQRAVGTLCAGKTVIVIAH 1164
              N   +   + T   G T I I+H
Sbjct: 563  TVNVAWLVNYLNT--CGITSITISH 585



 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 342 EAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVAR 401
           E  K  + A V + +  F Y   ++P + +++ +    +  AV+GP+G+GKSTL N++  
Sbjct: 644 EGVKTKQKAIVKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTG 702

Query: 402 FWDVDSGQV 410
                SG+V
Sbjct: 703 ELLPTSGEV 711


>2iw3B [x.x.x] ELONGATION FACTOR 3A
          Length = 958

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 45/325 (13%)

Query: 843  LEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRV--ELAVDVSVSLASAILRSGVGLTAC 900
            L  +K +R    VG+D A  E +       T++V  EL  D +V+    I+   V   A 
Sbjct: 307  LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVVNELLKDETVAPRFKIV---VEYIAA 363

Query: 901  VGAVLLASGGVDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEAR 960
            +GA L+    +D       +   +     I     +  ++L+   K    +AV + P   
Sbjct: 364  IGADLIDERIIDQQAWFTHITPYT-----IFLHEKKAKDILDEFRK----RAVDNIPVGP 414

Query: 961  GSASADVPGHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF 1020
                 +  G DL        YG + +L+      +      + GP+G GKST   +A   
Sbjct: 415  NFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIA--- 471

Query: 1021 WEPDSGRVLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAE 1079
                +G+V   G    E     ++ H +     D  + D    + +   +E   D+    
Sbjct: 472  ----NGQV--DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGT-KEAIKDK---- 520

Query: 1080 AARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLD 1139
                   +EF      GF   +    A LSGG + +L++ARA+L++A ++LLDE T  LD
Sbjct: 521  ------LIEF------GFTDEIAPISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLD 566

Query: 1140 PENETLIQRAVGTLCAGKTVIVIAH 1164
              N   +   + T   G T I I+H
Sbjct: 567  TVNVAWLVNYLNT--CGITSITISH 589



 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 342 EAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVAR 401
           E  K  + A V + +  F Y   ++P + +++ +    +  AV+GP+G+GKSTL N++  
Sbjct: 648 EGVKTKQKAIVKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTG 706

Query: 402 FWDVDSGQV 410
                SG+V
Sbjct: 707 ELLPTSGEV 715


>2iw3A [x.x.x] ELONGATION FACTOR 3A
          Length = 950

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 45/325 (13%)

Query: 843  LEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRV--ELAVDVSVSLASAILRSGVGLTAC 900
            L  +K +R    VG+D A  E +       T++V  EL  D +V+    I+   V   A 
Sbjct: 303  LRALKTLRRVGNVGEDDAIPELSHAGDVSTTLQVVNELLKDETVAPRFKIV---VEYIAA 359

Query: 901  VGAVLLASGGVDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEAR 960
            +GA L+    +D       +   +     I     +  ++L+   K    +AV + P   
Sbjct: 360  IGADLIDERIIDQQAWFTHITPYT-----IFLHEKKAKDILDEFRK----RAVDNIPVGP 410

Query: 961  GSASADVPGHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF 1020
                 +  G DL        YG + +L+      +      + GP+G GKST   +A   
Sbjct: 411  NFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIA--- 467

Query: 1021 WEPDSGRVLCSGKDIAEFSEESWLAH-VSIVFQDVVLFDDTVANNIRIGREGASDEEVAE 1079
                +G+V   G    E     ++ H +     D  + D    + +   +E   D+    
Sbjct: 468  ----NGQV--DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGT-KEAIKDK---- 516

Query: 1080 AARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLD 1139
                   +EF      GF   +    A LSGG + +L++ARA+L++A ++LLDE T  LD
Sbjct: 517  ------LIEF------GFTDEIAPISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLD 562

Query: 1140 PENETLIQRAVGTLCAGKTVIVIAH 1164
              N   +   + T   G T I I+H
Sbjct: 563  TVNVAWLVNYLNT--CGITSITISH 585



 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 342 EAPKAPKDASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVAR 401
           E  K  + A V + +  F Y   ++P + +++ +    +  AV+GP+G+GKSTL N++  
Sbjct: 644 EGVKTKQKAIVKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTG 702

