BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV54696.1 elen0 ACV54696.1 GIB01015CH01 "phosphoribosyl-ATP
diphosphatase"
         (163 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

HIS2_THICR RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    49   2e-08
HIS2_LACPL RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    48   7e-08
HIS2_LEPIN RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    47   2e-07
HIS2_LEPIC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    47   2e-07
HIS2_NITEU RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    46   2e-07
HIS2_LACF3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    46   2e-07
HIS2_HALHL RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    45   4e-07
HIS2_ACIAC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    45   4e-07
HIS2_HALSA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    44   1e-06
HIS2_HALS3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    44   1e-06
HIS2_DECAR RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    44   1e-06
HIS2_TERTT RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    44   1e-06
HIS2_HALMA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    44   1e-06
HIS2_DEIRA RecName: Full=Histidine biosynthesis bifunctional pro...    43   2e-06
HIS2_RALPJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   3e-06
HIS2_NITEC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   3e-06
HIS2_THETN RecName: Full=Histidine biosynthesis bifunctional pro...    42   4e-06
HIS2_STRGC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   4e-06
HIS2_POLSJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   4e-06
HIS2_LEPBP RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   4e-06
HIS2_LEPBA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   4e-06
HIS2_HELHP RecName: Full=Histidine biosynthesis bifunctional pro...    42   4e-06
HIS2_NEIG1 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   5e-06
HIS2_METNO RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   5e-06
HIS2_METCA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   5e-06
HIS2_LEUMM RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    42   5e-06
HIS2_RHIL3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    41   6e-06
HIS2_RALEJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    41   6e-06
HIS2_RHILW RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    41   8e-06
HIS2_RHIE6 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    41   8e-06
HIS2_AGRRK RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    40   1e-05
HIS2_THIDA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    40   2e-05
HIS2_NEIMF RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    40   2e-05
HIS2_NEIMB RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    40   2e-05
HIS2_NEIMA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    40   2e-05
HIS2_RHOCA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    39   2e-05
HIS2_RALEH RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    39   2e-05
HIS2_METVS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    39   2e-05
HIS2_ERYLH RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    39   2e-05
HIS2_RHOBA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    39   3e-05
HIS2_RHIEC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    38   5e-05
HIS2_METS5 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    38   5e-05
HIS2_METRJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    38   5e-05
HIS2_AZOC5 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    38   7e-05
HIS2_ALCBS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    38   7e-05
HIS2_BURM1 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   9e-05
HIS2_BURCH RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   9e-05
HIS2_BURCA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   9e-05
HIS2_LEPBL RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_LEPBJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_BURVG RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_BURTA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_BURS3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_BURCJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_BURCC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   1e-04
HIS2_BURPS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURP6 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURP1 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURP0 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURMS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURMA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURM9 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BURM7 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    37   2e-04
HIS2_BACTN RecName: Full=Histidine biosynthesis bifunctional pro...    37   2e-04
HIS2_AGRT5 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    36   2e-04
HIS2_IGNH4 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    36   3e-04
HIS2_METBF RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    35   4e-04
HIS2_MESSB RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    35   4e-04
HIS2_GLOVI RecName: Full=Histidine biosynthesis bifunctional pro...    35   4e-04
HIS2_BURCM RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    35   4e-04
HIS2_BURA4 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    35   4e-04
HIS21_BRAJA RecName: Full=Phosphoribosyl-ATP pyrophosphatase 1; ...    35   5e-04
HIS2_THET2 RecName: Full=Histidine biosynthesis bifunctional pro...    35   6e-04
HIS2_ROSDO RecName: Full=Phosphoribosyl-ATP pyrophosphatase;    ...    35   6e-04
HIS21_RHOPA RecName: Full=Phosphoribosyl-ATP pyrophosphatase 1; ...    34   8e-04

>HIS2_THICR RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 113

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 38/125 (30%), Positives = 49/125 (39%), Gaps = 38/125 (30%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY   L    LD +LKKV EEA ET +AAKD                             
Sbjct: 24  SYVASLYEKGLDKILKKVGEEATETVMAAKDA---------------------------- 55

