BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV56911.1 elen0 ACV56911.1 GIB01015CH01 "xanthine
phosphoribosyltransferase"
         (191 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2fxvA [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE                      160   2e-42
1y0bD [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE                      153   3e-40
1y0bA [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE                      153   3e-40
1y0bC [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE                      151   1e-39
1y0bB [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE                      151   1e-39
1o57B [a.4.5 - c.61.1] PUR OPERON REPRESSOR                            73   6e-16
1o57A [a.4.5 - c.61.1] PUR OPERON REPRESSOR                            73   6e-16
1p4aC [a.4.5 - c.61.1] PUR OPERON REPRESSOR                            72   2e-15
1p4aB [a.4.5 - c.61.1] PUR OPERON REPRESSOR                            71   2e-15
1p4aA [a.4.5 - c.61.1] PUR OPERON REPRESSOR                            71   2e-15
1l1rA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE                       54   4e-10
1l1qA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE                       54   4e-10
1g2qA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1                     40   4e-06
1g2pA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1                     39   1e-05
2dy0B [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE                        38   2e-05
2dy0A [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE                        38   2e-05
1ecfB [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE         37   4e-05
1eccA [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE         37   4e-05
1ecbC [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE         37   4e-05
1ecbD [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE         37   5e-05
1ecbB [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE         37   5e-05
1oroA [c.61.1] OROTATE PHOSPHORIBOSYLTRANSFERASE                       33   5e-04

>2fxvA [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE
          Length = 190

 Score =  160 bits (406), Expect = 2e-42
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 2/190 (1%)

Query: 1   MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEAS 60
           ME L+ +I  +GVV S+ VLKVDSFLNHQ+D  L   +G+EF   FA   ITKI+TIE+S
Sbjct: 1   MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESS 60

Query: 61  GIGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHV 120
           GI  A +     GVPVVFA+K +S+ L   + T  + SFT      + VS   L+  DHV
Sbjct: 61  GIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHV 120

Query: 121 LIIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVER 180
           LIIDDFLANG A +GL+ +V +           IEK FQPG D+L + GYR+ESLA ++ 
Sbjct: 121 LIIDDFLANGQAAHGLVSIVKQXXXXXXXXXXVIEKSFQPGRDELVKLGYRVESLARIQS 180

Query: 181 MDPETGEIAF 190
           +  E G+++F
Sbjct: 181 L--EEGKVSF 188


>1y0bD [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE
          Length = 191

 Score =  153 bits (387), Expect = 3e-40
 Identities = 90/189 (47%), Positives = 119/189 (62%), Gaps = 4/189 (2%)

Query: 2   ELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASG 61
           E L+ +I  +GVV S+ VLKVDSFLNHQ+D  L   +G+EF   FA   ITKI+TIE+SG
Sbjct: 4   EALKRKIEEEGVVLSDQVLKVDSFLNHQID-PLLQRIGDEFASRFAKDGITKIVTIESSG 62

Query: 62  IGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVL 121
           I  A V     GVPVVFA+K +S+ L   + T  + SFT      + VS   L+  DHVL
Sbjct: 63  IAPA-VTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVL 121

Query: 122 IIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERM 181
           IIDDFLANG A +GL+ +V +           IEK FQPG D+L + GYR+ESLA ++ +
Sbjct: 122 IIDDFLANGQAAHGLVSIVKQXXXXXXXXXXVIEKSFQPGRDELVKLGYRVESLARIQSL 181

Query: 182 DPETGEIAF 190
             E G+++F
Sbjct: 182 --EEGKVSF 188


>1y0bA [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE
          Length = 190

 Score =  153 bits (387), Expect = 3e-40
 Identities = 90/189 (47%), Positives = 119/189 (62%), Gaps = 4/189 (2%)

Query: 2   ELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASG 61
           E L+ +I  +GVV S+ VLKVDSFLNHQ+D  L   +G+EF   FA   ITKI+TIE+SG
Sbjct: 3   EALKRKIEEEGVVLSDQVLKVDSFLNHQID-PLLQRIGDEFASRFAKDGITKIVTIESSG 61

Query: 62  IGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVL 121
           I  A V     GVPVVFA+K +S+ L   + T  + SFT      + VS   L+  DHVL
Sbjct: 62  IAPA-VTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVL 120