Query: 402 FWDVDSGQV 410
                SG+V
Sbjct: 703 ELLPTSGEV 711


>2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 864

 Score = 42.7 bits (99), Expect = 6e-06
 Identities = 22/34 (64%), Positives = 25/34 (73%)

Query: 366 EPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLV 399
           E  L+NVS++IP GT  AV G SGSGKSTL N V
Sbjct: 536 EHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEV 569



 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 1065 IRIGREGASDEEVAEAARAAHCLEFIERLPQ-----------GFDTVLGENGASLSGGER 1113
            + +  +G +  EV +    A  L+F   +P+           G    LG+   +LSGGE 
Sbjct: 690  LEVTYKGKNIAEVLDTVEDA--LDFFASIPKIKRKLETLYDVGLGYKLGQPATTLSGGEA 747

Query: 1114 QRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AGKTVIVIAHRLRTV 1169
            QR+ +A  L + +    + +LDE T  L  ++   +   +  L   G TV+VI H L  +
Sbjct: 748  QRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI 807

Query: 1170 ANADKIVVL 1178
              AD I+ L
Sbjct: 808  KTADYIIDL 816


>2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 884

 Score = 42.7 bits (99), Expect = 6e-06
 Identities = 22/34 (64%), Positives = 25/34 (73%)

Query: 366 EPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLV 399
           E  L+NVS++IP GT  AV G SGSGKSTL N V
Sbjct: 556 EHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEV 589



 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 1065 IRIGREGASDEEVAEAARAAHCLEFIERLPQ-----------GFDTVLGENGASLSGGER 1113
            + +  +G +  EV +    A  L+F   +P+           G    LG+   +LSGGE 
Sbjct: 710  LEVTYKGKNIAEVLDTVEDA--LDFFASIPKIKRKLETLYDVGLGYKLGQPATTLSGGEA 767

Query: 1114 QRLSIARALLKDA---PVVLLDEATASLDPENETLIQRAVGTLC-AGKTVIVIAHRLRTV 1169
            QR+ +A  L + +    + +LDE T  L  ++   +   +  L   G TV+VI H L  +
Sbjct: 768  QRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI 827

Query: 1170 ANADKIVVL 1178
              AD I+ L
Sbjct: 828  KTADYIIDL 836


>2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 299

 Score = 42.7 bits (99), Expect = 6e-06
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVG 413
           + +G
Sbjct: 59  LFIG 62



 Score = 35.8 bits (81), Expect = 7e-04
 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 1128 VVLLDEAT-ASLDPENETLIQRAVGTLCAGKTVIVIAH-RLRTVANADKIVVLDSGRVAE 1185
            V LLDE   A+L  +    I R    L  G+T+I + H ++  +  ADKIVVLD+GRVA+
Sbjct: 83   VFLLDEPLDAALRVQMRIEISRLHKRL--GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ 140

Query: 1186 EG 1187
             G
Sbjct: 141  VG 142



 Score = 35.4 bits (80), Expect = 9e-04
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRI 1067
             K + +         V +V   V L D+ +   +R+
Sbjct: 63   EKRMNDTPPAE--RGVGMVEPSVFLLDEPLDAALRV 96


>2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 301

 Score = 42.7 bits (99), Expect = 6e-06
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 350 ASVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQ 409
           ASV L++VT ++ +      ++++L+I  G     VGPSG GKSTL  ++A    + SG 
Sbjct: 1   ASVQLQNVTKAWGEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 58

Query: 410 VLVG 413
           + +G
Sbjct: 59  LFIG 62



 Score = 39.7 bits (91), Expect = 5e-05
 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 1128 VVLLDEATASLDPENETLIQRAVGTLCA--GKTVIVIAH-RLRTVANADKIVVLDSGRVA 1184
            V LLDE  ++LD      ++  +  L    G+T+I + H ++  +  ADKIVVLD+GRVA
Sbjct: 83   VFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVA 142

Query: 1185 EEG 1187
            + G
Sbjct: 143  QVG 145



 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query: 972  LSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCS 1031
            +  Q V   +G+  V   ++    EGE    VGPSG GKST  ++ A      SG +   
Sbjct: 3    VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVAN 1063
             K + +         V +V   V L D+ ++N
Sbjct: 63   EKRMNDTPPAE--RGVGMVEPSVFLLDEPLSN 92