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVRLHEDH 158
             EY    D+L YE AD+ +H L++L   G+   +   EL  R         G+  HE+ 
Sbjct: 56  --EYTQNNDNLVYEVADLWFHTLILLSHQGLSSTDITNELQKRF--------GLSGHEEK 105

Query: 159 VKRGK 163
             R K
Sbjct: 106 ANRSK 110


>HIS2_LACPL RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 106

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 38/115 (33%), Positives = 50/115 (43%), Gaps = 38/115 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L T  LD +LKKV EE+ E  +AAK+                             
Sbjct: 22  SYTDYLFTKGLDKILKKVGEESTEVIVAAKN----------------------------- 52

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR---MTD-AERPE 149
                   D L YE AD++YH+LV+L   G+  D+   EL  R   M+D  +RPE
Sbjct: 53  -----PGDDELTYETADLLYHVLVLLVERGVSFDQIKQELAKREGKMSDYKDRPE 102


>HIS2_LEPIN RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 92

 Score = 46.6 bits (109), Expect = 2e-07
 Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L  G +D +LKKV EEAGE  +AAK+ +                           
Sbjct: 22  SYTADLFRGGVDRILKKVGEEAGEVIIAAKNSDK-------------------------- 55

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                     L +E AD+++HL V+L   G+ L E   EL+ R
Sbjct: 56  --------KELTHEVADLLFHLQVLLVEQGLSLQEIVEELHKR 90


>HIS2_LEPIC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 92

 Score = 46.6 bits (109), Expect = 2e-07
 Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L  G +D +LKKV EEAGE  +AAK+ +                           
Sbjct: 22  SYTADLFRGGVDRILKKVGEEAGEVIIAAKNSDK-------------------------- 55

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                     L +E AD+++HL V+L   G+ L E   EL+ R
Sbjct: 56  --------KELTHEVADLLFHLQVLLVEQGLSLQEIVEELHKR 90


>HIS2_NITEU RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 112

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT +LL  S D VLKK+ EEA ET +A KD +                           
Sbjct: 25  SYTAKLLNSSQDKVLKKIAEEAAETIMACKDNDR-------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                   + + YE AD+ +H L++L R+ I  ++   EL  R
Sbjct: 59  --------EQIIYETADLWFHCLIMLTRHDISPEDILRELERR 93


>HIS2_LACF3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 106

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 39/115 (33%), Positives = 52/115 (45%), Gaps = 38/115 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L T  LD +LKKV EE  E  +AAK+                   + T EL    
Sbjct: 22  SYTDYLFTKGLDKILKKVGEETTEVIVAAKN-------------------EGTAEL---- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR---MTD-AERPE 149
                      +YE AD++YHL+V+L   G+  D+   EL  R   M+D  +RPE
Sbjct: 59  -----------QYETADLLYHLMVLLVEQGLTYDDIKEELGKREGLMSDFKDRPE 102


>HIS2_HALHL RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 114

 Score = 45.1 bits (105), Expect = 4e-07
 Identities = 33/104 (31%), Positives = 43/104 (41%), Gaps = 34/104 (32%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL    LD +LKKV EEA E  +AAK  E                           
Sbjct: 32  SYVARLHDKGLDAILKKVGEEATEAVIAAKGGER-------------------------- 65

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRM 142
                   + + YE AD+ +H LV+L   G+ +DE  AEL  R+
Sbjct: 66  --------EQVVYETADLWFHTLVMLSASGVSVDEVLAELERRV 101


>HIS2_ACIAC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 137

 Score = 45.1 bits (105), Expect = 4e-07
 Identities = 32/103 (31%), Positives = 42/103 (40%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RLL    D  LKK+ EEA E  +AAKDV                            
Sbjct: 41  SYVARLLHKGPDAFLKKIGEEATEVVMAAKDV---------------------------- 72

