BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV55587.1 elen0 ACV55587.1 GIB01015CH01 "recA protein"
         (352 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

RECA_HELMI RecName: Full=Protein recA;AltName: Full=Recombinase A;    373   e-105
RECA_CLOAB RecName: Full=Protein recA;AltName: Full=Recombinase A;    373   e-105
RECA_AMYMD RecName: Full=Protein recA;AltName: Full=Recombinase A;    372   e-105
RECA_CLOPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    370   e-105
RECA_CLOPE RecName: Full=Protein recA;AltName: Full=Recombinase A;    369   e-104
RECA_CLOP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    369   e-104
RECA_CHLSY RecName: Full=Protein recA;AltName: Full=Recombinase A;    369   e-104
RECA_CHLAA RecName: Full=Protein recA;AltName: Full=Recombinase A;    369   e-104
RECA_RHILW RecName: Full=Protein recA;AltName: Full=Recombinase A;    369   e-104
RECA_RHIL3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    369   e-104
RECA_AGRRK RecName: Full=Protein recA;AltName: Full=Recombinase A;    368   e-104
RECA_RHIE6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    366   e-103
RECA_LISWE RecName: Full=Protein recA;AltName: Full=Recombinase A;    366   e-103
RECA_LISW6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    366   e-103
RECA_LISSE RecName: Full=Protein recA;AltName: Full=Recombinase A;    366   e-103
RECA_LISIV RecName: Full=Protein recA;AltName: Full=Recombinase A;    366   e-103
RECA_RHILO RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_LISMO RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_LISMH RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_LISMF RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_LISMC RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_LISIN RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_RHIET RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_OCHA4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    365   e-103
RECA_CLOBA RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUSU RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUME RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUMB RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUC2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUAB RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_BRUA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    364   e-103
RECA_CLOBB RecName: Full=Protein recA;AltName: Full=Recombinase A;    363   e-103
RECA_DICNV RecName: Full=Protein recA;AltName: Full=Recombinase A;    363   e-102
RECA_BRUSI RecName: Full=Protein recA;AltName: Full=Recombinase A;    363   e-102
RECA_BREBN RecName: Full=Protein recA;AltName: Full=Recombinase A;    363   e-102
RECA_BIFLO RecName: Full=Protein recA;AltName: Full=Recombinase A;    363   e-102
RECA_CLOTE RecName: Full=Protein recA;AltName: Full=Recombinase A;    362   e-102
RECA_RHILV RecName: Full=Protein recA;AltName: Full=Recombinase A;    362   e-102
RECA_BIFBR RecName: Full=Protein recA;AltName: Full=Recombinase A;    362   e-102
RECA_BACCN RecName: Full=Protein recA;AltName: Full=Recombinase A;    362   e-102
RECA_CHLAD RecName: Full=Protein recA;AltName: Full=Recombinase A;    361   e-102
RECA_GEOSL RecName: Full=Protein recA;AltName: Full=Recombinase A;    361   e-102
RECA_STRLI RecName: Full=Protein recA;AltName: Full=Recombinase A;    360   e-101
RECA_STRCO RecName: Full=Protein recA;AltName: Full=Recombinase A;    360   e-101
RECA_STRAM RecName: Full=Protein recA;AltName: Full=Recombinase A;    360   e-101
RECA_RHOE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    360   e-101
RECA_AGRVS RecName: Full=Protein recA;AltName: Full=Recombinase A;    360   e-101
RECA_STRRM RecName: Full=Protein recA;AltName: Full=Recombinase A;    359   e-101
RECA_CLOB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    359   e-101
RECA_HERA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    359   e-101
RECA_BACLI RecName: Full=Protein recA;AltName: Full=Recombinase A;    359   e-101
RECA_BACLD RecName: Full=Protein recA;AltName: Full=Recombinase A;    359   e-101
RECA_NITWN RecName: Full=Protein recA;AltName: Full=Recombinase A;    358   e-101
RECA_BACP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    358   e-101
RECA_SACEN RecName: Full=Protein recA;AltName: Full=Recombinase A;    358   e-101
RECA_NOCSJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    358   e-101
RECA_MESSB RecName: Full=Protein recA;AltName: Full=Recombinase A;    358   e-101
RECA_SYNAS RecName: Full=Protein recA;AltName: Full=Recombinase A;    357   e-101
RECA_BACSU RecName: Full=Protein recA;AltName: Full=Recombinase A;    357   e-101
RECA_RHOPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    357   e-100
RECA_CHRVI RecName: Full=Protein recA;AltName: Full=Recombinase A;    357   e-100
RECA_BACA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    356   e-100
RECA_ARTAT RecName: Full=Protein recA;AltName: Full=Recombinase A;    356   e-100
RECA_OCEIH RecName: Full=Protein recA;AltName: Full=Recombinase A;    356   e-100
RECA_NITHX RecName: Full=Protein recA;AltName: Full=Recombinase A;    356   e-100
RECA_METNO RecName: Full=Protein recA;AltName: Full=Recombinase A;    356   e-100
RECA_SALAI RecName: Full=Protein recA;AltName: Full=Recombinase A;    355   e-100
RECA_PROAC RecName: Full=Protein recA;AltName: Full=Recombinase A;    355   e-100
RECA_BACWK RecName: Full=Protein recA;AltName: Full=Recombinase A;    355   e-100
RECA_SALTO RecName: Full=Protein recA;AltName: Full=Recombinase A;    355   e-100
RECA_CORU7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    355   e-100
RECA_GEOMG RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACCR RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACC4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACC3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACC2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACC1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACAN RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACAH RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_PORGI RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_PORG3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACTN RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_BACFR RecName: Full=Protein recA;AltName: Full=Recombinase A;    354   e-100
RECA_THICR RecName: Full=Protein recA;AltName: Full=Recombinase A;    353   e-99 
RECA_SYMTH RecName: Full=Protein recA;AltName: Full=Recombinase A;    353   e-99 
RECA_EXISA RecName: Full=Protein recA;AltName: Full=Recombinase A;    353   1e-99
RECA_BACSK RecName: Full=Protein recA;AltName: Full=Recombinase A;    353   1e-99
RECA_SYNFM RecName: Full=Protein recA;AltName: Full=Recombinase A;    352   2e-99
RECA_KINRD RecName: Full=Protein recA;AltName: Full=Recombinase A;    352   2e-99
RECA_ARTCA RecName: Full=Protein recA;AltName: Full=Recombinase A;    352   2e-99
RECA_THETN RecName: Full=Protein recA;AltName: Full=Recombinase A;    351   5e-99
RECA_MAGSA RecName: Full=Protein recA;AltName: Full=Recombinase A;    351   5e-99
RECA_ALTMD RecName: Full=Protein recA;AltName: Full=Recombinase A;    351   5e-99
RECA_METRJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    351   6e-99
RECA_ACIC1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    351   6e-99
RECA_PROMI RecName: Full=Protein recA;AltName: Full=Recombinase A;    350   8e-99
RECA_PROMH RecName: Full=Protein recA;AltName: Full=Recombinase A;    350   8e-99
RECA_MACCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    350   8e-99
RECA_ARTS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    350   1e-98
RECA_GLUOX RecName: Full=Protein recA;AltName: Full=Recombinase A;    350   1e-98
RECA_CLAM3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    350   1e-98
RECA_PRERU RecName: Full=Protein recA;AltName: Full=Recombinase A;    349   2e-98
RECA_BORPD RecName: Full=Protein recA;AltName: Full=Recombinase A;    349   2e-98
RECA_MYCA9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    349   2e-98
RECA_ENTFA RecName: Full=Protein recA;AltName: Full=Recombinase A;    349   2e-98
RECA_LACPL RecName: Full=Protein recA;AltName: Full=Recombinase A;    348   4e-98
RECA_EXIS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    348   4e-98
RECA_XYLFA RecName: Full=Protein recA;AltName: Full=Recombinase A;    348   5e-98
RECA_AGRT5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    348   5e-98
RECA_ERWCA RecName: Full=Protein recA;AltName: Full=Recombinase A;    347   7e-98
RECA_BACHD RecName: Full=Protein recA;AltName: Full=Recombinase A;    347   7e-98
RECA_STRMK RecName: Full=Protein recA;AltName: Full=Recombinase A;    347   9e-98
RECA_METCL RecName: Full=Protein recA;AltName: Full=Recombinase A;    347   9e-98
RECA_STAS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    347   1e-97
RECA_XYLFM RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_GEOSM RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_GEOBB RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_XYLFT RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_XYLF2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_COXBU RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_BARHE RecName: Full=Protein recA;AltName: Full=Recombinase A;    346   2e-97
RECA_CHLTE RecName: Full=Protein recA;AltName: Full=Recombinase A;    344   6e-97
RECA_LEPIN RecName: Full=Protein recA;AltName: Full=Recombinase A;    344   8e-97
RECA_LEPIC RecName: Full=Protein recA;AltName: Full=Recombinase A;    344   8e-97
RECA_STRM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   1e-96
RECA_STACT RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   1e-96
RECA_LEPME RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   1e-96
RECA_BORPE RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   1e-96
RECA_BORPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   1e-96
RECA_BORBR RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   1e-96
RECA_PSEA6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   2e-96
RECA_DESAH RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   2e-96
RECA_CORA7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    343   2e-96
RECA_LACPE RecName: Full=Protein recA;AltName: Full=Recombinase A;    342   2e-96
RECA_CHLP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    342   2e-96
RECA_ACHLI RecName: Full=Protein recA;AltName: Full=Recombinase A;    342   2e-96
RECA_DELAS RecName: Full=Protein recA;AltName: Full=Recombinase A;    342   3e-96
RECA_ACHLA RecName: Full=Protein recA;AltName: Full=Recombinase A;    342   4e-96
RECA_XANCP RecName: Full=Protein recA;AltName: Full=Recombinase A;    341   5e-96
RECA_XANCB RecName: Full=Protein recA;AltName: Full=Recombinase A;    341   5e-96
RECA_XANC8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    341   5e-96
RECA_PSEOL RecName: Full=Protein recA;AltName: Full=Recombinase A;    341   7e-96
RECA_METPP RecName: Full=Protein recA;AltName: Full=Recombinase A;    341   7e-96
RECA_LEIXX RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   8e-96
RECA_ALHEH RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   8e-96
RECA_SERMA RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   1e-95
RECA_CHLL2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   1e-95
RECA_STAHJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   1e-95
RECA_CITK8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   1e-95
RECA_CHLCH RecName: Full=Protein recA;AltName: Full=Recombinase A;    340   1e-95
RECA_SHISS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SHISO RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SHIFL RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SHIF8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SHIDS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SHIBS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SHIB3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALTY RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALTI RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALSV RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALPK RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALPC RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALPB RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALNS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALHS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALG2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALEP RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALDC RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALCH RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_SALA4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ESCF3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ENT38 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOUT RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOSM RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOSE RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOLU RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOLI RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOLC RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOL6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOL5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOHS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECOBW RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO8A RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO81 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO7I RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO5E RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO57 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO55 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO45 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO27 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_ECO24 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_BRAJA RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_YERPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_YERPB RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_YERP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_XANOR RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_XANOP RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_XANOM RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAW RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAU RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAT RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAS RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAR RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAN RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAM RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAE RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAC RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAAB RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAA9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_STAA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_RHIEC RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_PHOLL RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_MAGMG RecName: Full=Protein recA;AltName: Full=Recombinase A;    339   2e-95
RECA_RHIME RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   3e-95
RECA_MANSM RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   3e-95
RECA_LACJO RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   3e-95
RECA_ERWCT RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   3e-95
RECA_YERPP RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_XENBV RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_VIBCH RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_STAES RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_STAEQ RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_MARAV RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_KLEP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_KLEP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_ENTS8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_DESPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA_AERHH RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   4e-95
RECA2_MYXXA RecName: Full=Protein recA 2;AltName: Full=Recombina...   338   4e-95
RECA_SHEAM RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   6e-95
RECA_PECCP RecName: Full=Protein recA;AltName: Full=Recombinase A;    338   6e-95
RECA_SHEDO RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   7e-95
RECA_RHISN RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   7e-95
RECA_BDEBA RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   7e-95
RECA_VIBC3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   9e-95
RECA_VIBAN RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   9e-95
RECA_SINMW RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   9e-95
RECA_YERPY RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_YERPN RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_YERPG RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_YERPE RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_YERPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_VIBVY RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_VIBVU RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_TOLAT RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_SHEWM RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_SHEHH RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_LEPBP RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_LEPBA RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_LACBA RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_CLONN RecName: Full=Protein recA;AltName: Full=Recombinase A;    337   1e-94
RECA_YERE8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    336   2e-94
RECA_SHELP RecName: Full=Protein recA;AltName: Full=Recombinase A;    336   2e-94
RECA_SERP5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    336   2e-94
RECA_VIBPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    336   2e-94
RECA_SHEPW RecName: Full=Protein recA;AltName: Full=Recombinase A;    336   2e-94
RECA_CORJK RecName: Full=Protein recA;AltName: Full=Recombinase A;    336   2e-94
RECA_LACRJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   3e-94
RECA_LACRD RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   3e-94
RECA_TROWT RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   4e-94
RECA_TROW8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   4e-94
RECA_LACSS RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   4e-94
RECA_ENTAG RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   4e-94
RECA_EDWI9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   4e-94
RECA_BARQU RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   4e-94
RECA_XANC5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   5e-94
RECA_SHESW RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   5e-94
RECA_SHESA RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   5e-94
RECA_SHEPC RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   5e-94
RECA_SHEON RecName: Full=Protein recA;AltName: Full=Recombinase A;    335   5e-94
RECA_ACICJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    334   6e-94
RECA_ERWT9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    334   8e-94
RECA_SHEB9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   1e-93
RECA_SHEB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   1e-93
RECA_SHEB5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   1e-93
RECA_SHEB2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   1e-93
RECA_RICB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   1e-93
RECA_XANCI RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_XANAC RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_TERTT RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_STRAW RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_SHESR RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_SHESM RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_ENTGA RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_BART1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    333   2e-93
RECA_SHEFN RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   2e-93
RECA_SACD2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   2e-93
RECA_ENTHR RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   2e-93
RECA_CLOD6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   2e-93
RECA_CHLT3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   2e-93
RECA_RICTY RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   3e-93
RECA_METS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   3e-93
RECA_ENTMU RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   3e-93
RECA_AERS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   3e-93
RECA_ROSS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   4e-93
RECA_RHORT RecName: Full=Protein recA;AltName: Full=Recombinase A;    332   4e-93
RECA_SODGM RecName: Full=Protein recA;AltName: Full=Recombinase A;    331   5e-93
RECA_SODGL RecName: Full=Protein recA;AltName: Full=Recombinase A;    331   5e-93
RECA_RICPR RecName: Full=Protein recA;AltName: Full=Recombinase A;    331   5e-93
RECA_DESDG RecName: Full=Protein recA;AltName: Full=Recombinase A;    331   5e-93
RECA_SULNB RecName: Full=Protein recA;AltName: Full=Recombinase A;    331   7e-93
RECA_XENNE RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   9e-93
RECA_THISH RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   9e-93
RECA_STRVL RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   9e-93
RECA_LACF3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   9e-93
RECA_ALISL RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   1e-92
RECA_VIBNA RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   1e-92
RECA_ROSCS RecName: Full=Protein recA;AltName: Full=Recombinase A;    330   1e-92
RECA_SHESH RecName: Full=Protein recA;AltName: Full=Recombinase A;    329   2e-92
RECA_METCA RecName: Full=Protein recA;AltName: Full=Recombinase A;    329   2e-92
RECA_RALEJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    329   3e-92
RECA_RHOCA RecName: Full=Protein recA;AltName: Full=Recombinase A;    328   3e-92
RECA_JANMA RecName: Full=Protein recA;AltName: Full=Recombinase A;    328   4e-92
RECA_HAES2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    328   4e-92
RECA_HAES1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    328   4e-92
RECA_NAUPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    328   6e-92
RECA_RICFE RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_RICCK RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_PROVU RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_HAEIN RecName: Full=Protein recA;AltName: Full=Recombinase ...   327   7e-92
RECA_HAEIG RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_HAEIE RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_HAEI8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_CORGL RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_CORGB RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   7e-92
RECA_FRATW RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRATT RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRATO RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRATN RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRATM RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRATH RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRATF RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRAT1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_FRAP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_ENTFC RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_AQUPY RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_ACTAC RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_ACIAD RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_VIBFM RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_VIBF1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_NITEC RecName: Full=Protein recA;AltName: Full=Recombinase A;    327   1e-91
RECA_RHOOB RecName: Full=Protein recA;AltName: Full=Recombinase A;    326   2e-91
RECA_NITSB RecName: Full=Protein recA;AltName: Full=Recombinase A;    326   2e-91
RECA_COREF RecName: Full=Protein recA;AltName: Full=Recombinase A;    326   2e-91
RECA_CUPTR RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   3e-91
RECA_BARBK RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   3e-91
RECA_RICAE RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   4e-91
RECA_RALEH RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   4e-91
RECA_CHLTR RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   4e-91
RECA_CHLTB RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   4e-91
RECA_CHLT2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   4e-91
RECA_CHLMU RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   4e-91
RECA_RICCN RecName: Full=Protein recA;AltName: Full=Recombinase A;    325   5e-91
RECA_RHOS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   6e-91
RECA_RHOS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   6e-91
RECA_RHOSR RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   8e-91
RECA_RHOS5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   8e-91
RECA_HAMD5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   8e-91
RECA_CHLFF RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   8e-91
RECA_AZOLI RecName: Full=Protein recA;AltName: Full=Recombinase A;    324   8e-91
RECA_SYNP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_LEGPN RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_IDILO RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_HELHP RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_CHRVO RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_LEGPH RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_LEGPC RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_LEGPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_CHLTA RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   1e-90
RECA_CORDI RecName: Full=Protein recA;AltName: Full=Recombinase A;    323   2e-90
RECA_DECAR RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_ACIBY RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_ACIBT RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_ACIBS RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_ACIBC RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_ACIB5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_ACIB3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   2e-90