Query: 122 IIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERM 181
           IIDDFLANG A +GL+ +V +           IEK FQPG D+L + GYR+ESLA ++ +
Sbjct: 121 IIDDFLANGQAAHGLVSIVKQXXXXXXXXXXVIEKSFQPGRDELVKLGYRVESLARIQSL 180

Query: 182 DPETGEIAF 190
             E G+++F
Sbjct: 181 --EEGKVSF 187


>1y0bC [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE
          Length = 186

 Score =  151 bits (382), Expect = 1e-39
 Identities = 90/189 (47%), Positives = 120/189 (63%), Gaps = 7/189 (3%)

Query: 2   ELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASG 61
           E L+ +I  +GVV S+ VLKVDSFLNHQ+D  L   +G+EF   FA   ITKI+TIE+SG
Sbjct: 4   EALKRKIEEEGVVLSDQVLKVDSFLNHQID-PLLQRIGDEFASRFAKDGITKIVTIESSG 62

Query: 62  IGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVL 121
           I  A V     GVPVVFA+K +S+ L   + T  + SFT  ++    VS   L+  DHVL
Sbjct: 63  IAPA-VTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTESQI---AVSGTHLSDQDHVL 118

Query: 122 IIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERM 181
           IIDDFLANG A +GL+ +V +           IEK FQPG D+L + GYR+ESLA ++ +
Sbjct: 119 IIDDFLANGQAAHGLVSIVKQXXXXXXXXXXVIEKSFQPGRDELVKLGYRVESLARIQSL 178

Query: 182 DPETGEIAF 190
             E G+++F
Sbjct: 179 --EEGKVSF 185


>1y0bB [x.x.x] XANTHINE PHOSPHORIBOSYLTRANSFERASE
          Length = 189

 Score =  151 bits (382), Expect = 1e-39
 Identities = 90/189 (47%), Positives = 120/189 (63%), Gaps = 7/189 (3%)

Query: 2   ELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASG 61
           E L+ +I  +GVV S+ VLKVDSFLNHQ+D  L   +G+EF   FA   ITKI+TIE+SG
Sbjct: 4   EALKRKIEEEGVVLSDQVLKVDSFLNHQID-PLLQRIGDEFASRFAKDGITKIVTIESSG 62

Query: 62  IGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVL 121
           I  A V     GVPVVFA+K +S+ L   + T  + SFT  ++    VS   L+  DHVL
Sbjct: 63  IAPA-VTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTESQI---AVSGTHLSDQDHVL 118

Query: 122 IIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERM 181
           IIDDFLANG A +GL+ +V +           IEK FQPG D+L + GYR+ESLA ++ +
Sbjct: 119 IIDDFLANGQAAHGLVSIVKQXXXXXXXXXXVIEKSFQPGRDELVKLGYRVESLARIQSL 178

Query: 182 DPETGEIAF 190
             E G+++F
Sbjct: 179 --EEGKVSF 185


>1o57B [a.4.5 - c.61.1] PUR OPERON REPRESSOR
          Length = 269

 Score = 73.2 bits (178), Expect = 6e-16
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 15/150 (10%)

Query: 6   ERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIA 65
           ERI   G V    +L   S L+          +G+ F  +FA+  I  ++T+   GI +A
Sbjct: 95  ERILPGGYVYLTDILGKPSVLSK---------VGKLFASVFAEREIDVVMTVATKGIPLA 145

Query: 66  CVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDD 125
              A +  VPVV  +K      DG   +    S +  R+  + ++K+ +    +VLIIDD
Sbjct: 146 YAAASYLNVPVVIVRK------DGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDD 199

Query: 126 FLANGCALNGLIELVGEAGATVEGIGIAIE 155
           F+  G  +NG+I L+ E  A V GIG+ +E
Sbjct: 200 FMKAGGTINGMINLLDEFNANVAGIGVLVE 229


>1o57A [a.4.5 - c.61.1] PUR OPERON REPRESSOR
          Length = 270

 Score = 73.2 bits (178), Expect = 6e-16
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 15/150 (10%)

Query: 6   ERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIA 65
           ERI   G V    +L   S L+          +G+ F  +FA+  I  ++T+   GI +A
Sbjct: 94  ERILPGGYVYLTDILGKPSVLSK---------VGKLFASVFAEREIDVVMTVATKGIPLA 144