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
             ++ A    L YE AD+ +H ++ L  YG+   +  AEL  R
Sbjct: 73  --DHGADASKLVYEVADLWFHSMIALAHYGLAPADVVAELERR 113


>HIS2_HALSA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 95

 Score = 43.9 bits (102), Expect = 1e-06
 Identities = 38/106 (35%), Positives = 48/106 (45%), Gaps = 37/106 (34%)

Query: 39  SYTYRLLTGSLDG---VLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELA 95
           SYT  LL     G    L+KV EEA E  LAAKD                    +TDELA
Sbjct: 23  SYTASLLADDEKGENAALEKVGEEATEFLLAAKD-------------------GDTDELA 63

Query: 96  VDLPPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                          +E ADVVYH+LVVL +  + ++   AEL++R
Sbjct: 64  ---------------HEGADVVYHMLVVLAQQDMDVEALLAELDDR 94


>HIS2_HALS3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 95

 Score = 43.9 bits (102), Expect = 1e-06
 Identities = 38/106 (35%), Positives = 48/106 (45%), Gaps = 37/106 (34%)

Query: 39  SYTYRLLTGSLDG---VLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELA 95
           SYT  LL     G    L+KV EEA E  LAAKD                    +TDELA
Sbjct: 23  SYTASLLADDEKGENAALEKVGEEATEFLLAAKD-------------------GDTDELA 63

Query: 96  VDLPPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                          +E ADVVYH+LVVL +  + ++   AEL++R
Sbjct: 64  ---------------HEGADVVYHMLVVLAQQDMDVEALLAELDDR 94


>HIS2_DECAR RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 108

 Score = 43.9 bits (102), Expect = 1e-06
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT +L +   D +LKK+ EE  E  +AAKD +                           
Sbjct: 25  SYTAKLFSEGPDSILKKIGEECAELIMAAKDGKRL------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                    ++ +E+ DV+YH+LV+L  YG+ +++ + E+  R
Sbjct: 60  ---------NIVWESTDVIYHVLVLLAFYGLSIEDVSQEMRRR 93


>HIS2_TERTT RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 110

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  +L    L+ +L+KV EE  ET LAAKD +                           
Sbjct: 24  SYVAKLHHKGLNKILEKVGEECTETILAAKDAQ--------------------------- 56

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
              +D+   HL YE AD+ +H LV+L   G+  ++   EL  R
Sbjct: 57  ---HDSDTQHLIYETADLWFHSLVMLSHLGLSAEDVLNELARR 96


>HIS2_HALMA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 98

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 36/105 (34%)

Query: 39  SYTYRLLTGSL--DGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAV 96
           SYT  L T     + VL+K+ EE  E  LAAKD                   D+T+ELA 
Sbjct: 27  SYTASLFTHEKGENAVLEKLGEETTELILAAKD-------------------DDTEELA- 66

Query: 97  DLPPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                         +E+AD+VYHLLV+L    + +D+  AEL  R
Sbjct: 67  --------------HESADIVYHLLVLLSMKEMDIDDLRAELAKR 97


>HIS2_DEIRA RecName: Full=Histidine biosynthesis bifunctional
           protein hisIE;Includes:  RecName:
           Full=Phosphoribosyl-AMP cyclohydrolase;
          Length = 218

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 34/103 (33%), Positives = 42/103 (40%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL  G LD VLKK+ EEAGE  LAAK+ +                     ELA   
Sbjct: 137 SYVARLHAGGLDRVLKKISEEAGEVLLAAKNADRA-------------------ELAT-- 175

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                        E AD+++H L  L   G+   + AA L  R
Sbjct: 176 -------------ETADLLFHTLFALAEVGVSPADVAAVLQGR 205


>HIS2_RALPJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 124

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 32/103 (31%), Positives = 43/103 (41%), Gaps = 26/103 (25%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA ET +AAKD                     TDE     
Sbjct: 26  SYIARLFNKGDDAILKKIGEEATETVMAAKDAR---------------AAGMTDE----- 65