RECA_RHOCS RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   3e-90
RECA_LEGPL RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   3e-90
RECA_CORPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   3e-90
RECA_RICPU RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   4e-90
RECA_RHOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   4e-90
RECA_NOCFA RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   4e-90
RECA_MYCS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   4e-90
RECA_MYCGI RecName: Full=Protein recA;AltName: Full=Recombinase A;    322   4e-90
RECA_POLNA RecName: Full=Protein recA;AltName: Full=Recombinase A;    320   9e-90
RECA_BAUCH RecName: Full=Protein recA;AltName: Full=Recombinase A;    320   9e-90
RECA_AQUAE RecName: Full=Protein recA;AltName: Full=Recombinase A;    320   9e-90
RECA_DEIGD RecName: Full=Protein recA;AltName: Full=Recombinase A;    320   1e-89
RECA_RALME RecName: Full=Protein recA;AltName: Full=Recombinase A;    319   2e-89
RECA_FRAAA RecName: Full=Protein recA;AltName: Full=Recombinase A;    319   2e-89
RECA_DESVV RecName: Full=Protein recA;AltName: Full=Recombinase A;    319   2e-89
RECA_DESVH RecName: Full=Protein recA;AltName: Full=Recombinase A;    319   2e-89
RECA_CYAP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    319   2e-89
RECA_CHLCV RecName: Full=Protein recA;AltName: Full=Recombinase A;    319   3e-89
RECA_CHRSD RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   3e-89
RECA_STRGC RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   5e-89
RECA_MYCVP RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   5e-89
RECA_CAMLR RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   5e-89
RECA_ANAMF RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   5e-89
RECA_RALEU RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   6e-89
RECA_NITEU RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   6e-89
RECA_CHLPN RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   6e-89
RECA_ANAMM RecName: Full=Protein recA;AltName: Full=Recombinase A;    318   6e-89
RECA_NEIMF RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   8e-89
RECA_NEIGO RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_NEIG2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_NEIG1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_WOLWR RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_WOLPM RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_PASMU RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_NEIMA RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_AZOSE RecName: Full=Protein recA;AltName: Full=Recombinase A;    317   1e-88
RECA_WIGBR RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_MYCSS RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_MYCSK RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_MYCSJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAUCR RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAUCN RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_SILPO RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_NEIMB RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_LACAC RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_HERSE RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAMLA RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAMJR RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAMJJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAMJE RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_CAMJ8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    316   2e-88
RECA_RUBXD RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   3e-88
RECA_TREDE RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRZT RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRZP RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRZJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRR6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRPN RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRPJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRPI RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRP4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_HERAR RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_GLOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   4e-88
RECA_STRU0 RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_NITMU RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_HALHL RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_EHRRW RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_EHRRG RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_DESDA RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_DEIRA RecName: Full=Protein recA;AltName: Full=Recombinase A;    315   5e-88
RECA_ZYMMO RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRPG RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRPC RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRPB RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRP6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRA5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_STRA3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_RHOBA RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_BORA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   7e-88
RECA_WOLPP RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   9e-88
RECA_MYCPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   9e-88
RECA_MYCA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   9e-88
RECA_COLP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    314   9e-88
RECA_STRMU RecName: Full=Protein recA;AltName: Full=Recombinase A;    313   1e-87
RECA_STRPM RecName: Full=Protein recA;AltName: Full=Recombinase A;    313   1e-87
RECA_STRPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    313   1e-87
RECA_STRP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    313   1e-87
RECA_MYCMM RecName: Full=Protein recA;AltName: Full=Recombinase A;    313   2e-87
RECA_STRPF RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   2e-87
RECA_STRPD RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   2e-87
RECA_STRP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   2e-87
RECA_STREM RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   2e-87
RECA_SHEPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   2e-87
RECA_PARDE RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   2e-87
RECA_STRS7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   3e-87
RECA_STRE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   3e-87
RECA_MYCUA RecName: Full=Protein recA;AltName: Full=Recombinase A;    312   3e-87
RECA_PASHA RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   4e-87
RECA_ACEPO RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   4e-87
RECA_TREPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   6e-87
RECA_TREPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   6e-87
RECA_STRPZ RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   6e-87
RECA_PARL1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   6e-87
RECA_CAUSK RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   6e-87
RECA_BURS3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   6e-87
RECA_EHRCR RecName: Full=Protein recA;AltName: Full=Recombinase A;    311   7e-87
RECA_LACDB RecName: Full=Protein recA;AltName: Full=Recombinase A;    310   9e-87
RECA_STRSV RecName: Full=Protein recA;AltName: Full=Recombinase A;    310   1e-86
RECA_AZOSB RecName: Full=Protein recA;AltName: Full=Recombinase A;    310   1e-86
RECA_LACLS RecName: Full=Protein recA;AltName: Full=Recombinase A;    310   2e-86
RECA_LACLM RecName: Full=Protein recA;AltName: Full=Recombinase A;    310   2e-86
RECA_LACLC RecName: Full=Protein recA;AltName: Full=Recombinase A;    310   2e-86
RECA1_LACLA RecName: Full=Protein recA, chromosomal;AltName: Ful...   310   2e-86
RECA_STRAG RecName: Full=Protein recA;AltName: Full=Recombinase A;    309   2e-86
RECA_BURCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    309   2e-86
RECA_BURCE RecName: Full=Protein recA;AltName: Full=Recombinase A;    309   2e-86
RECA_CYTH3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    309   3e-86
RECA_PSEAE RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   4e-86
RECA_PSEAB RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   4e-86
RECA_PSEA8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   4e-86
RECA_PSEA7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   4e-86
RECA_EHRCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   4e-86
RECA_RICBR RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   5e-86
RECA_BURM1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   5e-86
RECA_PSEPW RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   6e-86
RECA_LACDA RecName: Full=Protein recA;AltName: Full=Recombinase A;    308   6e-86
RECA_STRTD RecName: Full=Protein recA;AltName: Full=Recombinase A;    307   1e-85
RECA_STRT2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    307   1e-85
RECA_PSEE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    307   1e-85
RECA_HAHCH RecName: Full=Protein recA;AltName: Full=Recombinase A;    307   1e-85
RECA_AZOVD RecName: Full=Protein recA;AltName: Full=Recombinase A;    307   1e-85
RECA_THEM4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   1e-85
RECA_STRT1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   1e-85
RECA_PSEPK RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   1e-85
RECA_PSEPG RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   1e-85
RECA_PSEP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   1e-85
RECA_METFK RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   2e-85
RECA_BURPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   2e-85
RECA_BURMA RecName: Full=Protein recA;AltName: Full=Recombinase A;    306   2e-85
RECA_PSEST RecName: Full=Protein recA;AltName: Full=Recombinase A;    305   3e-85
RECA_PSEPU RecName: Full=Protein recA;AltName: Full=Recombinase A;    305   4e-85
RECA_CAMHC RecName: Full=Protein recA;AltName: Full=Recombinase A;    305   4e-85
RECA_BORDL RecName: Full=Protein recA;AltName: Full=Recombinase A;    305   4e-85
RECA_HELPH RecName: Full=Protein recA;AltName: Full=Recombinase A;    305   5e-85
RECA_AZOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;    305   5e-85
RECA_WOLTR RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   7e-85
RECA_SYNP6 RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   7e-85
RECA_SYNE7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   7e-85
RECA_CHLAB RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   7e-85
RECA_ACIF5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   7e-85
RECA_ACIF2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   7e-85
RECA_HELPY RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   9e-85
RECA_HELPG RecName: Full=Protein recA;AltName: Full=Recombinase A;    304   9e-85
RECA_STRTR RecName: Full=Protein recA;AltName: Full=Recombinase A;    303   1e-84
RECA_PHOPR RecName: Full=Protein recA;AltName: Full=Recombinase A;    303   1e-84
RECA_OENOB RecName: Full=Protein recA;AltName: Full=Recombinase A;    303   1e-84
RECA_BORHE RecName: Full=Protein recA;AltName: Full=Recombinase A;    303   2e-84
RECA_BORHD RecName: Full=Protein recA;AltName: Full=Recombinase A;    303   2e-84
RECA_PSYWF RecName: Full=Protein recA;AltName: Full=Recombinase A;    302   3e-84
RECA_METFL RecName: Full=Protein recA;AltName: Full=Recombinase A;    302   3e-84
RECA_HELP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    302   3e-84
RECA_RICM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    301   4e-84
RECA_HELPS RecName: Full=Protein recA;AltName: Full=Recombinase A;    301   4e-84
RECA_BORBZ RecName: Full=Protein recA;AltName: Full=Recombinase A;    301   4e-84
RECA_BORBU RecName: Full=Protein recA;AltName: Full=Recombinase A;    301   4e-84
RECA_HELAH RecName: Full=Protein recA;AltName: Full=Recombinase A;    301   6e-84
RECA_DESVM RecName: Full=Protein recA;AltName: Full=Recombinase A;    300   1e-83
RECA_PSEU2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    300   1e-83
RECA_HELPJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    300   2e-83
RECAM_DICDI RecName: Full=Mitochondrial DNA repair protein recA ...   300   2e-83
RECA_THIFE RecName: Full=Protein recA;AltName: Full=Recombinase A;    299   2e-83
RECA_PSESM RecName: Full=Protein recA;AltName: Full=Recombinase A;    299   2e-83
RECA_PSE14 RecName: Full=Protein recA;AltName: Full=Recombinase A;    299   2e-83
RECA_PSYCK RecName: Full=Protein recA;AltName: Full=Recombinase A;    299   3e-83
RECA_THEAQ RecName: Full=Protein recA;AltName: Full=Recombinase A;    298   4e-83
RECA_SYNSC RecName: Full=Protein recA;AltName: Full=Recombinase A;    298   4e-83
RECA_LARHH RecName: Full=Protein recA;AltName: Full=Recombinase A;    298   4e-83
RECA_DESMR RecName: Full=Protein recA;AltName: Full=Recombinase A;    298   4e-83
RECA_THEEB RecName: Full=Protein recA;AltName: Full=Recombinase A;    298   6e-83
RECA_SYNS9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    297   8e-83
RECA_PSEFL RecName: Full=Protein recA;AltName: Full=Recombinase A;    297   8e-83
RECA_THENN RecName: Full=Protein recA;AltName: Full=Recombinase A;    297   1e-82
RECA_PSETO RecName: Full=Protein recA;AltName: Full=Recombinase A;    297   1e-82
RECA_PSEFS RecName: Full=Protein recA;AltName: Full=Recombinase A;    297   1e-82
RECA_PROMA RecName: Full=Protein recA;AltName: Full=Recombinase A;    297   1e-82
RECA_SPIPL RecName: Full=Protein recA;AltName: Full=Recombinase A;    296   1e-82
RECAC_ARATH RecName: Full=DNA repair protein recA homolog 1, chl...   296   1e-82
RECA_THESQ RecName: Full=Protein recA;AltName: Full=Recombinase A;    296   2e-82
RECA_THEMA RecName: Full=Protein recA;AltName: Full=Recombinase A;    296   2e-82
RECA_WOLSU RecName: Full=Protein recA;AltName: Full=Recombinase A;    296   2e-82
RECA_THEP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    296   2e-82
RECA_NOSP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    296   2e-82
RECA1_MYXXA RecName: Full=Protein recA 1;AltName: Full=Recombina...   296   2e-82
RECA_PSEF5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    295   3e-82
RECA_BORT9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    295   3e-82
RECA_PETMO RecName: Full=Protein recA;AltName: Full=Recombinase A;    295   4e-82
RECA_CYAP4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    295   4e-82
RECA_BORAP RecName: Full=Protein recA;AltName: Full=Recombinase A;    294   7e-82
RECA_SYNPX RecName: Full=Protein recA;AltName: Full=Recombinase A;    293   2e-81
RECA_PROM4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    293   2e-81
RECA_HAEDU RecName: Full=Protein recA;AltName: Full=Recombinase A;    293   2e-81
RECA_PSYA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    292   3e-81
RECA_PSEPF RecName: Full=Protein recA;AltName: Full=Recombinase A;    292   3e-81
RECA_ANAVT RecName: Full=Protein recA;AltName: Full=Recombinase A;    292   3e-81
RECA_SYNS3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    291   5e-81
RECA_SYNPW RecName: Full=Protein recA;AltName: Full=Recombinase A;    291   5e-81
RECA_ANASP RecName: Full=Protein recA;AltName: Full=Recombinase A;    291   5e-81
RECA_CYAA5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    291   6e-81
RECA_SULDN RecName: Full=Protein recA;AltName: Full=Recombinase A;    290   2e-80
RECA_PROMM RecName: Full=Protein recA;AltName: Full=Recombinase A;    289   2e-80
RECA_PROM3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    289   2e-80
RECA_THET2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    289   3e-80
RECA_THET8 RecName: Full=Protein recA;AltName: Full=Recombinase A;    288   4e-80
RECA_CAMFF RecName: Full=Protein recA;AltName: Full=Recombinase A;    288   4e-80
RECA_CAMFE RecName: Full=Protein recA;AltName: Full=Recombinase A;    288   4e-80
RECA_RALSO RecName: Full=Protein recA;AltName: Full=Recombinase A;    288   5e-80
RECA_FRASC RecName: Full=Protein recA;AltName: Full=Recombinase A;    288   7e-80
RECA_CAMJD RecName: Full=Protein recA;AltName: Full=Recombinase A;    288   7e-80
RECA_TRIEI RecName: Full=Protein recA;AltName: Full=Recombinase A;    286   2e-79
RECA_THETH RecName: Full=Protein recA;AltName: Full=Recombinase A;    286   2e-79
RECA_PROM0 RecName: Full=Protein recA;AltName: Full=Recombinase A;    286   2e-79
RECA_MYCMS RecName: Full=Protein recA;AltName: Full=Recombinase A;    286   2e-79
RECA_MYCMY RecName: Full=Protein recA;AltName: Full=Recombinase A;    285   6e-79
RECA_PROMS RecName: Full=Protein recA;AltName: Full=Recombinase A;    284   7e-79
RECA_PROM9 RecName: Full=Protein recA;AltName: Full=Recombinase A;    284   7e-79
RECA_CYAP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    284   7e-79
RECA_PROMT RecName: Full=Protein recA;AltName: Full=Recombinase A;    284   9e-79
RECA_PROM2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    284   9e-79
RECA_PROM1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    284   9e-79
RECA_BORGA RecName: Full=Protein recA;AltName: Full=Recombinase A;    282   4e-78
RECA_PROMP RecName: Full=Protein recA;AltName: Full=Recombinase A;    281   6e-78
RECA_PHYMT RecName: Full=Protein recA;AltName: Full=Recombinase A;    280   1e-77
RECA_PROM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;    280   1e-77
RECA_MESFL RecName: Full=Protein recA;AltName: Full=Recombinase A;    276   2e-76
RECA_FUSNN RecName: Full=Protein recA;AltName: Full=Recombinase A;    275   4e-76
RECA_MYCPU RecName: Full=Protein recA;AltName: Full=Recombinase A;    274   7e-76
RECA_NEIPO RecName: Full=Protein recA;AltName: Full=Recombinase ...   273   2e-75
RECA_NEILA RecName: Full=Protein recA;AltName: Full=Recombinase ...   273   2e-75
RECA_ARCB4 RecName: Full=Protein recA;AltName: Full=Recombinase A;    272   4e-75
RECA_MYCMO RecName: Full=Protein recA;AltName: Full=Recombinase A;    270   2e-74
RECA_SYNY3 RecName: Full=Protein recA;AltName: Full=Recombinase A;    265   3e-73
RECA_NEIFL RecName: Full=Protein recA;AltName: Full=Recombinase ...   262   4e-72
RECA_NEICI RecName: Full=Protein recA;AltName: Full=Recombinase ...   261   5e-72
RECA_MYCHJ RecName: Full=Protein recA;AltName: Full=Recombinase A;    261   7e-72
RECA_MYCH7 RecName: Full=Protein recA;AltName: Full=Recombinase A;    261   9e-72
RECA_MYCH2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    261   9e-72
RECA_ARTAU RecName: Full=Protein recA;AltName: Full=Recombinase ...   252   3e-69
RECA_NEIPH RecName: Full=Protein recA;AltName: Full=Recombinase ...   251   5e-69
RECA_NEIMU RecName: Full=Protein recA;AltName: Full=Recombinase ...   251   9e-69
RECA_NEIEG RecName: Full=Protein recA;AltName: Full=Recombinase ...   250   1e-68
RECA_MYCTU RecName: Full=Protein recA;AltName: Full=Recombinase ...   247   1e-67
RECA_MYCBO RecName: Full=Protein recA;AltName: Full=Recombinase ...   247   1e-67
RECA_NEIAN RecName: Full=Protein recA;AltName: Full=Recombinase ...   244   1e-66
RECA3_ARATH RecName: Full=DNA repair protein recA homolog 3, mit...   241   9e-66
RECA_ACIFA RecName: Full=Protein recA;AltName: Full=Recombinase A;    239   2e-65
RECA_NEISU RecName: Full=Protein recA;AltName: Full=Recombinase ...   238   6e-65
RECA_NEIPE RecName: Full=Protein recA;AltName: Full=Recombinase ...   238   6e-65
RECA_MYCLE RecName: Full=Protein recA;AltName: Full=Recombinase ...   236   2e-64
RECA_MYCPE RecName: Full=Protein recA;AltName: Full=Recombinase A;    231   7e-63
RECA_NEISI RecName: Full=Protein recA;AltName: Full=Recombinase ...   225   4e-61
RECA_UREPA RecName: Full=Protein recA;AltName: Full=Recombinase A;    215   4e-58
RECA_UREP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;    215   4e-58
RECA2_LACLA RecName: Full=Protein recA, plasmid;AltName: Full=Re...   209   2e-56
RECA_UREU1 RecName: Full=Protein recA;AltName: Full=Recombinase A;    209   4e-56
RECA_MYCPN RecName: Full=Protein recA;AltName: Full=Recombinase A;    197   9e-53
RECA_MYCGE RecName: Full=Protein recA;AltName: Full=Recombinase A;    195   4e-52
RECA_STRCT RecName: Full=Protein recA;AltName: Full=Recombinase ...   189   2e-50
RECA_ACEAC RecName: Full=Protein recA;AltName: Full=Recombinase ...   187   1e-49
RECAM_ARATH RecName: Full=DNA repair protein recA homolog 2, mit...   186   3e-49
RECA_RUMAL RecName: Full=Protein recA;AltName: Full=Recombinase ...   152   6e-39
RECA4_ARATH RecName: Full=Putative DNA repair protein recA homol...   140   2e-35
RECA_LEUME RecName: Full=Protein recA;AltName: Full=Recombinase ...   130   2e-32
RECA_LACHE RecName: Full=Protein recA;AltName: Full=Recombinase ...   120   2e-29
RECA_STRSL RecName: Full=Protein recA;AltName: Full=Recombinase ...   116   3e-28
RECA_LACDE RecName: Full=Protein recA;AltName: Full=Recombinase ...   110   2e-26
RECA_SPIME RecName: Full=Protein recA;AltName: Full=Recombinase ...    65   9e-13
RADA_METST RecName: Full=DNA repair and recombination protein radA;    59   5e-11
RADB_PYRFU RecName: Full=DNA repair and recombination protein radB;    53   5e-09
RADB_THESM RecName: Full=DNA repair and recombination protein radB;    52   6e-09
RADA_METTH RecName: Full=DNA repair and recombination protein radA;    51   1e-08
RADA_DESK1 RecName: Full=DNA repair and recombination protein radA;    50   4e-08
UVSX_BPT4 RecName: Full=Recombination and repair protein;              49   7e-08
RADB_PYRHO RecName: Full=DNA repair and recombination protein radB;    49   9e-08
RADB_PYRAB RecName: Full=DNA repair and recombination protein radB;    49   9e-08
RADB_METST RecName: Full=DNA repair and recombination protein radB;    48   1e-07
RADA_METS3 RecName: Full=DNA repair and recombination protein radA;    48   1e-07
RADA_DESAM RecName: Full=DNA repair and recombination protein radA;    48   1e-07
RADA_SULSO RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_SULIY RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_SULIN RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_SULIM RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_SULIL RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_SULIK RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_SULIA RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADA_METBU RecName: Full=DNA repair and recombination protein radA;    47   2e-07
RADB_THEON RecName: Full=DNA repair and recombination protein radB;    47   3e-07
RADB_PYRKO RecName: Full=DNA repair and recombination protein radB;    47   3e-07
RADB_METTH RecName: Full=DNA repair and recombination protein radB;    45   7e-07
RADA_METBF RecName: Full=DNA repair and recombination protein radA;    45   1e-06
DMC1_SCHPO RecName: Full=Meiotic recombination protein dmc1;           45   1e-06
RAD55_SCHPO RecName: Full=DNA repair protein rhp55;AltName: Full...    43   4e-06
DMC1_MOUSE RecName: Full=Meiotic recombination protein DMC1/LIM1...    43   4e-06
RADB_METMJ RecName: Full=DNA repair and recombination protein radB;    43   5e-06
DMC1_HUMAN RecName: Full=Meiotic recombination protein DMC1/LIM1...    43   5e-06
RADA_METMA RecName: Full=DNA repair and recombination protein radA;    42   8e-06
RADA_ARCFU RecName: Full=DNA repair and recombination protein radA;    42   8e-06
RADB_METMP RecName: Full=DNA repair and recombination protein radB;    42   1e-05
RADA_METAC RecName: Full=DNA repair and recombination protein radA;    42   1e-05
RADA_SULTO RecName: Full=DNA repair and recombination protein radA;    41   2e-05
RADA_METS5 RecName: Full=DNA repair and recombination protein radA;    41   2e-05
RADB_METBU RecName: Full=DNA repair and recombination protein radB;    40   2e-05
RADB_METM7 RecName: Full=DNA repair and recombination protein radB;    40   3e-05
RADA_METLZ RecName: Full=DNA repair and recombination protein radA;    40   3e-05
DMC1_SOYBN RecName: Full=Meiotic recombination protein DMC1 homo...    40   3e-05
RADA_SULAC RecName: Full=DNA repair and recombination protein radA;    40   4e-05
RADA_AQUAE RecName: Full=DNA repair protein radA homolog;AltName...    40   4e-05
RAD51_USTMA RecName: Full=DNA repair protein RAD51;                    40   4e-05
RADA_PYRCJ RecName: Full=DNA repair and recombination protein radA;    39   5e-05
RADB_HALSA RecName: Full=DNA repair and recombination protein radB;    39   7e-05
RADB_HALS3 RecName: Full=DNA repair and recombination protein radB;    39   7e-05
DMC1_LILLO RecName: Full=Meiotic recombination protein DMC1 homo...    39   7e-05
DMC1_ARATH RecName: Full=Meiotic recombination protein DMC1 homo...    39   7e-05
RADA_HAEIN RecName: Full=DNA repair protein radA homolog;AltName...    39   9e-05
RADB_METS3 RecName: Full=DNA repair and recombination protein radB;    38   1e-04
RADA_AERPE RecName: Full=DNA repair and recombination protein radA;    38   1e-04
RAD51_YEAST RecName: Full=DNA repair protein RAD51;                    38   1e-04
RADB_METM5 RecName: Full=DNA repair and recombination protein radB;    38   2e-04
MRP3_MOUSE RecName: Full=Canalicular multispecific organic anion...    37   2e-04
RADA_PYRAR RecName: Full=DNA repair and recombination protein radA;    37   3e-04
RADA_PYRAE RecName: Full=DNA repair and recombination protein radA;    37   3e-04
RADA_THENV RecName: Full=DNA repair and recombination protein radA;    37   3e-04
RADA_PYRIL RecName: Full=DNA repair and recombination protein radA;    37   3e-04
CYSA_BACCR RecName: Full=Sulfate/thiosulfate import ATP-binding ...    37   3e-04
RADB_THEVO RecName: Full=DNA repair and recombination protein radB;    36   4e-04
RADA_METJA RecName: Full=DNA repair and recombination protein radA;    36   4e-04
RAD57_SCHPO RecName: Full=DNA repair protein rhp57;AltName: Full...    36   6e-04
MRP3_RAT RecName: Full=Canalicular multispecific organic anion t...    36   6e-04
MIAA_SILPO RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate ...    36   6e-04
RCA_SOLPN RecName: Full=Ribulose bisphosphate carboxylase/oxygen...    35   8e-04
RCA2_TOBAC RecName: Full=Ribulose bisphosphate carboxylase/oxyge...    35   8e-04
RCA1_TOBAC RecName: Full=Ribulose bisphosphate carboxylase/oxyge...    35   8e-04
RA51B_MOUSE RecName: Full=DNA repair protein RAD51 homolog 2;   ...    35   8e-04
RADB_THEGJ RecName: Full=DNA repair and recombination protein radB;    35   0.001
RA51C_HUMAN RecName: Full=DNA repair protein RAD51 homolog 3;   ...    35   0.001
R51A1_MAIZE RecName: Full=DNA repair protein RAD51 homolog A;Alt...    35   0.001