>1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 50/205 (24%), Positives = 80/205 (39%), Gaps = 37/205 (18%)

Query: 979  FGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGR-------VLCS 1031
            F  G    L  V+     GE   ++GPSG+GK+T  ++ A    P +G        V  +
Sbjct: 13   FKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASN 72

Query: 1032 GKDIAEFSEESWLAHVSIVFQDVVLFDDTVA--------NNIRIGREGASD--EEVAEAA 1081
            GK I    +      + +VFQ   L+ +  A         N+++ +E      EEVA+  
Sbjct: 73   GKLIVPPEDRK----IGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKIL 128

Query: 1082 RAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDPE 1141
               H L    R               LSG             KD  ++LLDE  ++LD  
Sbjct: 129  DIHHVLNHFPR--------------ELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDAR 174

Query: 1142 NETLIQRAVGTLCA--GKTVIVIAH 1164
                 +  V  + +  G T++V++H
Sbjct: 175  MRDSARALVKEVQSRLGVTLLVVSH 199


>2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 251

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 57/224 (25%), Positives = 90/224 (40%), Gaps = 23/224 (10%)

Query: 986  VLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGK-DIAEFSEESWL 1044
            +L  +S+   +G+   L G +G+GK+T   +   +    SG V   GK     +S E+  
Sbjct: 17   ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKVGYSAETVR 76

Query: 1045 AHVSIV-------FQDVVLFDDTVANNI--RIGREGASDEEVAEAARAAHCLEFIERLPQ 1095
             H+  V       FQ+     D V +     IG     D+E+   A     L    +  Q
Sbjct: 77   QHIGFVSHSLLEKFQEGERVIDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGSAKAQQ 136

Query: 1096 GFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLD--PENETLIQRAVGTL 1153
                        LS GE+QR+ IARA L    V++LDE  A LD                
Sbjct: 137  YI--------GYLSTGEKQRV-IARA-LGQPQVLILDEPAAGLDFIAREXXXXXXXXXXX 186

Query: 1154 CAGKTVIVIAHRLRTV-ANADKIVVLDSGRVAEEGNHKTLLAED 1196
                  I + H +  + AN  KI++L  G+  ++G  + +L  +
Sbjct: 187  XYPTLAIYVTHFIEEITANFSKILLLKDGQSIQQGAVEDILTSE 230


>1xewY [c.37.1] SMC PROTEIN
          Length = 160

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 7/96 (7%)

Query: 1090 IERLPQGFDTVLGENGASLSGGERQRLSIARAL----LKDAPVVLLDEATASLDPENETL 1145
            IE  P G D    E   ++SGGE+   ++A        K AP  L DE  A LD  N   
Sbjct: 43   IEAKPAGKDVKRIE---AMSGGEKALTALAFVFAIQKFKPAPFYLFDEIDAHLDDANVKR 99

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSG 1181
            +   +         IVI  R   +ANADKI+ +  G
Sbjct: 100  VADLIKESSKESQFIVITLRDVMMANADKIIGVSMG 135


>2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066
          Length = 261

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 357 VTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVD 416
           +T S +     +L N++LE+  G    ++GP+GSGK+TL   ++      SG + + G++
Sbjct: 9   ITLSGKGYERFSLENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPY-SGNIFINGME 66

Query: 417 VREM 420
           VR++
Sbjct: 67  VRKI 70


>1xexB [c.37.1] SMC PROTEIN
          Length = 161

 Score = 35.4 bits (80), Expect = 9e-04
 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 1090 IERLPQGFDTVLGENGASLSGGERQRLSIARAL----LKDAPVVLLDEATASLDPENETL 1145
            IE  P G D    E   ++SGGE+   ++A        K AP  L D+  A LD  N   
Sbjct: 43   IEAKPAGKDVKRIE---AMSGGEKALTALAFVFAIQKFKPAPFYLFDQIDAHLDDANVKR 99

Query: 1146 IQRAVGTLCAGKTVIVIAHRLRTVANADKIV 1176
            +   +         IVI  R   +ANADKI+
Sbjct: 100  VADLIKESSKESQFIVITLRDVMMANADKII 130


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.329    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 912,650,523
Number of extensions: 36468521
Number of successful extensions: 88045
Number of sequences better than 1.0e-03: 1077
Number of HSP's gapped: 86772
Number of HSP's successfully gapped: 2331
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)