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   + YE AD+ +H +V+L  + +  D+   EL  R
Sbjct: 66  ------ARSKVVYEVADLWFHTMVLLSHFDLTPDDVVGELARR 102


>HIS2_NITEC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 117

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  +LL+ + D VLKK+ EEA ET +A KD +                           
Sbjct: 26  SYIAKLLSSNEDKVLKKIAEEAAETIMACKDNDR-------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                   + + YE AD+ +H L++L R+ I  +   +EL  R
Sbjct: 60  --------EQIIYETADLWFHCLIMLARHDISPEAILSELERR 94


>HIS2_THETN RecName: Full=Histidine biosynthesis bifunctional
           protein hisIE;Includes:  RecName:
           Full=Phosphoribosyl-AMP cyclohydrolase;
          Length = 205

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L    +D +LKKV EEA E  +A+K+                   D  DE+    
Sbjct: 134 SYTNYLFEKGIDKILKKVGEEATEVVIASKN-------------------DSKDEIV--- 171

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                       YE +D++YHL+V+L    I L++   EL  R
Sbjct: 172 ------------YEVSDLIYHLMVLLVEKNITLNDIYNELERR 202


>HIS2_STRGC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 104

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 34/109 (31%), Positives = 45/109 (41%), Gaps = 34/109 (31%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L    LD +LKKV EEA E  +AAK+                   D+ +E+A   
Sbjct: 20  SYTSYLYDKGLDKILKKVGEEATEVVIAAKN-------------------DDKNEMA--- 57

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAER 147
                        E AD++YH+ V L   G+ L+E  A L  R     R
Sbjct: 58  ------------NETADLLYHMAVALVETGVSLEEVEAVLQARQGKQSR 94


>HIS2_POLSJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 127

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 34/103 (33%), Positives = 43/103 (41%), Gaps = 26/103 (25%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RLL    D  LKK+ EEA ET +AAKD++                   T EL   L
Sbjct: 28  SYVARLLHRGPDAFLKKIGEEATETVMAAKDLDHG---------------GPTPELRAKL 72

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                        E AD+ +H L+ L  YG+   +  AEL  R
Sbjct: 73  VG-----------EVADLWFHSLIALAHYGLQPADVIAELERR 104


>HIS2_LEPBP RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 92

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L    +D +LKK+ EEAGE  +AAK+                             
Sbjct: 22  SYTAELFRDGVDRILKKIGEEAGEVIIAAKN----------------------------- 52

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           P E +     L +E AD+++HL V++   GI L   A EL  R
Sbjct: 53  PNEKE-----LIHEIADLIFHLEVLMVEKGISLTTIAKELEKR 90


>HIS2_LEPBA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 92

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L    +D +LKK+ EEAGE  +AAK+                             
Sbjct: 22  SYTAELFRDGVDRILKKIGEEAGEVIIAAKN----------------------------- 52

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           P E +     L +E AD+++HL V++   GI L   A EL  R
Sbjct: 53  PNEKE-----LIHEIADLIFHLEVLMVEKGISLTTIAKELEKR 90


>HIS2_HELHP RecName: Full=Histidine biosynthesis bifunctional
           protein hisIE;Includes:  RecName:
           Full=Phosphoribosyl-AMP cyclohydrolase;
          Length = 231

 Score = 42.0 bits (97), Expect = 4e-06
 Identities = 36/117 (30%), Positives = 46/117 (39%), Gaps = 34/117 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  LL   ++G+ KK++EEAGE   A KD                      DE A+  
Sbjct: 149 SYTASLLAKGVNGIGKKIIEEAGELCFALKD---------------------KDEKAI-- 185

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVRLH 155
                       YE AD+ YH+LV L    I  +    EL  RM  +   E   R H
Sbjct: 186 -----------IYECADLFYHILVGLALEHITPERVLQELRRRMGQSGIEEKASRKH 231