>RECA_HELMI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  373 bits (958), Expect = e-105
 Identities = 204/322 (63%), Positives = 244/322 (75%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           + K + L+   + IE  FGKGSIM+ GE    L + VIPTG++ LD ALGIGGVPRGRIV
Sbjct: 5   DNKLQALQQALNSIEKAFGKGSIMRLGEASAKLLVEVIPTGSIALDMALGIGGVPRGRIV 64

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           EVYGPESSGKTT+AL IIAEAQ MGG+ AFIDAEHALDPVYA  LGVDID +L+SQPDTG
Sbjct: 65  EVYGPESSGKTTVALHIIAEAQKMGGMAAFIDAEHALDPVYARNLGVDIDNLLVSQPDTG 124

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEIC+ LVRSG              P+AEI+GE+GD  VGLQARLMSQALRKL G +
Sbjct: 125 EQALEICEALVRSGXXXXXXXXXXXXXXPKAEIDGEMGDAHVGLQARLMSQALRKLTGVV 184

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKS T C+FINQ+REK+GVMFGNPETT GGRALKF+                 +++G   
Sbjct: 185 SKSKTCCLFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRKVDTLKQGSDMIGSRT 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ A+FD+MYGEGISREG +VD+AV+ G+ +KSGAWY+Y  +RLGQGR
Sbjct: 245 RVKVVKNKVAPPFKVADFDIMYGEGISREGSLVDLAVDMGIVEKSGAWYSYKGDRLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVR 324
           E  K+ L+ +P L  E+E+ +R
Sbjct: 305 ENVKEFLRNHPALAAEIESMIR 326


>RECA_CLOAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  373 bits (958), Expect = e-105
 Identities = 221/331 (66%), Positives = 258/331 (77%), Gaps = 1/331 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ EK K +     QIE +FGKG+IMK GE    LNI  I TG L LD ALGIGGVPRGR
Sbjct: 1   MDNEKLKAIDAAMSQIEKQFGKGAIMKLGEQDI-LNIDAISTGCLSLDIALGIGGVPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTT+AL I+AEAQ  GG  AFIDAEHALDP YA  LGVDID +++SQPD
Sbjct: 60  VVEIYGPESSGKTTVALHILAEAQKKGGAAAFIDAEHALDPQYARALGVDIDNLVVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 120 TGEQALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S++KS    IFINQLREK+G+MFGNPETT GGRALKF+                 E++G 
Sbjct: 180 SINKSKCIAIFINQLREKVGIMFGNPETTPGGRALKFYASVRMDIRKIDTIKQGEEMIGX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MY EGISREG IVD+ V+  + +KSGAW++YG+ RLGQ
Sbjct: 240 XXXXXXXXXXXAPPFKQAEFDIMYNEGISREGNIVDVGVKENIIQKSGAWFSYGDIRLGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPI 331
           GRE AK   KEN D+R E+E K+RE +++PI
Sbjct: 300 GRENAKLFFKENIDIRSEVENKIREKYDLPI 330


>RECA_AMYMD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  372 bits (954), Expect = e-105
 Identities = 188/326 (57%), Positives = 233/326 (71%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L+L   QI+ ++GKGS+M+ GE G    I VIPTGA+ LD ALGIGG+PRGR++E
Sbjct: 6   DKDKALELALAQIDKQYGKGSVMRLGEEGR-APIAVIPTGAIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  VYGPESSGKTTVALHAVANAQRNGGIAAFIDAEHALDPDYAKKLGVDTDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+++
Sbjct: 125 QALEIADMLVRSGALDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGAMN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                GE VG    
Sbjct: 185 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGGEAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++DM V+  + +KSGAWYTY  ++LGQG+E
Sbjct: 245 VKVVKNKMAPPFKQAEFDILYGHGISREGSLIDMGVDQAILRKSGAWYTYEGDQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            A++ L++NPD+  E+E +++E   I
Sbjct: 305 NARKFLRDNPDIANEIEKRIKEKLGI 330


>RECA_CLOPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  370 bits (951), Expect = e-105
 Identities = 201/347 (57%), Positives = 256/347 (73%), Gaps = 9/347 (2%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++++K K +++   QIE +FGKGS+MK GE G    +  + TG L LD ALGIGGVP+GR
Sbjct: 4   IDKDKLKAIEMAMGQIEKQFGKGSVMKLGEQGAP-QMDAVSTGCLDLDIALGIGGVPKGR 62

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL ++AEAQ +GG  A+IDAEHALDPVYA RLGV+ID++++SQPD
Sbjct: 63  IIEIYGPESSGKTTVALHVVAEAQKLGGAAAYIDAEHALDPVYAKRLGVNIDDLVVSQPD 122

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + LVRSG              PRAEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 123 TGEQALEITEALVRSGAIXXXXXXXXXXXXPRAEIEGEMGDSHVGLQARLMSQALRKLTG 182

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +++KSN   IFINQLREK+G+MFGNPETT GGRALKF+                  I G 
Sbjct: 183 TINKSNCVVIFINQLREKVGIMFGNPETTPGGRALKFYASVRMDIRRIDSIKQGDGITGN 242

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MY EGIS+EG IVD+ V+  + +KSGAW++YG+ RLGQ
Sbjct: 243 RTRVKIVKNKVAPPFKQAEFDIMYNEGISKEGNIVDVGVKENIVQKSGAWFSYGDIRLGQ 302

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPI--------ITRSTEEA 339
           GRE AKQ LKENP +  ++E ++RE + +P+        + ++TEE+
Sbjct: 303 GRENAKQYLKENPSVALDIENQIREKYSLPLAKAVESTSVEKNTEES 349


>RECA_CLOPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  369 bits (947), Expect = e-104
 Identities = 198/331 (59%), Positives = 249/331 (75%), Gaps = 1/331 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++++K K +++   QIE +FGKGS+MK GE G    +  + TG L LD ALGIGGVP+GR
Sbjct: 4   IDKDKLKAIEMAMGQIEKQFGKGSVMKLGEQGAP-QMDAVSTGCLDLDIALGIGGVPKGR 62

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL ++AEAQ +GG  A+IDAEHALDPVYA RLGV+ID++++SQPD
Sbjct: 63  IIEIYGPESSGKTTVALHVVAEAQKLGGAAAYIDAEHALDPVYAKRLGVNIDDLVVSQPD 122

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + LVRSG              PRAEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 123 TGEQALEITEALVRSGAIXXXXXXXXXXXXPRAEIEGEMGDSHVGLQARLMSQALRKLTG 182

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +++KSN   IFINQLREK+G+MFGNPETT GGRALKF+                  I G 
Sbjct: 183 TINKSNCVVIFINQLREKVGIMFGNPETTPGGRALKFYASVRMDIRRIDSIKQGDGITGN 242

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MY EGIS+EG IVD+ V+  + +KSGAW++YG+ RLGQ
Sbjct: 243 RTRVKIVKNKVAPPFKQAEFDIMYNEGISKEGNIVDVGVKENIVQKSGAWFSYGDIRLGQ 302

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPI 331
           GRE AKQ LKENP +  ++E ++RE + +P+
Sbjct: 303 GRENAKQYLKENPAVALDIENQIREKYSLPL 333


>RECA_CLOP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  369 bits (947), Expect = e-104
 Identities = 198/331 (59%), Positives = 249/331 (75%), Gaps = 1/331 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++++K K +++   QIE +FGKGS+MK GE G    +  + TG L LD ALGIGGVP+GR
Sbjct: 4   IDKDKLKAIEMAMGQIEKQFGKGSVMKLGEQGAP-QMDAVSTGCLDLDIALGIGGVPKGR 62

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL ++AEAQ +GG  A+IDAEHALDPVYA RLGV+ID++++SQPD
Sbjct: 63  IIEIYGPESSGKTTVALHVVAEAQKLGGAAAYIDAEHALDPVYAKRLGVNIDDLVVSQPD 122

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + LVRSG              PRAEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 123 TGEQALEITEALVRSGAIXXXXXXXXXXXXPRAEIEGEMGDSHVGLQARLMSQALRKLTG 182

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +++KSN   IFINQLREK+G+MFGNPETT GGRALKF+                  I G 
Sbjct: 183 TINKSNCVVIFINQLREKVGIMFGNPETTPGGRALKFYASVRMDIRRIDSIKQGDGITGN 242

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MY EGIS+EG IVD+ V+  + +KSGAW++YG+ RLGQ
Sbjct: 243 RTRVKIVKNKVAPPFKQAEFDIMYNEGISKEGNIVDVGVKENIVQKSGAWFSYGDIRLGQ 302

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPI 331
           GRE AKQ LKENP +  ++E ++RE + +P+
Sbjct: 303 GRENAKQYLKENPAVALDIENQIREKYSLPL 333


>RECA_CHLSY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  369 bits (947), Expect = e-104
 Identities = 191/321 (59%), Positives = 227/321 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L  T  QI+ KFGKGSIMK GE    L I  IPTG++ LD ALGIGGVPRGR+VE
Sbjct: 6   EKEKALAATMAQIDRKFGKGSIMKMGEASSRLAIEAIPTGSIALDIALGIGGVPRGRVVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  IIAEAQ MGG+ AFIDAEHA DPVYAAR GV+ID++L+SQPDTGE
Sbjct: 66  IFGPESSGKTTLAQHIIAEAQKMGGVCAFIDAEHAFDPVYAARCGVNIDDLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEIC+MLVRS               PRAEIEGE+GD+  G+QARLMSQALRKL+G++S
Sbjct: 126 QALEICEMLVRSNAIDVIVIDSVAALVPRAEIEGEMGDSMPGMQARLMSQALRKLSGAIS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQLR KIGVMFG+PETTTGG+ALKF+                 E +G    
Sbjct: 186 KSRTVVIFINQLRMKIGVMFGSPETTTGGQALKFYASVRLDIRRVETLKQGQEAIGSRVR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQAEFD++  EGISREG I+D+  E G+ +KSGAW+  GE+RLGQGRE
Sbjct: 246 VKVIKNKVAPPFRQAEFDILANEGISREGNIIDIGTELGIIRKSGAWFYLGEDRLGQGRE 305

Query: 304 AAKQTLKENPDLREELETKVR 324
             ++ LK NP L +E+E  ++
Sbjct: 306 NVREFLKNNPALTDEIERLIK 326


>RECA_CHLAA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  369 bits (947), Expect = e-104
 Identities = 191/321 (59%), Positives = 227/321 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L  T  QI+ KFGKGSIMK GE    L I  IPTG++ LD ALGIGGVPRGR+VE
Sbjct: 6   EKEKALAATMAQIDRKFGKGSIMKMGEASSRLAIEAIPTGSIALDIALGIGGVPRGRVVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  IIAEAQ MGG+ AFIDAEHA DPVYAAR GV+ID++L+SQPDTGE
Sbjct: 66  IFGPESSGKTTLAQHIIAEAQKMGGVCAFIDAEHAFDPVYAARCGVNIDDLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEIC+MLVRS               PRAEIEGE+GD+  G+QARLMSQALRKL+G++S
Sbjct: 126 QALEICEMLVRSNAIDVIVIDSVAALVPRAEIEGEMGDSMPGMQARLMSQALRKLSGAIS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQLR KIGVMFG+PETTTGG+ALKF+                 E +G    
Sbjct: 186 KSRTVVIFINQLRMKIGVMFGSPETTTGGQALKFYASVRLDIRRVETLKQGQEAIGSRVR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQAEFD++  EGISREG I+D+  E G+ +KSGAW+  GE+RLGQGRE
Sbjct: 246 VKVIKNKVAPPFRQAEFDILANEGISREGNIIDIGTELGIIRKSGAWFYLGEDRLGQGRE 305

Query: 304 AAKQTLKENPDLREELETKVR 324
             ++ LK NP L +E+E  ++
Sbjct: 306 NVREFLKNNPALTDEIERLIK 326


>RECA_RHILW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  369 bits (946), Expect = e-104
 Identities = 202/323 (62%), Positives = 241/323 (74%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  I TG+L LD ALG+GG+PRGRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETISTGSLGLDIALGVGGLPRGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXXTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G    
Sbjct: 195 KSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 315 NAKTFLRDNPDLAREIELSLRQN 337


>RECA_RHIL3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 364

 Score =  369 bits (946), Expect = e-104
 Identities = 202/323 (62%), Positives = 241/323 (74%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  I TG+L LD ALG+GG+PRGRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETISTGSLGLDIALGVGGLPRGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXXTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G    
Sbjct: 195 KSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 315 NAKTFLRDNPDLAREIELSLRQN 337


>RECA_AGRRK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  368 bits (945), Expect = e-104
 Identities = 190/323 (58%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  + TG+L LD ALGIGG+P+GRIVE
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETVSTGSLSLDIALGIGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 315 NAKLFLRDNPDLAREIELSLRQN 337


>RECA_RHIE6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  366 bits (940), Expect = e-103
 Identities = 200/323 (61%), Positives = 241/323 (74%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  I TG+L LD ALG+GG+P+GRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSNENVIEIETISTGSLGLDIALGVGGLPKGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAE+Q  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXXTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G    
Sbjct: 195 KSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVIGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 315 NAKTFLRDNPDLAREIELALRQN 337


>RECA_LISWE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  366 bits (940), Expect = e-103
 Identities = 205/326 (62%), Positives = 239/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISQRVREEYEI 327


>RECA_LISW6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  366 bits (940), Expect = e-103
 Identities = 205/326 (62%), Positives = 239/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISQRVREEYEI 327


>RECA_LISSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  366 bits (940), Expect = e-103
 Identities = 205/326 (62%), Positives = 239/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_LISIV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  366 bits (940), Expect = e-103
 Identities = 205/326 (62%), Positives = 239/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_RHILO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  365 bits (937), Expect = e-103
 Identities = 186/323 (57%), Positives = 226/323 (69%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE  FGKGSIM+ G     + I  +PTG+L LD ALG+GG+PRGRI+E
Sbjct: 15  DKSKALDAALSQIERAFGKGSIMRLGANEQVVEIETVPTGSLGLDIALGVGGLPRGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTVAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEICD LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEICDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDRDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+  EFD+MYGEG+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKVVEFDIMYGEGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPD   E+E  +R++
Sbjct: 315 NAKLFLRDNPDTAREIELALRQN 337