Query: 66  CVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDD 125
              A +  VPVV  +K      DG   +    S +  R+  + ++K+ +    +VLIIDD
Sbjct: 145 YAAASYLNVPVVIVRK------DGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDD 198

Query: 126 FLANGCALNGLIELVGEAGATVEGIGIAIE 155
           F+  G  +NG+I L+ E  A V GIG+ +E
Sbjct: 199 FMKAGGTINGMINLLDEFNANVAGIGVLVE 228


>1p4aC [a.4.5 - c.61.1] PUR OPERON REPRESSOR
          Length = 269

 Score = 71.6 bits (174), Expect = 2e-15
 Identities = 46/150 (30%), Positives = 74/150 (49%), Gaps = 13/150 (8%)

Query: 6   ERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIA 65
           ERI   G V    +L   S L+          +G+ F  +FA+  I  ++T+   GI +A
Sbjct: 94  ERILPGGYVYLTDILGKPSVLSK---------VGKLFASVFAEREIDVVMTVATKGIPLA 144

Query: 66  CVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDD 125
              A +  VPVV  +K      +G   +    S +  R+  + ++K+ +    +VLIIDD
Sbjct: 145 YAAASYLNVPVVIVRKDN----EGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDD 200

Query: 126 FLANGCALNGLIELVGEAGATVEGIGIAIE 155
           F+  G  +NG+I L+ E  A V GIG+ +E
Sbjct: 201 FMKAGGTINGMINLLDEFNANVAGIGVLVE 230


>1p4aB [a.4.5 - c.61.1] PUR OPERON REPRESSOR
          Length = 268

 Score = 71.2 bits (173), Expect = 2e-15
 Identities = 46/150 (30%), Positives = 74/150 (49%), Gaps = 14/150 (9%)

Query: 6   ERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIA 65
           ERI   G V    +L   S L+          +G+ F  +FA+  I  ++T+   GI +A
Sbjct: 94  ERILPGGYVYLTDILGKPSVLSK---------VGKLFASVFAEREIDVVMTVATKGIPLA 144

Query: 66  CVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDD 125
              A +  VPVV  +K +     G   +    S +  R+  + ++K+ +    +VLIIDD
Sbjct: 145 YAAASYLNVPVVIVRKDE-----GSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDD 199

Query: 126 FLANGCALNGLIELVGEAGATVEGIGIAIE 155
           F+  G  +NG+I L+ E  A V GIG+ +E
Sbjct: 200 FMKAGGTINGMINLLDEFNANVAGIGVLVE 229


>1p4aA [a.4.5 - c.61.1] PUR OPERON REPRESSOR
          Length = 269

 Score = 71.2 bits (173), Expect = 2e-15
 Identities = 45/150 (30%), Positives = 76/150 (50%), Gaps = 16/150 (10%)

Query: 6   ERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIA 65
           ERI   G V    +L   S L+          +G+ F  +FA+  I  ++T+   GI +A
Sbjct: 94  ERILPGGYVYLTDILGKPSVLSK---------VGKLFASVFAEREIDVVMTVATKGIPLA 144

Query: 66  CVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDD 125
              A +  VPVV  +K  +++++         S +  R+  + ++K+ +    +VLIIDD
Sbjct: 145 YAAASYLNVPVVIVRKDSTVSIN-------YVSGSSNRIQTMSLAKRSMKTGSNVLIIDD 197

Query: 126 FLANGCALNGLIELVGEAGATVEGIGIAIE 155
           F+  G  +NG+I L+ E  A V GIG+ +E
Sbjct: 198 FMKAGGTINGMINLLDEFNANVAGIGVLVE 227


>1l1rA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE
          Length = 179

 Score = 53.9 bits (128), Expect = 4e-10
 Identities = 41/119 (34%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 36  DAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVFAKKAQSINLDGEMFTTR 95
           DA+ +E    + D PITK++ IE+ G  +  +VA   GV  V  +KA  +  D    T  
Sbjct: 38  DAVRKEVTAHYKDVPITKVVGIESRGFILGGIVANSLGVGFVALRKAGKLPGDVCKCTFD 97

Query: 96  IESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELVGEAGATVEGIGIAI 154
           +E   + +   + V K+ L   D VL+ DD LA G  L   IEL   AG   E I I +
Sbjct: 98  ME---YQKGVTIEVQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENIYINV 153