>HIS2_NEIG1 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 41.6 bits (96), Expect = 5e-06
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  +LL    D +LKKV+EEAGE  +A+KD +                           
Sbjct: 24  SYVAQLLHKGEDKILKKVIEEAGEVLMASKDKDP-------------------------- 57

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                    HL YE AD+ +H +++L  + +  ++   EL+ R
Sbjct: 58  --------SHLVYEVADLWFHTMILLTHHDLKAEDVLDELSRR 92


>HIS2_METNO RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 41.6 bits (96), Expect = 5e-06
 Identities = 23/42 (54%), Positives = 26/42 (61%)

Query: 112 EAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVR 153
           EAADV+YHLLVVL   GI L+E  AEL  R T +   E   R
Sbjct: 63  EAADVLYHLLVVLAGGGIPLEEVMAELERRTTQSGLAEKAAR 104


>HIS2_METCA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 105

 Score = 41.6 bits (96), Expect = 5e-06
 Identities = 31/103 (30%), Positives = 41/103 (39%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY   L    LD +LKK+ EEA ET +AAKD E                           
Sbjct: 22  SYAASLYAKGLDTILKKIGEEATETVIAAKDGEP-------------------------- 55

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                     + YE AD+ +H  V+L + G+G D+   EL  R
Sbjct: 56  --------GKIVYEMADLWFHCCVLLAQQGLGPDDVLRELGRR 90


>HIS2_LEUMM RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 114

 Score = 41.6 bits (96), Expect = 5e-06
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 35/104 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L    LD +LKKV EE+ E  L AK+                             
Sbjct: 24  SYTDYLYQKGLDKILKKVGEESTEVILGAKNNN--------------------------- 56

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRM 142
                   + L YE +D+++HL+V+L   G+ LD+   EL +R+
Sbjct: 57  --------EELIYETSDLLFHLMVLLVEKGVSLDDIKDELGSRL 92


>HIS2_RHIL3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 23/47 (48%), Positives = 28/47 (59%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVR 153
           D+L YEAADV+YHLLVVL+   I L+   AEL  R   +   E   R
Sbjct: 58  DNLTYEAADVLYHLLVVLKIAEIPLENVMAELERRTAQSGLKEKASR 104


>HIS2_RALEJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 125

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 30/103 (29%), Positives = 42/103 (40%), Gaps = 26/103 (25%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA ET +AAKD                             
Sbjct: 33  SYVARLFRKGDDAILKKIGEEATETVMAAKDARAAG------------------------ 68

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
             +  A  D + YE AD+ +H +V+L  +G+   +   EL  R
Sbjct: 69  --KTGADADKIVYEVADLWFHTMVLLANFGLTPADVVNELARR 109


>HIS2_RHILW RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 40.8 bits (94), Expect = 8e-06
 Identities = 21/35 (60%), Positives = 25/35 (71%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           D+L YEAADV+YHLLVVL+   I L+   AEL  R
Sbjct: 58  DNLTYEAADVLYHLLVVLKIAEIPLENVMAELERR 92


>HIS2_RHIE6 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 40.8 bits (94), Expect = 8e-06
 Identities = 21/35 (60%), Positives = 25/35 (71%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           D+L YEAADV+YHLLVVL+   I L+   AEL  R
Sbjct: 58  DNLTYEAADVLYHLLVVLKIAEIPLENVMAELERR 92


>HIS2_AGRRK RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 104

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVR 153
           D+L YEAAD++YHL+VVL+  GI L     EL  R   +   E   R
Sbjct: 58  DNLTYEAADLLYHLMVVLKIAGIPLQNVMGELERRTAQSGLQEKASR 104


>HIS2_THIDA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 108

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 39/118 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA ET +AAKD                   D+ +++    
Sbjct: 23  SYVARLYAKGTDAILKKIGEEATETVMAAKD-------------------DQAEKII--- 60

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR-----MTDAERPEGG 151
                       YE AD+ +H LV+L   G+   +   EL  R     +T+    +GG
Sbjct: 61  ------------YEVADLWFHTLVLLAHKGLKPADVLEELARREGLSGLTEKANRQGG 106