>RECA_LISMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  365 bits (937), Expect = e-103
 Identities = 205/326 (62%), Positives = 238/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G ++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGVIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_LISMH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  365 bits (937), Expect = e-103
 Identities = 205/326 (62%), Positives = 238/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G ++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGVIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_LISMF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  365 bits (937), Expect = e-103
 Identities = 205/326 (62%), Positives = 238/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G ++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGVIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_LISMC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  365 bits (937), Expect = e-103
 Identities = 205/326 (62%), Positives = 238/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G ++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGVIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_LISIN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  365 bits (937), Expect = e-103
 Identities = 205/326 (62%), Positives = 238/326 (73%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L     QIE +FGKGSIMK GE   D NI  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDQALKQIEKQFGKGSIMKLGEHS-DQNISTISSGSLALDIALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE QA GG  AFIDAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQAQGGTAAFIDAEHALDPAYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL+G ++
Sbjct: 122 QALEIAEALVRSGAVDMLVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGVIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPE T GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPEITPGGRALKFYSTVRLEVRRAEQLKQGTDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG +VDMA E  V  KSG+WY+Y EER+GQGRE
Sbjct: 242 XXXXXXXXAPPFRIAEVDIMYGEGISREGELVDMAAEVDVINKSGSWYSYKEERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            AKQ LKE+ D+R+E+  +VRE +EI
Sbjct: 302 NAKQYLKEHTDIRDEISKRVREEYEI 327


>RECA_RHIET RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  365 bits (936), Expect = e-103
 Identities = 200/323 (61%), Positives = 240/323 (74%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  I TG+L LD ALG+GG+P+GRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSNENVIEIETISTGSLGLDIALGVGGLPKGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAE+Q  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXXTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G    
Sbjct: 195 KSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVIGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQG E
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGGE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +RE+
Sbjct: 315 NAKTFLRDNPDLAREIELALREN 337


>RECA_OCHA4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  365 bits (936), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  +PTG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGKNAPVIEIETVPTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_CLOBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  364 bits (935), Expect = e-103
 Identities = 191/334 (57%), Positives = 232/334 (69%), Gaps = 1/334 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K ++    QIE +FGKGS+MK GE    LNI  I TG L LD ALGIGGVP+GRIVE+
Sbjct: 8   KLKAIENAMGQIEKQFGKGSVMKLGEDSV-LNIDAISTGCLDLDIALGIGGVPKGRIVEI 66

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTT+AL I AEAQ  GG V FIDAEHALDP YA  LGVD + +++SQPDTGEQ
Sbjct: 67  YGPESSGKTTIALHIAAEAQKKGGAVGFIDAEHALDPSYARNLGVDTENLIVSQPDTGEQ 126

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
            LEI + LVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKLAG++SK
Sbjct: 127 GLEIAEALVRSGAIDVIIVDSVAALVPKAEIEGEMGDSHIGLQARLMSQALRKLAGTISK 186

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           +N   IFINQLREK+GVMFG+PETTTGGRALKF+                  IVG     
Sbjct: 187 TNCIAIFINQLREKVGVMFGSPETTTGGRALKFYASVRLDVRRIDSIKQGDGIVGNRTRI 246

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEFD+MY EGISREG IVD+ V+  + +KSGAW++YG+ RLGQGRE 
Sbjct: 247 KVTKNKVAPPFKQAEFDIMYNEGISREGNIVDVGVKEEIVQKSGAWFSYGDIRLGQGREN 306

Query: 305 AKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           AKQ LKENP++  ++E ++RE   +P++    +E
Sbjct: 307 AKQYLKENPEVALDIENQIREKHNLPLMDAVIKE 340


>RECA_BRUSU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BRUME RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BRUMB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BRUC2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BRUAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BRUA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BRUA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  364 bits (934), Expect = e-103
 Identities = 186/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_CLOBB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  363 bits (933), Expect = e-103
 Identities = 190/334 (56%), Positives = 232/334 (69%), Gaps = 1/334 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K ++    QIE +FGKGS+MK GE    LNI  I TG L LD ALGIGGVP+GRIVE+
Sbjct: 8   KLKAIENAMGQIEKQFGKGSVMKLGENSV-LNIDAISTGCLDLDIALGIGGVPKGRIVEI 66

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTT+AL I AEAQ  GG V FIDAEHALDP YA  LGVD + +++SQPDTGEQ
Sbjct: 67  YGPESSGKTTIALHIAAEAQKKGGAVGFIDAEHALDPSYARNLGVDTENLIVSQPDTGEQ 126

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
            LEI + LVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKLAG++SK
Sbjct: 127 GLEIAEALVRSGAIDVIIVDSVAALVPKAEIEGEMGDSHIGLQARLMSQALRKLAGTISK 186

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           +N   IFINQLREK+GVMFG+PETTTGGRALKF+                  IVG     
Sbjct: 187 TNCIAIFINQLREKVGVMFGSPETTTGGRALKFYASVRLDVRRIDSIKQGDGIVGNRTRI 246

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEFD+MY EGISR+G IVD+ V+  + +KSGAW++YG+ RLGQGRE 
Sbjct: 247 KVTKNKVAPPFKQAEFDIMYNEGISRQGNIVDVGVKEEIVQKSGAWFSYGDIRLGQGREN 306

Query: 305 AKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           AKQ LKENP++  ++E ++RE   +P++    +E
Sbjct: 307 AKQYLKENPEVALDIENQIREKHNLPLMDAVIKE 340


>RECA_DICNV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  363 bits (931), Expect = e-102
 Identities = 179/327 (54%), Positives = 233/327 (71%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           MNEE+ K L     Q++ +FGKG++M+ GE     +I  I TG+L LD ALGIGG+P+GR
Sbjct: 1   MNEEQKKALTAVLTQLDKQFGKGTVMRLGEQVAAHDIQAISTGSLTLDIALGIGGLPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+ L +IAEAQ  GG  AFIDAEHALDP+YA +LGV+ D++ ++QPD
Sbjct: 61  IVEIYGPESSGKTTMMLHVIAEAQKNGGTAAFIDAEHALDPIYARKLGVNTDDLYVTQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 121 TGEQALEICDALVRSGAFDVIVVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NT  +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G 
Sbjct: 181 NIKRANTLVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRMDIRRIGSIKEGDEVLGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD++YG+G+SREG I+ +AV A + +KSGAWY+Y +E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKQAEFDILYGQGVSREGEIIQLAVNADIMQKSGAWYSYRDEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESF 327
           G+E  +  LKE+PD+ +E+ETK+RE F
Sbjct: 301 GKEKVRLYLKEHPDVAQEIETKIREKF 327


>RECA_BRUSI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  363 bits (931), Expect = e-102
 Identities = 185/323 (57%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  + TG+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G    
Sbjct: 195 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVMGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYG G+S+ G +VD+ V+AGV +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ LK+NP++  E+ET +R++
Sbjct: 315 NAKQYLKDNPEVAREIETTLRQN 337


>RECA_BREBN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  363 bits (931), Expect = e-102
 Identities = 209/338 (61%), Positives = 248/338 (73%), Gaps = 3/338 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L+    QIE +FGKGSIMK GE  + + I    +GAL LD ALG+GG PRGRIVE
Sbjct: 3   DRRAALESALRQIEKQFGKGSIMKLGEVSN-IQISTASSGALALDIALGVGGFPRGRIVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYAA+LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVALHAIAEVQRQGGQAAFIDAEHALDPVYAAKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQLREK+GVMFGNPETT GGRALKF+                 +I+G    
Sbjct: 182 KSKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRKAESIKVGNDILGSKTK 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AE D+MYGEGISREG I+D+  E  V +KSGAWY++ EERLGQGRE
Sbjct: 242 IKVVKNKVAPPFKVAEVDIMYGEGISREGSILDIGSEIDVVQKSGAWYSFNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
            +K  LKENP +  ++ETKVRE F +     S  EA+A
Sbjct: 302 NSKVFLKENPHIASQIETKVREYFSLN--PSSVPEAEA 337


>RECA_BIFLO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 397

 Score =  363 bits (931), Expect = e-102
 Identities = 182/327 (55%), Positives = 228/327 (69%), Gaps = 1/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ ++   L     Q+E  FGKGS M+ G+     N+ VIPTG+L LD ALGIGG+P+GR
Sbjct: 19  LDPKRKAALDTALAQVEKSFGKGSAMRLGDQPEQ-NVEVIPTGSLALDMALGIGGLPKGR 77

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTLAL ++A AQ  GG+ A+IDAEHALDP YA +LGVD D +++SQPD
Sbjct: 78  IVEIYGPESSGKTTLALHVVANAQKKGGVAAYIDAEHALDPAYARKLGVDTDSLIVSQPD 137

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DML+RSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G
Sbjct: 138 NGEQALEIADMLIRSGALDVIVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKMTG 197

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L+++ TT IFINQLREKIGV FGNPETTTGG+ALKF+                 E VG 
Sbjct: 198 ALAQAGTTAIFINQLREKIGVFFGNPETTTGGKALKFYASVRLDIRRIQTLKNGDEAVGN 257

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD++YGEGISREG ++DMA + GV KKSG+W+TY  ++LGQ
Sbjct: 258 RTRVKVVKNKMAPPFKSAEFDMLYGEGISREGSVIDMAQQVGVVKKSGSWFTYEGDQLGQ 317

Query: 301 GREAAKQTLKENPDLREELETKVRESF 327
           GRE  +Q LK+NP + EE+E KV+  F
Sbjct: 318 GREKVRQFLKDNPAITEEIENKVKAEF 344


>RECA_CLOTE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  362 bits (930), Expect = e-102
 Identities = 199/332 (59%), Positives = 248/332 (74%), Gaps = 1/332 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++EK K ++     IE +FGKGS+MK GE  + L+I  I TG L +D ALGIGGVP+GR
Sbjct: 1   MDKEKLKAIEAAMGNIEKQFGKGSVMKLGEK-NILDIEAISTGCLGMDIALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL IIAEAQ  GG+ AFIDAEHALDP YA +LGVDID +++SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHIIAEAQKNGGVAAFIDAEHALDPSYARKLGVDIDNLIVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ LEI + LVRS               P+AEI+GE+GD+ VGLQARLMSQALRKLAG
Sbjct: 120 TGEQGLEIAEALVRSNXXXXXXXXXXXXXXPKAEIQGEMGDSHVGLQARLMSQALRKLAG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S++KSN   IFINQLREK+G+MFG+PETT GGRALKF+                 E +G 
Sbjct: 180 SINKSNCVAIFINQLREKVGIMFGSPETTPGGRALKFYSSVRLDVRRIDTIKQGDEFLGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD+MY EGISR G ++D+ V+  + +KSG+W++Y + RLGQ
Sbjct: 240 RTRVKVTKNKVAPPFKNAEFDIMYNEGISRTGDVLDLGVKEEIVQKSGSWFSYNDVRLGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPII 332
           GRE AKQ LK+NP+L  E+E  +RE +++PI+
Sbjct: 300 GRENAKQFLKDNPELLYEIENTIREKYDLPIV 331


>RECA_RHILV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  362 bits (928), Expect = e-102
 Identities = 199/323 (61%), Positives = 237/323 (73%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  I TG+L LD ALG+GG+PRGRI+E
Sbjct: 2   DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETISTGSLGLDIALGVGGLPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 62  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D L                  PRAEIEGE+GDT  GLQARLMSQALRKL  S+S
Sbjct: 122 QALEITDTLXXXXXXXXXXXXXXXXXTPRAEIEGEMGDTVPGLQARLMSQALRKLTASIS 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G    
Sbjct: 182 KSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 242 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 302 NAKTFLRDNPDLAREIELSLRQN 324


>RECA_BIFBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 392

 Score =  362 bits (928), Expect = e-102
 Identities = 182/327 (55%), Positives = 228/327 (69%), Gaps = 1/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ ++   L     Q+E  FGKGS M+ G+     N+ VIPTG+L LD ALGIGG+P+GR
Sbjct: 19  LDPKRKAALDTALAQVEKSFGKGSAMRLGDQPVQ-NVEVIPTGSLALDMALGIGGLPKGR 77

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTLAL ++A AQ  GG+ A+IDAEHALDP YA +LGVD D +++SQPD
Sbjct: 78  IVEIYGPESSGKTTLALHVVANAQKKGGVAAYIDAEHALDPAYARKLGVDTDSLIVSQPD 137

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DML+RSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G
Sbjct: 138 NGEQALEIADMLIRSGALDVIVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKMTG 197

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L+++ TT IFINQLREKIGV FGNPETTTGG+ALKF+                 E VG 
Sbjct: 198 ALAQAGTTAIFINQLREKIGVFFGNPETTTGGKALKFYASVRLDIRRIQTLKNGDEAVGN 257

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD++YGEGISREG ++DMA + GV KKSG+W+TY  ++LGQ
Sbjct: 258 RTRVKVVKNKMAPPFKSAEFDMLYGEGISREGSVIDMAQQVGVVKKSGSWFTYEGDQLGQ 317

Query: 301 GREAAKQTLKENPDLREELETKVRESF 327
           GRE  +Q LK+NP + EE+E KV+  F
Sbjct: 318 GREKVRQFLKDNPAITEEIENKVKAEF 344


>RECA_BACCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  362 bits (928), Expect = e-102
 Identities = 211/322 (65%), Positives = 249/322 (77%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  +P+G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKMGEQA-ERKVSTVPSGSLSLDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGXXXXXXXXXXXXLVPKAEIEGEMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 EI      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTIRLEVRRAEQLKQGNEIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYAYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            AKQ LKENPD+R+E+   +RE
Sbjct: 302 NAKQFLKENPDIRDEIAFFIRE 323


>RECA_CHLAD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  361 bits (927), Expect = e-102
 Identities = 201/321 (62%), Positives = 239/321 (74%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L     QI+ KFGKGSIMK GE G  L I  IPTG++ LD ALGIGGVPRGR++E
Sbjct: 6   EKEKALAAAMAQIDRKFGKGSIMKMGEVGGRLAIEAIPTGSIALDIALGIGGVPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  IIAEAQ MGG+ AFIDAEHA DPVYAAR GV+I ++L+SQPDTGE
Sbjct: 66  IFGPESSGKTTLAQHIIAEAQKMGGVGAFIDAEHAFDPVYAARCGVNISDLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEIC+MLVRS               PRAEIEG++GD+  G+QARLMSQALRKL+G++S
Sbjct: 126 QALEICEMLVRSNXXXXXXXXXXXXXXPRAEIEGDMGDSMPGMQARLMSQALRKLSGAIS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS    IFINQLR KIGVMFG+PETTTGG+ALKF+                 E +G    
Sbjct: 186 KSRAVVIFINQLRMKIGVMFGSPETTTGGQALKFYASVRLDIRRIETLKQGQEAIGSRVR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQAEFD++  EGISREG I+D+  E G+ +KSGAW+  GE+RLGQGRE
Sbjct: 246 VKVIKNKVAPPFRQAEFDILANEGISREGNIIDIGTELGIIRKSGAWFYLGEDRLGQGRE 305

Query: 304 AAKQTLKENPDLREELETKVR 324
             ++ LK NP L +E+E  ++
Sbjct: 306 NVREFLKNNPALTDEIERLIK 326


>RECA_GEOSL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 338

 Score =  361 bits (926), Expect = e-102
 Identities = 195/330 (59%), Positives = 239/330 (72%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +E+ K ++L   QIE +FGKG+IM+ G      ++  IPTG+L LD ALG+GGVPRGR
Sbjct: 1   MTQEREKAIELALSQIEKQFGKGAIMRLGADEALPDVAAIPTGSLSLDLALGVGGVPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTLAL I AEAQ MGGI AF+DAEHALD  YA +LGV  D++L+SQPD
Sbjct: 61  IIEIYGPESSGKTTLALHIAAEAQKMGGIAAFVDAEHALDIGYARKLGVKTDDLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI +MLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKL G
Sbjct: 121 TGEQALEIAEMLVRSGAVDVLVIDSVAALVPKAEIEGEMGDSHMGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SKSN   IFINQ+R KIGVMFGNPETTTGG ALKF+                 +++G 
Sbjct: 181 IISKSNCCVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRKIASLKQGQDVIGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++ EFD+ YGEGISREG I+D+AVE G+  KSGAW++YG +R+GQ
Sbjct: 241 RTXXXXXXXXXAPPFKEVEFDIYYGEGISREGDILDLAVEKGIVDKSGAWFSYGGDRIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIP 330
           GRE ++  LKE P+L  E+E KV +   IP
Sbjct: 301 GRENSRLFLKERPELVNEIEGKVYDVAGIP 330


>RECA_STRLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 374

 Score =  360 bits (923), Expect = e-101
 Identities = 191/328 (58%), Positives = 238/328 (72%), Gaps = 1/328 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE +FGKG++M+ G+  ++  I VIPTG+  LD ALG+GG+PRGR+VE
Sbjct: 5   DREKALDAALAQIERQFGKGAVMRMGDRTNE-PIEVIPTGSTALDVALGVGGIPRGRVVE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  +A AQ  GG VAF+DAEHALDP YA +LGVDID +++SQPD GE
Sbjct: 64  VYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPDNGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S TT IFINQLREKIGVMFG+PETTTGGRALKF+                 + VG    
Sbjct: 184 QSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDIRRIETLKDGTDAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +K+GAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFKQAEFDILYGQGISREGGLIDMGVENGFVRKAGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPI 331
            A+  LK+NPDL  E+E K+++   + +
Sbjct: 304 NARNFLKDNPDLANEIEKKIKQKLGVGV 331


>RECA_STRCO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 374

 Score =  360 bits (923), Expect = e-101
 Identities = 191/328 (58%), Positives = 238/328 (72%), Gaps = 1/328 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE +FGKG++M+ G+  ++  I VIPTG+  LD ALG+GG+PRGR+VE
Sbjct: 5   DREKALDAALAQIERQFGKGAVMRMGDRTNE-PIEVIPTGSTALDVALGVGGIPRGRVVE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  +A AQ  GG VAF+DAEHALDP YA +LGVDID +++SQPD GE
Sbjct: 64  VYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPDNGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S TT IFINQLREKIGVMFG+PETTTGGRALKF+                 + VG    
Sbjct: 184 QSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDIRRIETLKDGTDAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +K+GAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFKQAEFDILYGQGISREGGLIDMGVENGFVRKAGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPI 331
            A+  LK+NPDL  E+E K+++   + +
Sbjct: 304 NARNFLKDNPDLANEIEKKIKQKLGVGV 331


>RECA_STRAM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 372

 Score =  360 bits (923), Expect = e-101
 Identities = 191/328 (58%), Positives = 237/328 (72%), Gaps = 1/328 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE +FGKG++M+ G+   +  I VIPTG+  LD ALG+GG+PRGR++E
Sbjct: 5   DREKALDAALAQIERQFGKGAVMRMGDRSKE-PIEVIPTGSTALDVALGVGGLPRGRVIE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  +A AQ  GG VAF+DAEHALDP YA +LGVDID +++SQPD GE
Sbjct: 64  VYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAQKLGVDIDNLILSQPDNGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S TT IFINQLREKIGVMFG+PETTTGGRALKF+                 + VG    
Sbjct: 184 QSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDIRRIETLKDGTDAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +K+GAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFKQAEFDILYGQGISREGGLIDMGVEHGFVRKAGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPI 331
            A+  LK+NPDL  E+E K++E   + +
Sbjct: 304 NARNFLKDNPDLANEIEKKIKEKLGVGV 331