>1l1qA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE
          Length = 181

 Score = 53.9 bits (128), Expect = 4e-10
 Identities = 41/119 (34%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 36  DAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVFAKKAQSINLDGEMFTTR 95
           DA+ +E    + D PITK++ IE+ G  +  +VA   GV  V  +KA  +  D    T  
Sbjct: 38  DAVRKEVTAHYKDVPITKVVGIESRGFILGGIVANSLGVGFVALRKAGKLPGDVCKCTFD 97

Query: 96  IESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELVGEAGATVEGIGIAI 154
           +E   + +   + V K+ L   D VL+ DD LA G  L   IEL   AG   E I I +
Sbjct: 98  ME---YQKGVTIEVQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENIYINV 153


>1g2qA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1
          Length = 178

 Score = 40.4 bits (93), Expect = 4e-06
 Identities = 41/153 (26%), Positives = 61/153 (39%), Gaps = 7/153 (4%)

Query: 16  SEGVLKVDS---FLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHF 72
           SEG+L  D    F N  L   L DA     +  F +  I  I+ +E+ G      +A   
Sbjct: 22  SEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALAL 81

Query: 73  GVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCA 132
           GV  V  +KA    L GE F    E      ++++   K  + A  +V+I+DD +     
Sbjct: 82  GVGFVPVRKAGK--LPGECFKATYEKEYGSDLFEI--QKNAIPAGSNVIIVDDIIXXXXX 137

Query: 133 LNGLIELVGEAGATVEGIGIAIEKGFQPGGDDL 165
                ELV +  A +      +E  F  G   L
Sbjct: 138 XXXXXELVEQLEANLLEYNFVMELDFLKGRSKL 170


>1g2pA [c.61.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1
          Length = 170

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 43/154 (27%), Positives = 61/154 (39%), Gaps = 13/154 (8%)

Query: 16  SEGVLKVDS---FLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHF 72
           SEG+L  D    F N  L   L DA     +  F +  I  I+ +E+ G      +A   
Sbjct: 18  SEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALAL 77

Query: 73  GVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVI-VSKKFLNADDHVLIIDDFLANGC 131
           GV  V  +KA    L GE F    ES       D+  + K  + A  +V+I+DD +    
Sbjct: 78  GVGFVPVRKAGK--LPGECFKATYES-------DLFEIQKNAIPAGSNVIIVDDIIXXXX 128

Query: 132 ALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDL 165
                 ELV +  A +      +E  F  G   L
Sbjct: 129 XXXXXXELVEQLEANLLEYNFVMELDFLKGRSKL 162


>2dy0B [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
          Length = 181

 Score = 38.1 bits (87), Expect = 2e-05
 Identities = 32/123 (26%), Positives = 51/123 (41%), Gaps = 5/123 (4%)

Query: 46  FADAPITKILTIEASGIGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVY 105
           + +A ITK++  EA G      VA   GV  V  +K   +  +    T  +E  T     
Sbjct: 50  YKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTD---- 105

Query: 106 DVIVSKKFLNADDHVLIIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDL 165
            + +    +   D VL++DD LA G  +   ++L+   G  V      I   F  GG+  
Sbjct: 106 QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINL-FDLGGEQR 164

Query: 166 RER 168
            E+
Sbjct: 165 LEK 167


>2dy0A [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
          Length = 182

 Score = 38.1 bits (87), Expect = 2e-05
 Identities = 32/123 (26%), Positives = 51/123 (41%), Gaps = 5/123 (4%)

Query: 46  FADAPITKILTIEASGIGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVY 105
           + +A ITK++  EA G      VA   GV  V  +K   +  +    T  +E  T     
Sbjct: 51  YKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTD---- 106

Query: 106 DVIVSKKFLNADDHVLIIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDL 165
            + +    +   D VL++DD LA G  +   ++L+   G  V      I   F  GG+  
Sbjct: 107 QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINL-FDLGGEQR 165

Query: 166 RER 168
            E+
Sbjct: 166 LEK 168


>1ecfB [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
          Length = 500

 Score = 37.4 bits (85), Expect = 4e-05
 Identities = 30/127 (23%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 23  DSFLN----HQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVF 78
           DSF++    +   +++   +GE+  R + D  I  ++ I  +   IA  +AR  G P  +
Sbjct: 263 DSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKP--Y 320