>HIS2_NEIMF RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  +LL    D +LKKV+EEAGE  +A+KD                             
Sbjct: 24  SYVAQLLHKGEDKILKKVIEEAGEVLMASKDKNP-------------------------- 57

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                    HL YE AD+ +H +++L  + +  ++   EL  R
Sbjct: 58  --------SHLVYEVADLWFHTMILLTHHDLKAEDVLDELARR 92


>HIS2_NEIMB RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  +LL    D +LKKV+EEAGE  +A+KD                             
Sbjct: 24  SYVAQLLHKGEDKILKKVIEEAGEVLMASKDKNP-------------------------- 57

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                    HL YE AD+ +H +++L  + +  ++   EL  R
Sbjct: 58  --------SHLVYEVADLWFHTMILLTHHDLKAEDVLDELARR 92


>HIS2_NEIMA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  +LL    D +LKKV+EEAGE  +A+KD                             
Sbjct: 24  SYVAQLLHKGEDKILKKVIEEAGEVLMASKDKNP-------------------------- 57

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                    HL YE AD+ +H +++L  + +  ++   EL  R
Sbjct: 58  --------SHLVYEVADLWFHTMILLTHHDLKAEDVLDELARR 92


>HIS2_RHOCA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 103

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 108 HLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           +L YEAADV+YHL V+L    + LDE  AEL+ R
Sbjct: 57  NLVYEAADVLYHLTVMLAARDVSLDEVLAELDRR 90


>HIS2_RALEH RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 123

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 29/103 (28%), Positives = 42/103 (40%), Gaps = 26/103 (25%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL +   D +LKK+ EEA ET +AAKD                             
Sbjct: 33  SYVARLFSKGDDAILKKIGEEATETVMAAKDARAAG------------------------ 68

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
             +  A    + YE AD+ +H +V+L  +G+   +   EL  R
Sbjct: 69  --QTGAEAGKVVYEVADLWFHSMVLLANFGLTPADVVNELARR 109


>HIS2_METVS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 96

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 38/108 (35%)

Query: 39  SYTYRLLTG----SLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDEL 94
           SY  +L T     +++ + +K+ EEA ET LAAKD +                       
Sbjct: 22  SYVVKLTTNDKKTAVNKICEKIGEEAAETILAAKDNDK---------------------- 59

Query: 95  AVDLPPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRM 142
                         + YE+AD+++H  V+L ++GI  +E   E   RM
Sbjct: 60  ------------SEIIYESADLIFHTFVLLAKFGISYEELNEEFKKRM 95


>HIS2_ERYLH RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 104

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 32/103 (31%), Positives = 45/103 (43%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL    L  + +KV EEA ET +AA                    +  +DE  V  
Sbjct: 22  SYVARLNAKGLPKMAEKVGEEATETVIAA--------------------LTGSDEELVG- 60

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                        E AD+++HLLV+L+  G+ LD+  AEL+ R
Sbjct: 61  -------------EGADLIFHLLVLLQARGVSLDQVLAELDRR 90


>HIS2_RHOBA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 120

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 108 HLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           H  YEA D++YH +V++   GI LDE AAEL  R
Sbjct: 64  HAIYEAGDLIYHAMVLMAWRGIELDEVAAELARR 97


>HIS2_RHIEC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 21/47 (44%), Positives = 28/47 (59%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVR 153
           ++L YEAAD++YHLLVVL+   I L+   AEL  R   +   E   R
Sbjct: 58  NNLTYEAADLLYHLLVVLKIAEIPLENVMAELERRTAQSGLKEKASR 104


>HIS2_METS5 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 93

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 112 EAADVVYHLLVVLERYGIGLDEFAAELNNRM 142
           E AD++YHLLV+L   GI LDE   EL  RM
Sbjct: 62  ETADLIYHLLVLLAMEGISLDEVRDELRRRM 92