>RECA_RHOE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  360 bits (923), Expect = e-101
 Identities = 195/338 (57%), Positives = 240/338 (71%), Gaps = 1/338 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L L   QI+  FGKGS+M+ GEG     I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 7   DRDKALDLALAQIDKNFGKGSVMRLGEGVRQ-PIAVIPTGSIALDVALGIGGLPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A AQA GGI AFIDAEHALDP YAA+LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVALHAVANAQANGGIAAFIDAEHALDPDYAAKLGVDTDALLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+++
Sbjct: 126 QALEITDMLIRSGALDIVVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITGAMN 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTVIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDIRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+WYTY  ++LGQG+E
Sbjct: 246 XXXXXXXXAPPFKQAEFDILYGQGISKEGSLIDMGVEHGFIRKSGSWYTYEGDQLGQGKE 305

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
            A++ L EN D+R+           I     +T+EA A
Sbjct: 306 NARKFLLENTDIRDXXXXXXXXXLGIGADVTATDEAPA 343


>RECA_AGRVS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  360 bits (923), Expect = e-101
 Identities = 182/323 (56%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G     + +  + TG+L LD ALGIGG+P+GRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGANEKIVEVETVSTGSLSLDIALGIGGLPKGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GG+ AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGVCAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AEIEGE+GD+  G+QARLMSQALRKL GS+S
Sbjct: 135 QALEITDTLVRSGAIDVLVIDSVAALTPKAEIEGEMGDSLPGMQARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   +FINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG    
Sbjct: 195 RSNCMVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKDREEIVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +K+GAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKAGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NP + +E+ET +R++
Sbjct: 315 NAKIFLRDNPAVADEIETALRQN 337


>RECA_STRRM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 376

 Score =  359 bits (922), Expect = e-101
 Identities = 185/328 (56%), Positives = 227/328 (69%), Gaps = 1/328 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE +FGKG++M+ GE   +  I VIPT +  LD ALG+GG+PRGR+VE
Sbjct: 5   DREKALDAALAQIERQFGKGAVMRMGERSKE-PIEVIPTASTALDVALGVGGIPRGRVVE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  +A AQ  GG VAFIDAEHALDP YA +LGVD D +++SQPD GE
Sbjct: 64  IYGPESSGKTTLTLHAVANAQKAGGSVAFIDAEHALDPEYAKKLGVDTDALILSQPDNGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S TT IFINQLREKIGVMFG+PETTTGGRALKF+                 E VG    
Sbjct: 184 QSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRIDIRRIETLKDGTEAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +KSGAWYTY  ++LGQG+E
Sbjct: 244 CKVVKNKVAPPFKQAEFDILYGQGISREGGLIDMGVEHGFIRKSGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPI 331
            A+  LK+NPDL  E+E K++E   + +
Sbjct: 304 NARNFLKDNPDLANEVEKKIKEKLGVGV 331


>RECA_CLOB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  359 bits (922), Expect = e-101
 Identities = 196/331 (59%), Positives = 245/331 (74%), Gaps = 3/331 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDL-NIGVIPTGALPLDAALGIGGVPRG 59
           +N EK K ++     IE +FGKGS+MK G+  H++ N+  I TG L LD ALGIGGVP+G
Sbjct: 4   INAEKLKAIESAMSHIEKQFGKGSVMKLGD--HNISNMDAISTGCLDLDIALGIGGVPKG 61

Query: 60  RIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQP 119
           RI+E+YGPESSGKTT+AL I AE+Q  GG V +IDAEHALDP YA +LGVD+D ++ISQP
Sbjct: 62  RIIEIYGPESSGKTTIALHIAAESQKKGGAVGYIDAEHALDPSYAQKLGVDVDSLIISQP 121

Query: 120 DTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLA 179
           DTGEQ LEI + LVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKLA
Sbjct: 122 DTGEQGLEIAEALVRSGAIXXXXXXXXXXXXPKAEIEGEMGDSHIGLQARLMSQALRKLA 181

Query: 180 GSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
           G+++K+N   IFINQLREK+GVMFG+PETTTGGRALKF+                  I+G
Sbjct: 182 GTINKTNCVAIFINQLREKVGVMFGSPETTTGGRALKFYASVRLDIRRIDSIKQGDSIIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+QAEFD+MY EGISR G IVD+ V+  + +KSGAW++YG+ RLG
Sbjct: 242 NRTRIKVMKNKVAPPFKQAEFDIMYNEGISRCGNIVDVGVKEEIVQKSGAWFSYGDIRLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIP 330
           QGRE AK  LKENP++  ++E ++RE + +P
Sbjct: 302 QGRENAKLYLKENPEVALDIENQIREKYNLP 332


>RECA_HERA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 358

 Score =  359 bits (921), Expect = e-101
 Identities = 210/324 (64%), Positives = 254/324 (78%), Gaps = 2/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QI+ +FGKG+IM+  +    L+I  IPTG++ LD ALG+GG+PRGR
Sbjct: 3   ISPEKEKALAAALSQIDRQFGKGAIMRMSD--QRLSIEAIPTGSIALDLALGVGGIPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTL   I+AE Q MGG+ AFIDAEHA DPVYAA  GV+++++L+SQPD
Sbjct: 61  VIEIYGPESSGKTTLTQHIVAETQKMGGVAAFIDAEHAFDPVYAANCGVNVEDLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEIC+ LVRSG              PRAEIEG++GD+ VGLQARLMSQALRKL+G
Sbjct: 121 TGEQALEICETLVRSGXXXXXXXXXXXXXXPRAEIEGDMGDSHVGLQARLMSQALRKLSG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKS T  IFINQLR KIGVMFGNPETTTGG ALKF+                 ++ G 
Sbjct: 181 AVSKSRTALIFINQLRMKIGVMFGNPETTTGGNALKFYASVRLDIRKVESIKQGQDVTGX 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEFD+MY EGISREG IVD+ V   + +KSGAW+  G++RLGQ
Sbjct: 241 XXXXXXXXXXXXPPFRQAEFDIMYNEGISREGNIVDVGVTMEILRKSGAWFYLGDDRLGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GRE AKQ LK+NP L +E+E  +R
Sbjct: 301 GRENAKQFLKDNPALADEIEKMIR 324


>RECA_BACLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  359 bits (921), Expect = e-101
 Identities = 211/324 (65%), Positives = 254/324 (78%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  I  +P+G+L LDAALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQT-ETRISTVPSGSLALDAALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQQQGGQAAFIDAEHALDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGNDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGIS+EG I+D+  E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRTAEVDIMYGEGISKEGEIIDLGTELDIVQKSGAWYSYQEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESF 327
            AKQ LKEN D+   ++ ++RE +
Sbjct: 302 NAKQFLKENKDILLMIQEQIREHY 325


>RECA_BACLD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  359 bits (921), Expect = e-101
 Identities = 211/324 (65%), Positives = 254/324 (78%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  I  +P+G+L LDAALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQT-ETRISTVPSGSLALDAALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQQQGGQAAFIDAEHALDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGNDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGIS+EG I+D+  E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRTAEVDIMYGEGISKEGEIIDLGTELDIVQKSGAWYSYQEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESF 327
            AKQ LKEN D+   ++ ++RE +
Sbjct: 302 NAKQFLKENKDILLMIQEQIREHY 325


>RECA_NITWN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  358 bits (920), Expect = e-101
 Identities = 182/323 (56%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE +FGKGS+MK G+    +++ VI +G+L LD ALG+GG+P+GRIVE
Sbjct: 15  DKSKALSAALSQIERQFGKGSVMKLGKNDKSMDVEVISSGSLGLDIALGVGGLPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTLAL  +AEAQ  GGI AFIDAEHALDPVYA +LGV++D++LISQPD GE
Sbjct: 75  VYGPESSGKTTLALHAVAEAQKKGGICAFIDAEHALDPVYARKLGVNVDDLLISQPDHGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD   GLQARLMSQALRKL  S++
Sbjct: 135 QALEIADTLVRSGAVDVLIIDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTASIN 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEGIS+ G I+D+ V+AG+ +KSGAW++Y  +R+GQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGEGISKMGEILDLGVKAGIVEKSGAWFSYDSQRMGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L+ NPD+  ++E  +R++
Sbjct: 315 NAKAFLRANPDITAKVEMAIRQN 337


>RECA_BACP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  358 bits (919), Expect = e-101
 Identities = 201/324 (62%), Positives = 241/324 (74%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   D  I  +P+G+L LD ALGIGG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQT-DTRISTVPSGSLALDTALGIGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQQQGGQAAFIDAEHALDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I+G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGNDIMGNKTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGIS+EG I+D+  E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 IKVVKNKVAPPFRIAEVDIMYGEGISKEGEIIDLGSELDIVQKSGAWYSYQEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESF 327
            AKQ LKEN D+   ++ ++RE +
Sbjct: 302 NAKQFLKENKDILLMIQEQIREHY 325


>RECA_SACEN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  358 bits (918), Expect = e-101
 Identities = 190/326 (58%), Positives = 237/326 (72%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L+L   QI+ ++GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGRIVE
Sbjct: 6   DKGKALELALAQIDKQYGKGSVMRLGDETR-APIEVIPTGSISLDVALGIGGLPRGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKT++AL  +A AQ +GG  AFIDAEHALDP YA  +GVD D +L+SQPDTGE
Sbjct: 65  VYGPESSGKTSVALHAVANAQKLGGTAAFIDAEHALDPEYAKAIGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRKL  +L 
Sbjct: 125 QALEIADMLIRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKLTSALY 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            + TT IFINQLREK+GVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 185 NAKTTAIFINQLREKVGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGSDAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++DM VE G+ +KSGAWYTY  ++LGQG+E
Sbjct: 245 XXXXXXXXAPPFKQAEFDIIYGIGISREGSLIDMGVEQGIIRKSGAWYTYEGDQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
            A++ ++ENPD+  E+E +++E   I
Sbjct: 305 NARKFMRENPDVANEIEKRIKEKLGI 330


>RECA_NOCSJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  358 bits (918), Expect = e-101
 Identities = 193/339 (56%), Positives = 242/339 (71%), Gaps = 2/339 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L      IE +FGKGS+M+ G+      + +IP+G++ LD ALG+GG PRGR+VE
Sbjct: 5   DREKALDAALANIEKQFGKGSVMRLGDEVR-APLEIIPSGSIALDVALGLGGFPRGRVVE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A AQ  GGIVAFIDAEHALDP YA  LGVD D +L+SQPD+GE
Sbjct: 64  IYGPESSGKTTVALHAVANAQRAGGIVAFIDAEHALDPDYAKNLGVDTDALLVSQPDSGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 124 QALEIADMLIRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 ++VG    
Sbjct: 184 NSKTTMIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDMVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD+MYG+GISREG ++D+ VEAG+ +K+GAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFKQAEFDIMYGKGISREGGLIDVGVEAGLVRKAGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEI-PIITRSTEEADA 341
            A+  L++NPDL  ELE K+ E   + P + +   E  A
Sbjct: 304 NARAFLRDNPDLANELEKKILEKLGVGPTVDQDVAELPA 342


>RECA_MESSB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 360

 Score =  358 bits (918), Expect = e-101
 Identities = 195/323 (60%), Positives = 237/323 (73%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE  FGKGSIM+ G     + I  I TG+L LD ALG+GG+PRGRI+E
Sbjct: 15  DKSKALDAALSQIERAFGKGSIMRLGANDKVVEIETISTGSLGLDIALGVGGLPRGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GGI  FIDAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTVAEAQKKGGICGFIDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEICD LVRSG              PRAEIEGE+G++  G+QARLMSQALRKL  S+S
Sbjct: 135 QALEICDTLVRSGXXXXXXXXXXXXLTPRAEIEGEMGESLPGMQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E VG    
Sbjct: 195 RSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDREETVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AGV +K+GAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGVVEKAGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NP++  E+E  +R++
Sbjct: 315 NAKLFLRDNPEVAREIELALRQN 337


>RECA_SYNAS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  357 bits (917), Expect = e-101
 Identities = 194/335 (57%), Positives = 239/335 (71%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +++K + L   QIE +FGKGSIM+ G      +I VIPTGAL LD ALGIGGVPRGRI+E
Sbjct: 6   DRAKAVDLAISQIERQFGKGSIMRLGAKERIEDIAVIPTGALSLDIALGIGGVPRGRIIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPES GKTTLAL IIAEAQ   G+ AFIDAEHALD  YA ++GV+ D++LISQPDTGE
Sbjct: 66  IFGPESGGKTTLALHIIAEAQKRNGLAAFIDAEHALDVSYARKIGVNTDDLLISQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD  +GLQARLMSQALRKL GS+S
Sbjct: 126 QALEIAETLVRSGALDILVVDSVAALVPKAEIEGEMGDAQMGLQARLMSQALRKLTGSIS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNTT IFINQLR KIGV FGNPETTTGG ALKF+                 +++G    
Sbjct: 186 KSNTTVIFINQLRMKIGVFFGNPETTTGGNALKFYASMRLDIRKSGSIKSGQDVIGMRTX 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+++GEGIS+ G I+D+A E+G+ +KSGAWY+YG ER+GQGR+
Sbjct: 246 XXXXXXXXAPPFRETEFDILFGEGISKAGDILDLAAESGIVEKSGAWYSYGGERIGQGRD 305

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
             +  LKE+PD+   +E +VR    +    +  EE
Sbjct: 306 NTRNFLKEHPDILVRIEEQVRSEHGLKPRLQEQEE 340


>RECA_BACSU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  357 bits (916), Expect = e-101
 Identities = 210/324 (64%), Positives = 253/324 (78%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   D  I  +P+G+L LD ALGIGG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEKT-DTRISTVPSGSLALDTALGIGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA +LGV+I+E+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQQQGGQAAFIDAEHALDPVYAQKLGVNIEELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGNDVMGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGIS+EG I+D+  E  + +KSG+WY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRTAEVDIMYGEGISKEGEIIDLGTELDIVQKSGSWYSYEEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESF 327
            AKQ LKEN D+   ++ ++RE +
Sbjct: 302 NAKQFLKENKDIMLMIQEQIREHY 325


>RECA_RHOPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  357 bits (915), Expect = e-100
 Identities = 185/346 (53%), Positives = 237/346 (68%), Gaps = 4/346 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE +FGKGS+M+ G+    ++I  I +G+L LD ALG+GG+P+GRIVE
Sbjct: 2   DKSKALSAALSQIERQFGKGSVMRLGKNDRSMDIETISSGSLGLDIALGVGGLPKGRIVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GGI AF+DAEHALDPVYA +LGV++D++LISQPD GE
Sbjct: 62  IYGPESSGKTTLALHCVAEAQKKGGICAFVDAEHALDPVYARKLGVNVDDLLISQPDHGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD   GLQARLMSQALRKL  S++
Sbjct: 122 QALEIADTLVRSGAIDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTASIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG    
Sbjct: 182 KSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G I+D+ V+AG+ +KSGAW+++  +RLGQGRE
Sbjct: 242 VKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSHDSQRLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEI---PIITRSTE-EADAMSPV 345
            AK  LK NPD+  ++E  +R++  +    I+  S E +AD   P+
Sbjct: 302 NAKAFLKANPDMTAKIEAAIRQNSGLIAEQILAGSPESDADGEEPM 347


>RECA_CHRVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  357 bits (915), Expect = e-100
 Identities = 204/350 (58%), Positives = 258/350 (73%), Gaps = 4/350 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E + K L     QIE +FGKGS+M+ G+ G   NI  I TG+L LD ALGIGGVP+GR
Sbjct: 1   MDENRKKALAAALTQIEKQFGKGSVMRMGDVGAVRNIEAISTGSLGLDLALGIGGVPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTL L IIAE+Q +GG  AF+DAEHALDPVYA +LGV++ ++L+SQPD
Sbjct: 61  VIEIYGPESSGKTTLTLHIIAESQKLGGTAAFVDAEHALDPVYAEKLGVNMTDLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 121 TGEQALEITDMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G 
Sbjct: 181 NIKRSNCCVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAIKKGDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEFD++YG+GISREG I+D+ V  G   KSGAWY+Y   R+GQ
Sbjct: 241 ETXXXXXXXXXAPPFRQAEFDILYGQGISREGEIIDLGVAEGFIDKSGAWYSYDGNRIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAK 350
           G++  +  L ENP + + +E ++R+     ++ +   EA A + V +P++
Sbjct: 301 GKDNVRNFLCENPGIAQAIEARIRDK----LLPKGGVEAPAEADVPEPSE 346


>RECA_BACA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  356 bits (914), Expect = e-100
 Identities = 198/324 (61%), Positives = 241/324 (74%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   D  I  +P+G+L LD ALGIGG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEKT-DTRISTVPSGSLALDTALGIGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA +LGV+I+E+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQEKGGQAAFIDAEHALDPVYAQKLGVNIEELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +++G    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGNDVMGNKTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGIS+EG I+D+  E  + +KSG+WY+Y EERLGQGRE
Sbjct: 242 IKVVKNKVAPPFRTAEVDIMYGEGISKEGEIIDLGTELDIVQKSGSWYSYEEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESF 327
            AKQ LKEN D+   ++ ++RE +
Sbjct: 302 NAKQFLKENKDIMLMIQEQIREYY 325


>RECA_ARTAT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  356 bits (914), Expect = e-100
 Identities = 186/335 (55%), Positives = 234/335 (69%), Gaps = 3/335 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+    QI+ +FGKGSIM+ G+      I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 6   DREKALEAALAQIDKQFGKGSIMRLGDDTR-APIEVIPTGSIALDVALGIGGLPRGRVVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDP YAA+LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTVALHAVANAQRAGGIAAFIDAEHALDPDYAAKLGVDTDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLV SG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G LS
Sbjct: 125 QALEIMDMLVGSGSLDIVVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITGRLS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++ TT IFINQLREKIGV FG+PETTTGG+ALKF+                 + VG    
Sbjct: 185 QTKTTAIFINQLREKIGVFFGSPETTTGGKALKFYASVRIDVRRIQTLKEGADSVGNRTK 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AEFD++YG+GISREG I+DM VE G+ KKSG+W+TY  ++LGQG E
Sbjct: 245 AKIVKNKMAPPFKIAEFDIIYGQGISREGGIIDMGVEHGIIKKSGSWFTYDGDQLGQGME 304

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
            +++ L++NP+L +ELE  ++E   + ++   TEE
Sbjct: 305 NSRRFLRDNPELAQELERLIKEKLGVGVV--KTEE 337