Query: 79  AKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIE 138
            +        G  F    +      V   + + +    D +VL++DD +  G     +IE
Sbjct: 321 RQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIE 380

Query: 139 LVGEAGA 145
           +  EAGA
Sbjct: 381 MAREAGA 387


>1eccA [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
          Length = 492

 Score = 37.4 bits (85), Expect = 4e-05
 Identities = 30/127 (23%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 23  DSFLN----HQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVF 78
           DSF++    +   +++   +GE+  R + D  I  ++ I  +   IA  +AR  G P  +
Sbjct: 263 DSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKP--Y 320

Query: 79  AKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIE 138
            +        G  F    +      V   + + +    D +VL++DD +  G     +IE
Sbjct: 321 RQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIE 380

Query: 139 LVGEAGA 145
           +  EAGA
Sbjct: 381 MAREAGA 387


>1ecbC [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
          Length = 482

 Score = 37.4 bits (85), Expect = 4e-05
 Identities = 30/127 (23%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 23  DSFLN----HQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVF 78
           DSF++    +   +++   +GE+  R + D  I  ++ I  +   IA  +AR  G P  +
Sbjct: 263 DSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKP--Y 320

Query: 79  AKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIE 138
            +        G  F    +      V   + + +    D +VL++DD +  G     +IE
Sbjct: 321 RQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIE 380

Query: 139 LVGEAGA 145
           +  EAGA
Sbjct: 381 MAREAGA 387


>1ecbD [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
          Length = 473

 Score = 37.0 bits (84), Expect = 5e-05
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 26/133 (19%)

Query: 23  DSFLN----HQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVF 78
           DSF++    +   +++   +GE+  R + D  I  ++ I  +   IA  +AR  G P   
Sbjct: 263 DSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPY-- 320

Query: 79  AKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNA------DDHVLIIDDFLANGCA 132
               Q            +++   GR + + V +K LNA      D +VL++DD +  G  
Sbjct: 321 ---RQGF----------VKNRYVGRTFIMSVRRK-LNANRAEFRDKNVLLVDDSIVRGTT 366

Query: 133 LNGLIELVGEAGA 145
              +IE+  EAGA
Sbjct: 367 SEQIIEMAREAGA 379


>1ecbB [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
          Length = 470

 Score = 37.0 bits (84), Expect = 5e-05
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 26/133 (19%)

Query: 23  DSFLN----HQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVARHFGVPVVF 78
           DSF++    +   +++   +GE+  R + D  I  ++ I  +   IA  +AR  G P   
Sbjct: 263 DSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPY-- 320

Query: 79  AKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNA------DDHVLIIDDFLANGCA 132
               Q            +++   GR + + V +K LNA      D +VL++DD +  G  
Sbjct: 321 ---RQGF----------VKNRYVGRTFIMSVRRK-LNANRAEFRDKNVLLVDDSIVRGTT 366

Query: 133 LNGLIELVGEAGA 145
              +IE+  EAGA
Sbjct: 367 SEQIIEMAREAGA 379


>1oroA [c.61.1] OROTATE PHOSPHORIBOSYLTRANSFERASE
          Length = 213

 Score = 33.5 bits (75), Expect = 5e-04
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 11/117 (9%)

Query: 73  GVPVVFAKK---AQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLAN 129
           G+P+        A+  +LD      R E+  HG   +++ S         V+++DD +  
Sbjct: 74  GIPIATTTAVALAEHHDLDLPYCFNRKEAKDHGEGGNLVGSA----LQGRVMLVDDVITA 129

Query: 130 GCALNGLIELVGEAGATVEGIGIAIEKGFQPGGD----DLRERGYRLESLAIVERMD 182
           G A+   +E++   GAT+ G+ I++++  +  G+       ER Y  + ++I+   D
Sbjct: 130 GTAIRESMEIIQANGATLAGVLISLDRQERGRGEISAIQEVERDYNCKVISIITLKD 186


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.327    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 934,917,158
Number of extensions: 36878225
Number of successful extensions: 89557
Number of sequences better than 1.0e-03: 2583
Number of HSP's gapped: 87552
Number of HSP's successfully gapped: 2970
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)