>HIS2_METRJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 109 LRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVR 153
           LR EAADV+YHL+V+L   G+ LD   AEL  R   +   E   R
Sbjct: 60  LRNEAADVLYHLVVLLWAGGVELDAVMAELERRTAQSGIAEKAAR 104


>HIS2_AZOC5 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 109

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 36/115 (31%), Positives = 46/115 (40%), Gaps = 34/115 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  LL   +    +K+ EEA ETALAA                       +D+ AV  
Sbjct: 26  SYTRSLLDKGISKCAQKLGEEAVETALAAVG---------------------SDKAAVIS 64

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAERPEGGVR 153
                        E AD++YHL V+L   G+ LDE  AEL  R   +   E   R
Sbjct: 65  -------------ETADLLYHLAVLLHAKGVELDEVHAELARRTRQSGHEEKASR 106


>HIS2_ALCBS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 111

 Score = 37.7 bits (86), Expect = 7e-05
 Identities = 33/103 (32%), Positives = 44/103 (42%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY   L    L+ +L+KV EEA ET LAA+D E                          +
Sbjct: 23  SYVASLYAKGLNKILEKVGEEAIETILAARDAE--------------------------V 56

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
             E+ A I     E AD+ +H LV+L + G   D+  AEL  R
Sbjct: 57  SGEHQALIS----ETADLWFHSLVMLAKLGEHPDKVLAELQRR 95


>HIS2_BURM1 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPSALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_BURCH RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPSALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_BURCA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPSALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_LEPBL RecName: Full=Phosphoribosyl-ATP pyrophosphatase;     
             Short=PRA-PH;         EC=3.6.1.31;
          Length = 92

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 39 SYTYRLLTGSLDGVLKKVMEEAGETALAAKD 69
          SYT  L  G +D +LKKV EEAGE  +AAK+
Sbjct: 22 SYTADLFRGGVDRILKKVGEEAGEVIIAAKN 52


>HIS2_LEPBJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;     
             Short=PRA-PH;         EC=3.6.1.31;
          Length = 92

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 39 SYTYRLLTGSLDGVLKKVMEEAGETALAAKD 69
          SYT  L  G +D +LKKV EEAGE  +AAK+
Sbjct: 22 SYTADLFRGGVDRILKKVGEEAGEVIIAAKN 52


>HIS2_BURVG RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_BURTA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURS3 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_BURCJ RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_BURCC RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 39/103 (37%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +  AEL  R
Sbjct: 59  --RQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIAELERR 99


>HIS2_BURPS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURP6 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURP1 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURP0 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURMS RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURMA RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURM9 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BURM7 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 122

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D +LKK+ EEA E  LAAKDV                            
Sbjct: 28  SYVSRLFHKGDDAILKKIGEEATEVVLAAKDV---------------------------- 59

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV L  + +   +  AEL  R
Sbjct: 60  --RQGGAPSALVGEVADLWFHCLVALSHFDLSPADVIAELERR 100


>HIS2_BACTN RecName: Full=Histidine biosynthesis bifunctional
           protein hisIE;Includes:  RecName:
           Full=Phosphoribosyl-AMP cyclohydrolase;
          Length = 203

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 34/103 (33%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SYT  L    ++ + +KV EEA ET + A +                             
Sbjct: 127 SYTTSLFESGINKIAQKVGEEAVETVIEATN----------------------------- 157

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                   + L YE AD++YH++V+L   G  +++ A EL  R
Sbjct: 158 -----GTNERLIYEGADLIYHMIVLLTSKGYRIEDLARELQER 195


>HIS2_AGRT5 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 107

 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           D L+ EAAD++YHLLVVL+   I L +  AEL  R
Sbjct: 58  DGLKNEAADLLYHLLVVLKIADIPLSDVFAELERR 92


>HIS2_IGNH4 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 102

 Score = 35.8 bits (81), Expect = 3e-04
 Identities = 17/35 (48%), Positives = 22/35 (62%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           D + YEAADV+YHL+V+L   G+   E   EL  R
Sbjct: 57  DSVIYEAADVIYHLMVLLALRGVDWAEVIKELERR 91