>RECA_OCEIH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  356 bits (913), Expect = e-100
 Identities = 199/338 (58%), Positives = 245/338 (72%), Gaps = 1/338 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L +   QIE +FGKGSIMK GE      I  IP+G+L LD ALGIGG PRGR+VE
Sbjct: 3   DRKQALDMALRQIEKQFGKGSIMKMGENEIP-KIATIPSGSLALDVALGIGGYPRGRVVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  IAEAQ  GG  AFIDAEHALDPVYA  LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVALHAIAEAQKQGGQAAFIDAEHALDPVYAKALGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS TT IFINQ+REK+GVMFGNPETT GGRALKF+                 + VG    
Sbjct: 182 KSKTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAETLKLGNDAVGNKAR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAE D+MYG+GIS+EG ++D+  +  +  KSGAWY+Y  +RLGQGRE
Sbjct: 242 IKVVKNKVAPPFKQAEVDIMYGKGISKEGEVLDIGSDLDIVMKSGAWYSYNNDRLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
            AKQ LKE+ ++  E+   +R+ +E+  +     E +A
Sbjct: 302 NAKQYLKEHEEVLTEIHQSIRQHYELDKVDEDKTEEEA 339


>RECA_NITHX RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  356 bits (913), Expect = e-100
 Identities = 179/323 (55%), Positives = 227/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE +FGKGS+MK G+    ++I VI +G+L LD ALG+GG+P+GR+VE
Sbjct: 15  DKSKALSAALSQIERQFGKGSVMKLGKNDKSMDIEVISSGSLGLDIALGVGGLPKGRVVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GGI AFIDAEHALDP+YA +LGV +D++LISQPD GE
Sbjct: 75  IYGPESSGKTTLALHTVAEAQKKGGICAFIDAEHALDPIYARKLGVKVDDLLISQPDHGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD   GLQARLMSQALRKL  S++
Sbjct: 135 QALEIADTLVRSGAVDVLIIDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTASIN 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEGIS+ G I+D+ V+AG+ +KSGAW+++  +R+GQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGEGISKMGEILDLGVKAGIVEKSGAWFSHDSQRMGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L+ NPD+  ++E  +R++
Sbjct: 315 NAKAFLRANPDITAKIEVAIRQN 337


>RECA_METNO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  356 bits (913), Expect = e-100
 Identities = 189/326 (57%), Positives = 238/326 (73%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+++KSK +     QIE  FGKGSIM+ G+G     +  I TG+L LD ALG+GG+PRGR
Sbjct: 14  MDKDKSKAIDAALAQIERAFGKGSIMRLGKGDKVQEVETISTGSLGLDIALGVGGLPRGR 73

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTLAL  IAEAQ  GG+ AF+DAEHALDPVYA +LGV++D++LISQPD
Sbjct: 74  VIEIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPD 133

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              PRAEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 134 TGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDQQPGLQARLMSQALRKLTG 193

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S+S+SN   IFINQ+R KIGVM+G+PETTTGG ALKF+                 E +G 
Sbjct: 194 SISRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRVSTLKDRDEPIGN 253

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q EFD+M+GEG+S+ G ++D+ V+AG+ +KSGAW++Y  +RLGQ
Sbjct: 254 SXXXXXXXXXXAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQ 313

Query: 301 GREAAKQTLKENPDLREELETKVRES 326
           GRE AK  L++NPD+   +E  +R++
Sbjct: 314 GRENAKGFLRDNPDIAGRIEAAIRQN 339


>RECA_SALAI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  355 bits (912), Expect = e-100
 Identities = 193/322 (59%), Positives = 237/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L L   QI+ +FGKGS+M+ GE    +   V+PTG++ LD ALG+GG+PRGR++E
Sbjct: 6   DRERALDLALAQIDKQFGKGSVMRLGERPV-VQTAVVPTGSIALDVALGVGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  +A AQ  GGI AF+DAEHALDP YA  LGVD D +L+SQPDTGE
Sbjct: 65  VYGPESSGKTTVALHAVANAQRAGGIAAFVDAEHALDPEYARALGVDTDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G LS
Sbjct: 125 QALEIADMLVRSGALDIIIIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGVLS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            + TT IFINQLREKIGVMFG+PETTTGGRALKF+                 +       
Sbjct: 185 NTGTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDVRRIESLKDGTDXXXXXXX 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD+MYG+GISREG ++D+ VE  + +KSGAWYTY  ++LGQG+E
Sbjct: 245 XXXXXXXXAAPFKQAEFDIMYGKGISREGSLIDVGVEQAIIRKSGAWYTYEGDQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKVRE 325
            A++ L+ENPD+  E+E K+ E
Sbjct: 305 KAREFLRENPDVAAEIEKKILE 326


>RECA_PROAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  355 bits (912), Expect = e-100
 Identities = 181/320 (56%), Positives = 224/320 (70%), Gaps = 1/320 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE + GKGSIM+ GE    + I  IPTG++ LD ALG+GG+PRGRIVE
Sbjct: 6   DREKALATALQQIEKQHGKGSIMRLGEQ-ETVKIAAIPTGSVALDVALGVGGLPRGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  IA AQA GGI AFIDAEHALDP YA +LGVD D +L+SQPD GE
Sbjct: 65  IYGPESSGKTTVALHAIANAQAEGGICAFIDAEHALDPEYARKLGVDTDSLLVSQPDNGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADTLVRSGALELIVVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            + TT IFINQLREKIGVMFG+PETTTGGRALKF+                 E+VG    
Sbjct: 185 AAGTTAIFINQLREKIGVMFGSPETTTGGRALKFYSSVRLDVRRVETLKDGSEMVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM V+ G+  KSG+W++Y  E+LGQG+E
Sbjct: 245 VKVAKNKVAPPFKQAEFDILYGQGISREGSLIDMGVDCGIITKSGSWFSYNNEQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKV 323
             ++ L+ NPD+  E+E K+
Sbjct: 305 NVRKFLRGNPDVANEIEDKI 324


>RECA_BACWK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  355 bits (911), Expect = e-100
 Identities = 198/322 (61%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  I  I +G+L LD ALG+GG PRGR++E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRISTISSGSLALDVALGVGGYPRGRVIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   VRE
Sbjct: 302 NSKQFLKENTDLREEIAFFVRE 323


>RECA_SALTO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  355 bits (910), Expect = e-100
 Identities = 192/322 (59%), Positives = 237/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L L   QI+ +FGKGS+M+ GE    +   V+PTG++ LD ALG+GG+PRGR++E
Sbjct: 6   DRERALDLALAQIDKQFGKGSVMRLGERPV-VETAVVPTGSIALDVALGVGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  +A AQ  GGI AF+DAEHALDP YA  LGVD D +L+SQPDTGE
Sbjct: 65  VYGPESSGKTTVALHAVANAQRSGGIAAFVDAEHALDPEYARALGVDTDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G LS
Sbjct: 125 QALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGVLS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            + TT +FINQLREKIGVMFG+PETTTGGRALKF+                 +       
Sbjct: 185 HTGTTAVFINQLREKIGVMFGSPETTTGGRALKFYASVRLDVRRIESLKDGTDXXXXXXX 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD+MYG+GISREG ++D+ VE  + +KSGAWYTY  ++LGQG+E
Sbjct: 245 XXXXXXXXAAPFKQAEFDIMYGKGISREGSLIDVGVEQAIIRKSGAWYTYEGDQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKVRE 325
            A++ L+ENPD+  E+E K+ E
Sbjct: 305 KAREFLRENPDVAAEIEKKILE 326


>RECA_CORU7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 371

 Score =  355 bits (910), Expect = e-100
 Identities = 185/344 (53%), Positives = 236/344 (68%), Gaps = 3/344 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++SK L L   QIE  FGKG+IM+ G+      I  IP+G + ++ ALGIGG PRGR+VE
Sbjct: 14  DRSKALDLAMAQIEKDFGKGAIMRLGDENRP-PISAIPSGNIAINVALGIGGFPRGRVVE 72

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  IAEAQ  GGI AFIDAEHALDP YA  LGVD D +L+SQPDTGE
Sbjct: 73  IYGPESSGKTTVALHAIAEAQKGGGIAAFIDAEHALDPEYAKALGVDTDALLVSQPDTGE 132

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              P+AEI+GE+GD+ VGLQARLMSQALRK+  +L 
Sbjct: 133 QALEIADMLVRSGAIDMVVIDSVAALTPKAEIDGEMGDSHVGLQARLMSQALRKMTSALY 192

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++ TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 ++VG    
Sbjct: 193 QTGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDIRRIQALKDGQDVVGNRTR 252

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AEFD++YGEGISREG I+D+ V+AG+ KKSG+W+TY  E+LGQG+E
Sbjct: 253 LKIVKNKVSPPFKIAEFDILYGEGISREGSILDLGVDAGIIKKSGSWFTYEGEQLGQGKE 312

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEE--ADAMSPV 345
            A+  LK NP+L E+L+ ++ +  ++    ++ +E  AD   P+
Sbjct: 313 KARDFLKSNPELAEQLDDRIMQELKVGPYAKAKDEPIADEDQPI 356


>RECA_GEOMG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 339

 Score =  354 bits (909), Expect = e-100
 Identities = 191/330 (57%), Positives = 238/330 (72%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +E+ K ++L   QIE +FGKG+IM+ G      +I  IPTGAL LD ALG+GGVPRGR
Sbjct: 1   MTQEREKAIELALSQIEKQFGKGAIMRLGADEALPDIDAIPTGALSLDIALGVGGVPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTLAL I AEAQ +GGI AF+DAEHALD  YA +LGV  D++L+SQPD
Sbjct: 61  VIEIYGPESSGKTTLALHIAAEAQKLGGIAAFVDAEHALDIGYARKLGVRTDDLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI +MLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 121 TGEQALEIAEMLVRSGAVDVLVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SKSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  ++G 
Sbjct: 181 IISKSNCCVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRKIATLKQGDAVIGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+ EFD+ YGEGISR G ++D+AV+  +  KSGAW++YG +R+GQ
Sbjct: 241 RTXXXXXXXXXAPPFREVEFDIYYGEGISRLGDLLDLAVDRKIIDKSGAWFSYGSDRIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIP 330
           GRE ++  LKE+P++  E+E K+ E+  IP
Sbjct: 301 GRENSRNFLKEHPEMVAEIEDKIYETAGIP 330


>RECA_BACCR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 196/322 (60%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  + +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRVSTVSSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   +RE
Sbjct: 302 NSKQFLKENTDLREEIAFFIRE 323


>RECA_BACC4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 196/322 (60%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  + +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRVSTVSSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   +RE
Sbjct: 302 NSKQFLKENTDLREEIAFFIRE 323


>RECA_BACC3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 196/322 (60%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  + +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   +RE
Sbjct: 302 NSKQFLKENTDLREEIAFFIRE 323


>RECA_BACC2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 198/322 (61%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  I  I +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERRISTISSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   VR+
Sbjct: 302 NSKQFLKENTDLREEIAFFVRD 323


>RECA_BACC1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 196/322 (60%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  + +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   +RE
Sbjct: 302 NSKQFLKENTDLREEIAFFIRE 323


>RECA_BACAN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 196/322 (60%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  + +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   +RE
Sbjct: 302 NSKQFLKENTDLREEIAFFIRE 323


>RECA_BACAH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  354 bits (909), Expect = e-100
 Identities = 196/322 (60%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE   +  +  + +G+L LD ALG+GG PRGRI+E
Sbjct: 3   DRQAALDMALKQIEKQFGKGSIMKLGEQA-ERKVSTVSSGSLALDVALGVGGYPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GG  AFIDAEHA+DPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  IYGPESSGKTTVSLHAIAEVQRQGGQAAFIDAEHAMDPVYAQKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI + LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QGLEIAEALVRSGAVDIIVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +I      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTVRLEVRRAEQLKQGNDIXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG I+DMA E  + +KSGAWY+Y EERLGQGRE
Sbjct: 242 XXXXXXXXAPPFRVAEVDIMYGEGISREGEILDMASELDIVQKSGAWYSYNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKEN DLREE+   +RE
Sbjct: 302 NSKQFLKENTDLREEIAFFIRE 323


>RECA_PORGI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  354 bits (908), Expect = e-100
 Identities = 177/325 (54%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           +E+K + L++ T++IE  FGKG+IM  G    + ++ VIP+G++ LD ALG+GG PRGRI
Sbjct: 11  DEKKLQALRMATEKIEKTFGKGAIMNMGANTVE-DVSVIPSGSIGLDLALGVGGYPRGRI 69

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLA+  IAEAQ  GG+ A IDAEHA D  YA +LGV++D + I+QPD 
Sbjct: 70  IEIYGPESSGKTTLAIHAIAEAQKAGGLAAIIDAEHAFDRTYAEKLGVNVDNLWIAQPDN 129

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI + L+RS               P+AEIEGE+GD  VGL ARLMSQALRK+ G+
Sbjct: 130 GEQALEIAEQLIRSSAVDIIVIDSVAALTPKAEIEGEMGDNKVGLHARLMSQALRKMTGA 189

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SKSNTTCIFINQLREKIGV+FGNPETTTGG ALKF+                 EI+G  
Sbjct: 190 ISKSNTTCIFINQLREKIGVLFGNPETTTGGNALKFYASIRIDIRKSTPIKDGEEIMGHL 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+AEFD+++GEGISR G I+D+ VE  + KKSG+W++YG+ +LGQG
Sbjct: 250 TKVKVLKNKVAPPFRKAEFDIVFGEGISRSGEIIDLGVELDIIKKSGSWFSYGDTKLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRES 326
           REAAK+ +++N +L EEL  K+RE+
Sbjct: 310 REAAKEMIRDNEELAEELTEKIREA 334


>RECA_PORG3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  354 bits (908), Expect = e-100
 Identities = 177/325 (54%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           +E+K + L++ T++IE  FGKG+IM  G    + ++ VIP+G++ LD ALG+GG PRGRI
Sbjct: 11  DEKKLQALRMATEKIEKTFGKGAIMNMGANTVE-DVSVIPSGSIGLDLALGVGGYPRGRI 69

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLA+  IAEAQ  GG+ A IDAEHA D  YA +LGV++D + I+QPD 
Sbjct: 70  IEIYGPESSGKTTLAIHAIAEAQKAGGLAAIIDAEHAFDRTYAEKLGVNVDNLWIAQPDN 129

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI + L+RS               P+AEIEGE+GD  VGL ARLMSQALRK+ G+
Sbjct: 130 GEQALEIAEQLIRSSAVDIIVIDSVAALTPKAEIEGEMGDNKVGLHARLMSQALRKMTGA 189

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SKSNTTCIFINQLREKIGV+FGNPETTTGG ALKF+                 EI+G  
Sbjct: 190 ISKSNTTCIFINQLREKIGVLFGNPETTTGGNALKFYASIRIDIRKSTPIKDGEEIMGHL 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+AEFD+++GEGISR G I+D+ VE  + KKSG+W++YG+ +LGQG
Sbjct: 250 TKVKVLKNKVAPPFRKAEFDIVFGEGISRSGEIIDLGVELDIIKKSGSWFSYGDTKLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRES 326
           REAAK+ +++N +L EEL  K+RE+
Sbjct: 310 REAAKEMIRDNEELAEELTEKIREA 334


>RECA_BACTN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 330

 Score =  354 bits (908), Expect = e-100
 Identities = 206/325 (63%), Positives = 248/325 (76%), Gaps = 1/325 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           + EK K L+ T ++IE  FGKGSIMK G+   +  + VIPTG++ L+ ALG+GG PRGRI
Sbjct: 3   SSEKLKALQATMEKIEKNFGKGSIMKMGDDSVE-QVEVIPTGSIALNVALGVGGYPRGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLA+  IAEAQ  GGI AFIDAEHA D  YAA+LGVD+D + ISQPD 
Sbjct: 62  IEIYGPESSGKTTLAIHAIAEAQKAGGIAAFIDAEHAFDRFYAAKLGVDVDNLWISQPDN 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI + L+R                P+AEIEG++GD  VGLQARLMSQALRKL G+
Sbjct: 122 GEQALEIAEQLIRXXXXXXXXXXXXXXLTPKAEIEGDMGDNKVGLQARLMSQALRKLTGT 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SK+ TTCIFINQLREKIGVMFGNPETTTGG ALKF+                 E     
Sbjct: 182 VSKTRTTCIFINQLREKIGVMFGNPETTTGGNALKFYASVRIDIRGSQPIKDGEEXXXXX 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+AEFD+M+GEGIS  G I+D+  E G+ KKSG+WY+Y + +LGQG
Sbjct: 242 XXXXXXXXXXAPPFRKAEFDIMFGEGISHSGEIIDLGAELGIIKKSGSWYSYNDTKLGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRES 326
           R+AAK  +K+NP+L EELE  + E+
Sbjct: 302 RDAAKVCIKDNPELAEELEGLIFEA 326


>RECA_BACFR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 318

 Score =  354 bits (908), Expect = e-100
 Identities = 189/312 (60%), Positives = 229/312 (73%), Gaps = 1/312 (0%)

Query: 14  DQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           D+IE  FGKGSIMK GE   +  + VIPTG++ L+AALG+GG PRGRI+E+YGPESSGKT
Sbjct: 2   DKIEKSFGKGSIMKMGEEVVE-QVEVIPTGSIALNAALGVGGYPRGRIIEIYGPESSGKT 60

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TLA+  IAEAQ  GGI AFIDAEHA D  YAA+LGVD+D + ISQPD GEQALEI + L+
Sbjct: 61  TLAIHAIAEAQKAGGIAAFIDAEHAFDRFYAAKLGVDVDNLFISQPDNGEQALEIAEQLI 120

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEG++GD  VGLQARLMSQALRKL  ++SK+ TTCIFIN
Sbjct: 121 RSSAIDIIVVDSVAALTPKAEIEGDMGDNKVGLQARLMSQALRKLTSAVSKTRTTCIFIN 180

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           QLREKIGVMFGNPETTTGG ALKF+                 E++G              
Sbjct: 181 QLREKIGVMFGNPETTTGGNALKFYASVRLDIRGSQQIKDGEEVIGKQTXXXXXXXXXAP 240

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FR+AEFD+M+GEGIS  G I+D+  + G+ KKSG+WY+Y + +LGQGR+AAKQ + +NP
Sbjct: 241 PFRKAEFDIMFGEGISHSGEIIDLGADLGIIKKSGSWYSYNDTKLGQGRDAAKQCIADNP 300

Query: 314 DLREELETKVRE 325
           +L EELE  + E
Sbjct: 301 ELAEELEGLIFE 312


>RECA_THICR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  353 bits (907), Expect = e-99
 Identities = 191/340 (56%), Positives = 247/340 (72%), Gaps = 1/340 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L+    QIE +FGKGSIM+ G+ G   +I  + TG+L LD ALGIGG+PRGR
Sbjct: 1   MDENKKKALEAALGQIEKQFGKGSIMRMGDKGAIRDIDSVSTGSLGLDVALGIGGLPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL L  IAE Q MGG  AF+DAEHALDP+YA +LGVDID +L+SQPD
Sbjct: 61  VVEIYGPESSGKTTLTLHAIAEMQKMGGTAAFVDAEHALDPIYAEKLGVDIDNLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  
Sbjct: 121 TGEQALEITDSLVRSGXXXXXXXXXXXXLTPKAEIEGDMGDSHMGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 EI+G 
Sbjct: 181 NIKRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEILGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q EF+++YG+GISREG ++D+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 241 ETRVKVVKNKVSPPFKQVEFEILYGQGISREGEVIDLGVKEKLIEKAGAWYSYQGQKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRES-FEIPIITRSTEEA 339
           G++  +Q LK+NPD+ E L+ +++E     P   ++T+EA
Sbjct: 301 GKDNVRQFLKDNPDIYETLQVQIKERLMPKPNAPKATDEA 340


>RECA_SYMTH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  353 bits (907), Expect = e-99
 Identities = 195/346 (56%), Positives = 247/346 (71%), Gaps = 5/346 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K + +   QIE +FGKGSIM+ GE    LN+ VIPTG++ LD ALG+GG+PRGR
Sbjct: 3   LDPAKQKAIDMALAQIEKQFGKGSIMRLGEQMSRLNVEVIPTGSVALDVALGVGGLPRGR 62

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I E+YGPESSGKTT+AL +IAEAQ MGG+ AF+DAEHALDPVYA  LGVDID +L+SQPD
Sbjct: 63  ITEIYGPESSGKTTVALHVIAEAQKMGGVAAFVDAEHALDPVYAQALGVDIDNLLVSQPD 122

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI +                    P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 123 TGEQALEITETXXXXXXXXXXXXXXXXXXXPKAEIEGEMGDSFVGLQARLMSQALRKLTG 182

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKS    IFINQ+REK+GVMFGNPETT GGRALKF+                 E+VG 
Sbjct: 183 AISKSKAVVIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRKTETLKSGQEVVGS 242

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAG--VAKKSGAWYTYGEERL 298
                         F+QAEFD++YG+GIS+EG ++D+  E    V  KSGAWY+YG+ R+
Sbjct: 243 RTRVKVVKNKVAPPFKQAEFDILYGQGISKEGSLIDIGTELNPPVIVKSGAWYSYGDLRI 302

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEI---PIITRSTEEADA 341
           GQG++ A+  L+++P++  E+E K++E   +   P+     E  DA
Sbjct: 303 GQGKDNARDWLRQHPEVAAEIEQKIKERLNVASLPVKYADEEAGDA 348


>RECA_EXISA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  353 bits (906), Expect = 1e-99
 Identities = 180/324 (55%), Positives = 227/324 (70%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L++   QIE +FGKGSIM+ GE   D  + VIP+G++ LD ALG GG PRGR++E
Sbjct: 3   DRKQALEMALRQIEKQFGKGSIMRLGENT-DQQVSVIPSGSIALDVALGAGGYPRGRVIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AF+DAEHALDP YA  LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQKRGGQAAFVDAEHALDPKYAKNLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL+G+ +
Sbjct: 122 QALEIAEALVRSGAVDILVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLSGATN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REKIG+MFGNPETT GGRALKF+                 ++VG    
Sbjct: 182 KSKTIVIFINQIREKIGIMFGNPETTPGGRALKFYSSVRLEVRRAETLKQGQDMVGNRTK 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AE D+MYGEGISREG ++D+  +  + +KSGAWY++ EERLGQGRE
Sbjct: 242 IKIVKNKIAPPFKTAEVDIMYGEGISREGELIDIGADLDIVQKSGAWYSFNEERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESF 327
            AKQ +KENP +  E+E ++R+ +
Sbjct: 302 NAKQYMKENPAIAAEVEQQIRDHY 325


>RECA_BACSK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  353 bits (906), Expect = 1e-99
 Identities = 182/322 (56%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L +    IE +FGKGSIMK GE      +  + +G L LD ALG+GG P+GR++E
Sbjct: 3   DRKQALDMALRHIEKQFGKGSIMKLGEQAEQ-RVSTVSSGTLALDIALGVGGYPKGRVIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA++LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQRNGGQAAFIDAEHALDPVYASKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGALDIIVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG    
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEALKQGNEIVGNRTK 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AE D+MYGEGISREG ++D+A E  + +KSGAWY+Y  +RLGQGRE
Sbjct: 242 IKVVKNKVAPPFRLAEVDIMYGEGISREGSMLDIASELDIVEKSGAWYSYKGDRLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            +KQ LKENP++  E+E  +R+
Sbjct: 302 NSKQFLKENPEITAEIERLIRD 323


>RECA_SYNFM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  352 bits (904), Expect = 2e-99
 Identities = 197/327 (60%), Positives = 240/327 (73%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ + +     QIE   GKG+IM+ GEG  ++ I VI TG L LD ALGIGGV RGRI+
Sbjct: 5   DERQRAIDTAVSQIERMCGKGAIMRLGEGAQNVEIPVISTGCLSLDLALGIGGVARGRIM 64

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTLAL ++AEAQ +GG+ AFIDAEHALD  YA +LGV ++++LISQPD G
Sbjct: 65  EIFGPESSGKTTLALHVVAEAQKLGGLAAFIDAEHALDVNYARKLGVQVEDLLISQPDYG 124

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI ++LVRS               P+AEIEGE+GD  VGLQARLMSQALRKL  S+
Sbjct: 125 EQALEIAEILVRSNXXXXXXXXXXXXXXPKAEIEGEMGDPHVGLQARLMSQALRKLVSSI 184

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKS T  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG   
Sbjct: 185 SKSRTCVIFINQIRMKIGVMYGSPETTTGGNALKFYATMRLDIRRVGPIKDGQEVVGNRT 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR+ EFD++YG GISREG I+D+AVE+G  +KSG WY+Y  ERLGQGR
Sbjct: 245 RVKVVKNKIAPPFREVEFDVVYGRGISREGDILDLAVESGAIEKSGTWYSYSGERLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRESFEI 329
           E AK  L+E+PDL  ELE K+RE+  +
Sbjct: 305 ENAKNFLREHPDLLGELERKLREAHNL 331


>RECA_KINRD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  352 bits (904), Expect = 2e-99
 Identities = 191/326 (58%), Positives = 234/326 (71%), Gaps = 1/326 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR+VE+YGPESSGKTT+AL  
Sbjct: 22  FGKGSVMRLGDEVRP-PIEVIPTGSISLDVALGIGGLPRGRVVEIYGPESSGKTTVALHA 80

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           +A AQ  GGI AFIDAEHALDP YAA+LGVD D +L+SQPDTGEQALEI DML+RSG   
Sbjct: 81  VASAQKAGGIAAFIDAEHALDPDYAAKLGVDTDALLVSQPDTGEQALEIADMLIRSGALD 140

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L+ S TT IFINQLREKI
Sbjct: 141 IIVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKITGALNHSGTTAIFINQLREKI 200

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GVMFG+PETTTGG+ALKF+                   VG               F+QAE
Sbjct: 201 GVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTNPVGNRTRXXXXXXXXSPPFKQAE 260

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
           FD++YG+GISREG ++D+ VE G  +KSGAWYTY  ++LGQG+E A+  L++NPDL +E+
Sbjct: 261 FDIIYGQGISREGGLIDLGVEHGFVRKSGAWYTYEGDQLGQGKENARAFLRDNPDLGDEI 320

Query: 320 ETKVRESFEIPIITRSTEEADAMSPV 345
           E +++E   I     +  E D    V
Sbjct: 321 EKRIKEKLGIGARLDAPAEVDVEEKV 346


>RECA_ARTCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  352 bits (904), Expect = 2e-99
 Identities = 186/348 (53%), Positives = 237/348 (68%), Gaps = 6/348 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +++K L+    QI+ +FGKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 6   DRAKALEAALAQIDKQFGKGSVMRLGDEVR-APIEVIPTGSIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDP YAA+LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTVALHAVANAQRAGGIAAFIDAEHALDPDYAAKLGVDTDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLV SG              PRAEIEG++GD+ VGLQARLMSQALRK+ G LS
Sbjct: 125 QALEIMDMLVGSGSLDIVVIDSVAALVPRAEIEGDMGDSHVGLQARLMSQALRKITGRLS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++ TT IFINQLREKIGV FG+PETTTGG+ALKF+                 + VG    
Sbjct: 185 QTKTTAIFINQLREKIGVFFGSPETTTGGKALKFYASVRIDVRRIQTLKEGADSVGNRTK 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AEFD++YG+GISREG I+DM VE G+ KKSG+W+TY  ++LGQG E
Sbjct: 245 AKIVKNKMAPPFKIAEFDIIYGQGISREGGIIDMGVEHGIIKKSGSWFTYDGDQLGQGME 304

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKK 351
            +++ L++NP+L  ELE  ++E   + +     + ADA S    P  K
Sbjct: 305 NSRRFLRDNPELAAELERLIKEKLGVGV-----KPADAESKEDSPKLK 347


>RECA_THETN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 342

 Score =  351 bits (901), Expect = 5e-99
 Identities = 183/306 (59%), Positives = 220/306 (71%), Gaps = 1/306 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L++   QIE +FGKG+IM+ G+    LN+ VIPTG+L LD ALG+GGVPRGRI+E
Sbjct: 4   EKQKALEMAISQIERQFGKGAIMRLGDTAK-LNVEVIPTGSLELDIALGVGGVPRGRIIE 62

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLAL +IAEAQ +GG  AFIDAEHALDPVYA  LGV+ID++L++QPDTGE
Sbjct: 63  IFGPESSGKTTLALHMIAEAQKIGGTGAFIDAEHALDPVYAKNLGVNIDDLLVAQPDTGE 122

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKLAG  S
Sbjct: 123 QALEIAEALVRSGAVDIIVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLAGVTS 182

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS +  +FINQLREK+GVMFGNPETT GGRALKF+                 EIVG    
Sbjct: 183 KSKSIVVFINQLREKVGVMFGNPETTPGGRALKFYATIRLDVRKVDNIKQGNEIVGSRTR 242

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD+MYGEGISREG I+D+     + +KSG+WY+Y + +LGQGRE
Sbjct: 243 VKVVKNKIAPPFKQAEFDIMYGEGISREGSILDLGTALDIIEKSGSWYSYKDIKLGQGRE 302

Query: 304 AAKQTL 309
            AKQ L
Sbjct: 303 NAKQFL 308


>RECA_MAGSA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  351 bits (901), Expect = 5e-99
 Identities = 197/323 (60%), Positives = 234/323 (72%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+    QIE  FGKGSIMK G     +   V+ TG+L LD ALGIGGVPRGRI+E
Sbjct: 15  DRQKALEAAVSQIERAFGKGSIMKLGGKDQVVETEVVSTGSLGLDVALGIGGVPRGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTLAL IIAEAQ  GG  AF+DAEHALDP YA +LGV++DE+LISQPD GE
Sbjct: 75  VYGPESSGKTTLALHIIAEAQKKGGTCAFVDAEHALDPSYARKLGVNLDELLISQPDAGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD  +GL ARLMSQALRKL GS+S
Sbjct: 135 QALEIADTLVRSGXXXXXXXXXXXXXXPRAELEGEMGDNHMGLHARLMSQALRKLTGSVS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG    
Sbjct: 195 KSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVGAIKDRDEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+  +FD+MYGEGIS+ G ++D+ V+A V +KSGAW++Y   R+GQGRE
Sbjct: 255 VKVVKNKLAPPFKVVDFDIMYGEGISKMGELIDLGVKANVVEKSGAWFSYNSTRIGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L+ENP +  E+E  +R++
Sbjct: 315 NAKTFLRENPAMAAEIEGAIRQN 337


>RECA_ALTMD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  351 bits (901), Expect = 5e-99
 Identities = 192/337 (56%), Positives = 243/337 (72%), Gaps = 1/337 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ KSK L     QIE +FGKG+IM+ G+    ++I  I TG+L +D ALGIGG+P GR
Sbjct: 1   MDDNKSKALTAAVGQIEKQFGKGAIMRLGDN-QAMDIEAISTGSLTIDIALGIGGLPCGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ+IAEAQ  G   AF+DAEHALDPVYA +LGV+IDE+L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQVIAEAQKNGKTCAFVDAEHALDPVYAEKLGVNIDELLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICDMLVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEICDMLVRSGXXXXXXXXXXXXLTPKAEIEGDMGDSHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF + YGEGIS+E  ++D+ V+  +  K+GAWY+Y  +R+GQ
Sbjct: 240 ETRVKVVKNKVAPPFKQAEFMIRYGEGISKEAELIDLGVKQKLVDKAGAWYSYKGDRIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTE 337
           G+    + LKE+P+   E+ETK+R+   +    ++ E
Sbjct: 300 GKANVMKYLKEHPETANEIETKIRQELLLSKTVKAEE 336


>RECA_METRJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  351 bits (900), Expect = 6e-99
 Identities = 184/326 (56%), Positives = 238/326 (73%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++++KSK +     QIE  FGKGSIM+ G+      +  + TG+L LD ALG+GG+PRGR
Sbjct: 14  VDKDKSKAIDAALSQIERAFGKGSIMRLGKSDKVQEVETVSTGSLGLDIALGVGGLPRGR 73

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTLAL  IAEAQ  GG+ AF+DAEHALDPVYA +LGV++D++LISQPD
Sbjct: 74  VIEIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPD 133

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              PRAEIEGE+G++  GLQARLMSQALRKL G
Sbjct: 134 TGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGESQPGLQARLMSQALRKLTG 193

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S+S+SN   IFINQ+R KIGVM+G+PETTTGG ALKF+                 E +G 
Sbjct: 194 SISRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRISTLKDRDEAIGN 253

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q EFD+M+GEG+S+ G ++D+ V+AG+ +KSGAW++Y  +RLGQ
Sbjct: 254 QXXXXXXXXXXAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYNSQRLGQ 313

Query: 301 GREAAKQTLKENPDLREELETKVRES 326
           GRE +K  L++NP +  E+E  +R++
Sbjct: 314 GRENSKGFLRDNPKIAAEIEGSIRQN 339


>RECA_ACIC1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  351 bits (900), Expect = 6e-99
 Identities = 196/314 (62%), Positives = 232/314 (73%), Gaps = 1/314 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+    QIE   GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGRIVE
Sbjct: 6   DREKALEHAIAQIERAHGKGSLMRLGDEAR-APIDVIPTGSIALDVALGIGGLPRGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +A AQ  GGI AFIDAEHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTLALHAVANAQRAGGIAAFIDAEHALDPEYAKKLGVDTDNLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D L+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+LS
Sbjct: 125 QALEIADTLIRSGXXXXXXXXXXXXXXPRAEIEGEMGDSHVGLQARLMSQALRKITGALS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREK+GV FG+PETTTGG+ALKF+                 E +G    
Sbjct: 185 HSGTTAIFINQLREKVGVFFGSPETTTGGKALKFYASIRLDVRRIDTIKEGQEAIGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQAEFD++Y  GISREG ++DM VE G+ +KSGAWYTY  ++LGQG+E
Sbjct: 245 VKVVKNKCASPFRQAEFDILYNVGISREGSLIDMGVEHGIIRKSGAWYTYEGDQLGQGKE 304

Query: 304 AAKQTLKENPDLRE 317
            A+  L+ENPDL +
Sbjct: 305 NARNFLRENPDLAD 318


>RECA_PROMI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  350 bits (899), Expect = 8e-99
 Identities = 194/325 (59%), Positives = 234/325 (72%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +N+  I TG+L LD ALG GG+PRGR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMNVETISTGSLSLDVALGAGGLPRGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G I AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIASAQREGKICAFIDAEHALDPIYAQKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ VGL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALSRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHVGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 182 NLKNSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSVKNGDEVIGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G ++D+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQIMYGEGINTYGELIDLGVKHKLVEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKE+P++  EL TK+RE
Sbjct: 302 GKANATNYLKEHPEMYNELNTKLRE 326


>RECA_PROMH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  350 bits (899), Expect = 8e-99
 Identities = 194/325 (59%), Positives = 234/325 (72%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +N+  I TG+L LD ALG GG+PRGR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMNVETISTGSLSLDVALGAGGLPRGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G I AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIASAQREGKICAFIDAEHALDPIYAQKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ VGL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALSRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHVGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 182 NLKNSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSVKNGDEVIGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G ++D+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQIMYGEGINTYGELIDLGVKHKLVEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKE+P++  EL TK+RE
Sbjct: 302 GKANATNYLKEHPEMYNELNTKLRE 326


>RECA_MACCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  350 bits (899), Expect = 8e-99
 Identities = 196/338 (57%), Positives = 241/338 (71%), Gaps = 4/338 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      +E  FGKG++MK G+   D N+  + +G++ LD+ALG+GG P+GRI+E
Sbjct: 3   ERQKALDTVIKNMEKSFGKGAVMKLGDRT-DRNVSTVSSGSITLDSALGVGGYPKGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDPVYA  LGVDI+ + +SQPD GE
Sbjct: 62  IYGPESSGKTTVALHAIAEVQRQGGVAAFIDAEHALDPVYAKNLGVDIENLYLSQPDHGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI +  VRSG              P+AEIEGE+GD+ +GLQARLMSQALRKL+GS+S
Sbjct: 122 QGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARLMSQALRKLSGSVS 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+REKIGVMFGNPETT GGRALKF+                 EIVG    
Sbjct: 182 KSNTIAIFINQVREKIGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGNRTK 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AE D+MYG+GISREG IVD+  E  V +KSGAWY+Y  ER+GQGRE
Sbjct: 242 IKVVKNKVAPPFKVAEVDIMYGKGISREGEIVDLGAEYEVLQKSGAWYSYDGERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
             K  LKENP++R+E++ K+R++     +  S EEA A
Sbjct: 302 NIKTYLKENPEVRDEIDQKIRKAMG---VGASLEEASA 336


>RECA_ARTS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  350 bits (898), Expect = 1e-98
 Identities = 181/335 (54%), Positives = 230/335 (68%), Gaps = 1/335 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QI+ +FGKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 6   DRQKALDAALAQIDKQFGKGSVMRLGDEVR-APIEVIPTGSIALDVALGIGGLPRGRVVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDP YAA+LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTVALHAVANAQRQGGIAAFIDAEHALDPEYAAKLGVDTDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+ SG              PRAEIEG++GD+ VGLQARLMSQALRK+ G LS
Sbjct: 125 QALEIMDMLIGSGSLDVIVIDSVAALVPRAEIEGDMGDSHVGLQARLMSQALRKITGRLS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++ TT IFINQLREKIGV FG+PETTTGG+ALKF+                 + VG    
Sbjct: 185 QTKTTAIFINQLREKIGVFFGSPETTTGGKALKFYASIRIDVRRIQTLKEGADSVGNRTK 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AEFD++YG+GISREG I+DM VE G+ KKSG+W+TY  ++LGQG E
Sbjct: 245 AKIVKNKMAPPFKIAEFDIIYGQGISREGGIIDMGVEHGLIKKSGSWFTYDGDQLGQGME 304

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
            +++ L++NP+L  ELE  ++E   + +     E+
Sbjct: 305 NSRRFLRDNPELAAELERLIKEKLGVGVKPAEAEK 339


>RECA_GLUOX RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  350 bits (897), Expect = 1e-98
 Identities = 193/321 (60%), Positives = 241/321 (75%), Gaps = 1/321 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L+    QIE  FGKGSIM+ G+    +   VI TG++ LD ALGIGG+PRGRIVE
Sbjct: 2   DKTKALEGALSQIERAFGKGSIMRMGQRPK-VETNVISTGSIGLDIALGIGGMPRGRIVE 60