>HIS2_METBF RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 104

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 112 EAADVVYHLLVVLERYGIGLDEFAAELNNRMTDAER 147
           E++D+++HLLV+L    + LDE AAEL+ R    +R
Sbjct: 68  ESSDLIFHLLVMLAANNVTLDEIAAELSARHESMKR 103


>HIS2_MESSB RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 112

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 112 EAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           E+AD+VYH LVVL+  G+ LDE   EL +R
Sbjct: 63  ESADLVYHWLVVLKIAGVRLDEVMLELESR 92


>HIS2_GLOVI RecName: Full=Histidine biosynthesis bifunctional
           protein hisIE;Includes:  RecName:
           Full=Phosphoribosyl-AMP cyclohydrolase;
          Length = 218

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVE 71
           SYT RLL    + +LKK+ EEA E  +AAKD E
Sbjct: 150 SYTSRLLEAGSNKILKKIGEEATEVVMAAKDGE 182


>HIS2_BURCM RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +   EL  R
Sbjct: 59  --RQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIGELERR 99


>HIS2_BURA4 RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 121

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 30/103 (29%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKDVEXXXXXXXXXXXXXXXXVDETDELAVDL 98
           SY  RL     D VLKK+ EEA E  LAAKDV                            
Sbjct: 27  SYVSRLFHKGDDAVLKKIGEEATEVVLAAKDV---------------------------- 58

Query: 99  PPEYDAAIDHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
                 A   L  E AD+ +H LV+L  + +   +   EL  R
Sbjct: 59  --RQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIGELERR 99


>HIS21_BRAJA RecName: Full=Phosphoribosyl-ATP pyrophosphatase 1;    
               Short=PRA-PH 1;         EC=3.6.1.31;
          Length = 106

 Score = 35.0 bits (79), Expect = 5e-04
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 108 HLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           HL  E AD++YH LV+L+  GI L+E  A L  R
Sbjct: 59  HLIAEGADLLYHFLVLLKARGIKLEEVEAALGKR 92


>HIS2_THET2 RecName: Full=Histidine biosynthesis bifunctional
           protein hisIE;Includes:  RecName:
           Full=Phosphoribosyl-AMP cyclohydrolase;
          Length = 214

 Score = 34.7 bits (78), Expect = 6e-04
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 39  SYTYRLLTGSLDGVLKKVMEEAGETALAAKD 69
           SY  R+    LD +LKK+ EEAGE  LAAK+
Sbjct: 133 SYVARMHHAGLDRILKKIGEEAGEVILAAKN 163


>HIS2_ROSDO RecName: Full=Phosphoribosyl-ATP pyrophosphatase;       
            Short=PRA-PH;         EC=3.6.1.31;
          Length = 105

 Score = 34.7 bits (78), Expect = 6e-04
 Identities = 18/35 (51%), Positives = 22/35 (62%)

Query: 107 DHLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           D L  EAADV+YHLLV+L    + L +  AEL  R
Sbjct: 55  DALTGEAADVLYHLLVMLAACDVDLKDVLAELERR 89


>HIS21_RHOPA RecName: Full=Phosphoribosyl-ATP pyrophosphatase 1;    
               Short=PRA-PH 1;         EC=3.6.1.31;
          Length = 107

 Score = 34.3 bits (77), Expect = 8e-04
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 108 HLRYEAADVVYHLLVVLERYGIGLDEFAAELNNR 141
           HL  E ADV++H+LV+L+  G+ L+E  A L  R
Sbjct: 59  HLISETADVLFHMLVLLKSRGVKLEEVEAALAQR 92


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.320    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,274,963,594
Number of extensions: 408852682
Number of successful extensions: 1069722
Number of sequences better than 1.0e-03: 23038
Number of HSP's gapped: 1024976
Number of HSP's successfully gapped: 37229
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)