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL ++AEAQ  GG VAFIDAEHALDP YA +LGV+ID++L+SQPD GE
Sbjct: 61  IYGPESSGKTTLALHVLAEAQKKGGTVAFIDAEHALDPGYARKLGVNIDDLLLSQPDAGE 120

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EG++GD+ VGL ARLMSQALRKL G++S
Sbjct: 121 QALEIADTLVRSGXXXXXXXXXXXXXXPRAELEGDMGDSHVGLHARLMSQALRKLTGTVS 180

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SNT  IF+NQ+R KIGVMFGNPETTTGG ALKF+                 E+VG    
Sbjct: 181 RSNTLVIFLNQIRMKIGVMFGNPETTTGGNALKFYSSIRLDIRRIGSIKDKDEVVGNQTR 240

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQ EFD+MYGEGIS+ G ++D+ V+  + +KSGAW+++  +R+GQGRE
Sbjct: 241 VKVVKNKMAPPFRQVEFDIMYGEGISKMGELLDLGVKGNIVEKSGAWFSFDSQRIGQGRE 300

Query: 304 AAKQTLKENPDLREELETKVR 324
            AKQ L+E+P++  E+E ++R
Sbjct: 301 NAKQFLREHPEMASEIERRIR 321


>RECA_CLAM3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  350 bits (897), Expect = 1e-98
 Identities = 180/321 (56%), Positives = 222/321 (69%), Gaps = 1/321 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+    QI+ +FGKGS+M+ G       + VIPTG++ LD ALGIGG+PRGRIVE
Sbjct: 6   DREKSLETALAQIDRQFGKGSVMRLGSDER-APVAVIPTGSVALDVALGIGGLPRGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IA AQ  GGI AFIDAEHALDP YA +LGVDID +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTLTLHAIANAQRAGGIAAFIDAEHALDPEYAKKLGVDIDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRKL G L+
Sbjct: 125 QALEIADMLVRSGSIDLVVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKLTGGLN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++ TT IFINQLREKIGV FG+PETT GG+ALKF+                 + VG    
Sbjct: 185 QTQTTMIFINQLREKIGVFFGSPETTAGGKALKFYASVRLDIRRIETLKDGTDAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++D  VE  + +KSGAWYTY  ++LGQG+E
Sbjct: 245 VKVVKNKMAPPFKQAEFDILYGTGISREGSLIDFGVEHEIVRKSGAWYTYDGDQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKVR 324
            +++ L  NP++  E+E K++
Sbjct: 305 NSRKHLLNNPEIAAEIEQKIK 325


>RECA_PRERU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  349 bits (896), Expect = 2e-98
 Identities = 191/324 (58%), Positives = 236/324 (72%), Gaps = 1/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +EK K L+    +IE  +GKGSIM+ G+   D N+ VIPTG++ L+AALG+GG P+GRI+
Sbjct: 13  QEKLKALQAAMSKIEKDYGKGSIMRMGDEQID-NVEVIPTGSIGLNAALGVGGYPKGRII 71

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTLA+  IAE Q  GGI AFIDAEHA D  YAA LGVD++ + ISQPD G
Sbjct: 72  EIYGPESSGKTTLAIHAIAECQKNGGIAAFIDAEHAFDRFYAAHLGVDVENLYISQPDNG 131

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI D L+R                P+ EIEG++GD+ VGLQARLMSQALRKL  ++
Sbjct: 132 EQALEIADQLIRXXXXXXXXXXXXXXLTPKKEIEGDMGDSAVGLQARLMSQALRKLTSTI 191

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SK+NTTCIFINQLREKIGVMFGNPETTTGG ALKF+                  I+G   
Sbjct: 192 SKTNTTCIFINQLREKIGVMFGNPETTTGGNALKFYASVRLDIRKVTAIKDGDNIIGNQV 251

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR+AEF++ +GEGIS+ G IVD+ VE  + KKSG+W++YG+ +L QGR
Sbjct: 252 RVKVIKNKVAPPFRKAEFEITFGEGISKIGEIVDLGVEYEIIKKSGSWFSYGDSKLAQGR 311

Query: 303 EAAKQTLKENPDLREELETKVRES 326
           +A K  LK+NP+L EELE K+ E+
Sbjct: 312 DAVKALLKDNPELCEELEAKIMEA 335


>RECA_BORPD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  349 bits (896), Expect = 2e-98
 Identities = 177/312 (56%), Positives = 223/312 (71%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM++G+   + +I V+ TG+L LD ALG+GG+PRGR++E+YGPESSGKTT
Sbjct: 23  QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEIYGPESSGKTT 82

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAE Q +GG  AF+DAEHALD  YAA+LGV++ ++LISQPDTGEQALEI D LVR
Sbjct: 83  LTLQVIAEMQKIGGTCAFVDAEHALDVQYAAKLGVNLTDLLISQPDTGEQALEITDALVR 142

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+  GLQARLMSQALRKL  ++ ++N   IFINQ
Sbjct: 143 SGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFINQ 202

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 203 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKGEEVVGNETRVKVVKNKVSPP 262

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD+MYG GISREG I+D+ V+AGV  KSGAWY+Y   R+GQG++  ++ LKE+P+
Sbjct: 263 FKQAEFDIMYGAGISREGEIIDLGVQAGVVDKSGAWYSYSGTRIGQGKDNVREYLKEHPE 322

Query: 315 LREELETKVRES 326
           L  E+E KVRE+
Sbjct: 323 LAVEIENKVREN 334


>RECA_MYCA9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  349 bits (895), Expect = 2e-98
 Identities = 187/312 (59%), Positives = 228/312 (73%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QI+  FGKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 6   DREKALELALAQIDKSFGKGSVMRLGDEVRQ-PISVIPTGSIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTVALHAVANAQRAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADMLVRSGAIDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 185 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 245 XXXXXXXXSPPFKQAEFDILYGKGISKEGSLIDMGVEQGFIRKSGSWFTYEGEQLGQGKE 304

Query: 304 AAKQTLKENPDL 315
            A+  L EN D+
Sbjct: 305 NARNFLLENVDV 316


>RECA_ENTFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  349 bits (895), Expect = 2e-98
 Identities = 186/340 (54%), Positives = 230/340 (67%), Gaps = 1/340 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +++   L     +IE  FGKGSIMK GE   D  I  IP+G+L LD ALG+GG PRGR
Sbjct: 1   MADDRKVALDAALKKIEKNFGKGSIMKLGEKA-DQKISTIPSGSLALDVALGVGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+EVYGPESSGKTT++L  IAE Q  GG  AFIDAEHALDP YA +LGV+IDE+L+SQPD
Sbjct: 60  IIEVYGPESSGKTTVSLHAIAEVQRNGGTAAFIDAEHALDPQYAEKLGVNIDELLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ LEI D LV SG              PRAEI+GE+G + VGLQARLMSQALRKL+G
Sbjct: 120 TGEQGLEIADALVSSGAIDIVVIDSVAALVPRAEIDGEMGASHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S++K+ T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +IVG 
Sbjct: 180 SINKTKTIAIFINQIREKVGVMFGNPETTPGGRALKFYATVRLEVRRAEQLKQGTDIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AE D+MYG+GIS+EG ++DMAVE  +  KSGAWY Y EER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFKVAEVDIMYGQGISQEGELLDMAVEKDLISKSGAWYGYKEERIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           GRE AKQ + ++P++  E+   VR+++ I   +  TEEA+
Sbjct: 300 GRENAKQYMADHPEMMAEVSKLVRDAYGIGDGSTITEEAE 339


>RECA_LACPL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 380

 Score =  348 bits (893), Expect = 4e-98
 Identities = 193/347 (55%), Positives = 241/347 (69%), Gaps = 1/347 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M + +   L     +IE  FGKG+IM+ G+      I  I +G+L LD ALG+GG PRGR
Sbjct: 1   MADARKAALDTALKKIEKNFGKGAIMRMGDAAQT-TISTISSGSLALDDALGVGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+ALDPVYA  LGV+ID++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAVAEVQKQGGTAAYIDAENALDPVYAEHLGVNIDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ LEI D LV SG              PRAEIEGE+GD  VGLQARLMSQALRKL+G
Sbjct: 120 TGEQGLEIADALVSSGAVDILVVDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L+K+ T  +FINQ+REK+GVMFGNPETT GGRALKF+                  I+G 
Sbjct: 180 TLNKTKTIALFINQIREKVGVMFGNPETTPGGRALKFYATIRLEVRRAEQIKEGTNIIGX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++AE D+MYG+GIS+ G IVDMA E  + KKSG+WY+YG++R+GQ
Sbjct: 240 XXXXXXXXXXXAPPFKRAEVDIMYGQGISQTGEIVDMAAEKDIVKKSGSWYSYGDDRIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAK 347
           GRE AK+ L E+PD+  E+  KVR+++ +      T E D  +  AK
Sbjct: 300 GRENAKKYLDEHPDVMTEIRQKVRDAYGMDATGEETSETDDQAKEAK 346


>RECA_EXIS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  348 bits (893), Expect = 4e-98
 Identities = 179/322 (55%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L++   QIE +FGKGSIMK GE   D  + VI +G++ LD ALG GG PRGR++E
Sbjct: 3   DRKAALEMALRQIEKQFGKGSIMKLGESA-DQRVSVISSGSITLDIALGAGGYPRGRVIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT++L  IAE Q  GG  AFIDAEHALDP YA++LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVSLHAIAEVQKQGGQAAFIDAEHALDPAYASKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKL+G+ +
Sbjct: 122 QALEIAEALVRSGAVDILVVDSVAALVPKAEIEGEMGDSHMGLQARLMSQALRKLSGATN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REKIGVMFGNPETT GGRALKF+                 +IVG    
Sbjct: 182 KSKTIVIFINQIREKIGVMFGNPETTPGGRALKFYSSVRLEVRRAEALKNGTDIVGNRTK 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAE D+MYG+GIS+ G ++D+  +  + +KSGAWY+Y  ERLGQGRE
Sbjct: 242 LKVVKNKIAPPFKQAEVDIMYGQGISKFGELIDLGTDLDIVQKSGAWYSYNSERLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRE 325
            AKQ + E+PD+ +E+E  +RE
Sbjct: 302 NAKQYMIEHPDVADEVERLIRE 323


>RECA_XYLFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  348 bits (892), Expect = 5e-98
 Identities = 182/344 (52%), Positives = 233/344 (67%), Gaps = 3/344 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L +   QIE +FGKGS+M+ G+   +  +  IPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q  GG  AFIDAEHALDP+YA +LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKKGGTAAFIDAEHALDPIYAGKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              PRAEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGSIDIMVIDSVAALTPRAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  IFINQLR KIGVM    +PETTTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVIFINQLRMKIGVMMPGQSPETTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG +++M VEA + +K+GAWY+YG ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIEMGVEAKLVEKAGAWYSYGGERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAM 342
           GQG++ A+  L+ENP L  +LE  +RE FE   ++R   + D +
Sbjct: 300 GQGKDNARGYLRENPHLAAKLEADLREKFEPTELSREEGDEDTL 343


>RECA_AGRT5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  348 bits (892), Expect = 5e-98
 Identities = 182/323 (56%), Positives = 217/323 (67%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK                 L LD ALGIGG+P+GRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLXXXXXXXXXXXXXXXXLSLDIALGIGGLPKGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS    IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPD   E+E  +R++
Sbjct: 315 NAKTFLRDNPDTANEIELALRQN 337


>RECA_ERWCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 342

 Score =  347 bits (891), Expect = 7e-98
 Identities = 194/325 (59%), Positives = 233/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +N+  I TG+L LD ALG GG+PRGR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMNVETISTGSLSLDVALGAGGLPRGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPES GKTTL LQ+IA AQ  G I AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESYGKTTLTLQVIAAAQREGKICAFIDAEHALDPIYAQKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ VGL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALSRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHVGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKNSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSVKNGDEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G ++D+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQIMYGEGINTFGELIDLGVKHKLVEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKE+P++  EL TK+RE
Sbjct: 302 GKANATTYLKEHPEMYNELNTKLRE 326


>RECA_BACHD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  347 bits (891), Expect = 7e-98
 Identities = 193/310 (62%), Positives = 229/310 (73%), Gaps = 1/310 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++   L +   QIE +FGKGSIMK GE      +  I +GAL LD ALG+GG PRGR++E
Sbjct: 3   DRKAALDMALRQIEKQFGKGSIMKLGEQAEQ-RVSTISSGALALDIALGVGGYPRGRVIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL  IAE Q  GG  AFIDAEHALDPVYA +LGV+IDE+L+SQPDTGE
Sbjct: 62  VYGPESSGKTTVALHAIAEVQRNGGQAAFIDAEHALDPVYAKKLGVNIDELLLSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL+G+++
Sbjct: 122 QALEIAEALVRSGAIDVIVIDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLSGAIN 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+REK+GVMFGNPETT GGRALKF+                 ++      
Sbjct: 182 KSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAETLKQGNDMXXXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAE D+MYGEGISREG I+D+A E  + +KSGAWY++ +ERLGQGRE
Sbjct: 242 XXXXXXXXAPPFKQAEVDIMYGEGISREGSILDIASELDIVQKSGAWYSFNDERLGQGRE 301

Query: 304 AAKQTLKENP 313
            AKQ LKENP
Sbjct: 302 NAKQFLKENP 311


>RECA_STRMK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  347 bits (890), Expect = 9e-98
 Identities = 180/330 (54%), Positives = 230/330 (69%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  +  IPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALAAALGQIEKQFGKGSVMRMGDRVVE-PVEAIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q MGG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKMGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGSVDILVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  IFINQLR KIGVM    +PETTTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVIFINQLRMKIGVMMPGQSPETTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM V+A + +K+GAWY+YGEER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVITEILYGEGISREGELIDMGVDAKLVEKAGAWYSYGEERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++NP +  +LE ++RE F+
Sbjct: 300 GQGKDNARGYLRDNPTVAAKLEAELREKFQ 329


>RECA_METCL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 342

 Score =  347 bits (890), Expect = 9e-98
 Identities = 185/329 (56%), Positives = 236/329 (71%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ KSK L     QIE +FGKGSIM+ G+     ++ V+ TG+L LD ALG+GG+PRGR
Sbjct: 1   MDDNKSKALAAALSQIEKQFGKGSIMRMGDADIGEDLQVVSTGSLGLDIALGVGGLPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L  IAE Q +GG+ AFIDA+ ALDP YA++LGV++ E+LISQPD
Sbjct: 61  IIEIYGPESSGKTTLTLSAIAEMQKLGGVAAFIDADDALDPQYASKLGVNVPELLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DML                  PRAEIEGE+GD+ +GLQARLMSQALRKL G
Sbjct: 121 TGEQALEIADMLXXXXXXXXXXXXXXAALTPRAEIEGEMGDSHMGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 NIKRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGAIKKGDEVIGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MYGEGISR G I+++     + +KSGAWY+Y  E++GQ
Sbjct: 241 ETKVKVIKNKVAPPFKQAEFDIMYGEGISRLGEIIELGTNLKLVEKSGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E AK+ L+ENP +  E+E K+R++  +
Sbjct: 301 GKENAKEFLRENPAIAAEIEAKIRDNSNV 329


>RECA_STAS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  347 bits (889), Expect = 1e-97
 Identities = 193/344 (56%), Positives = 239/344 (69%), Gaps = 3/344 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+      +  + +G++ LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-KARKVSSVSSGSVTLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDPVYA  LGVDI  + +SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAIAEVQKNGGVAAFIDAEHALDPVYAEALGVDIQNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT +FINQ+REK+GVMFGNPE T GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAVFINQIREKVGVMFGNPEVTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+  E  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGKGISKEGELIDLGAEHEIVNKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSP 344
           G+E  K  LKENP +REE++ K+RE  ++ I     EE +A SP
Sbjct: 300 GKENVKLYLKENPAIREEIDQKLRE--KLGIFDGDVEEKEAESP 341


>RECA_XYLFM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  346 bits (888), Expect = 2e-97
 Identities = 180/344 (52%), Positives = 233/344 (67%), Gaps = 3/344 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L +   QIE +FGKGS+M+ G+   +  +  IPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q  GG  AFIDAEHALDP+YA +LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKKGGTAAFIDAEHALDPIYAGKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGSIDIMVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  IFINQLR KIG+M    +PETTTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVIFINQLRMKIGIMMPGQSPETTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG +++M VEA + +K+GAWY+YG ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIEMGVEAKLVEKAGAWYSYGGERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAM 342
           GQG++ A+  L+ENP L  +LE  +RE FE   ++R   + D +
Sbjct: 300 GQGKDNARGYLRENPHLAAKLEADLREKFEPTELSREEGDEDTL 343


>RECA_GEOSM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 338

 Score =  346 bits (888), Expect = 2e-97
 Identities = 187/321 (58%), Positives = 238/321 (74%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           ++  K L L   QIE +FGKG+IM+ G      +I  IPTG+L LD ALG+GGVPRGR++
Sbjct: 5   DKAEKALDLAMSQIEKQFGKGAIMRLGNEEALPDIASIPTGSLSLDIALGVGGVPRGRVI 64

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTLAL +I+EAQ +GGI AF+DAEHALD  YA +LGV  D++L+SQPDTG
Sbjct: 65  EIFGPESSGKTTLALHVISEAQKLGGIAAFVDAEHALDIGYARKLGVKTDDLLVSQPDTG 124

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI + LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL G +
Sbjct: 125 EQALEIAETLVRSGAIXXXXXXXXXXXXPKAEIEGDMGDSHMGLQARLMSQALRKLTGII 184

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKSN   IFINQ+R KIGVMFGNPETTTGG ALKF+                 +++G   
Sbjct: 185 SKSNCCVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMDIRKIAALKQGNDMIGSRT 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F++ EFD++YGEGIS+EG I+D+AVE  V +KSGAW++YG+ER+GQGR
Sbjct: 245 RVKVVKNKVAPPFKEVEFDILYGEGISKEGDILDLAVERNVVEKSGAWFSYGKERIGQGR 304

Query: 303 EAAKQTLKENPDLREELETKV 323
           E ++  LKE+P++  E+  K+
Sbjct: 305 ENSRLFLKEHPEITAEIREKL 325


>RECA_GEOBB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 338

 Score =  346 bits (888), Expect = 2e-97
 Identities = 187/321 (58%), Positives = 238/321 (74%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           ++  K L L   QIE +FGKG+IM+ G      +I  IPTG+L LD ALG+GGVPRGR++
Sbjct: 5   DKAEKALDLAMSQIEKQFGKGAIMRLGNEEALPDIASIPTGSLSLDIALGVGGVPRGRVI 64

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTLAL +I+EAQ +GGI AF+DAEHALD  YA +LGV  D++L+SQPDTG
Sbjct: 65  EIFGPESSGKTTLALHVISEAQKLGGIAAFVDAEHALDIGYARKLGVKTDDLLVSQPDTG 124

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI + LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL G +
Sbjct: 125 EQALEIAETLVRSGAIXXXXXXXXXXXXPKAEIEGDMGDSHMGLQARLMSQALRKLTGII 184

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKSN   IFINQ+R KIGVMFGNPETTTGG ALKF+                 +++G   
Sbjct: 185 SKSNCCVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMDIRKIAALKQGNDMIGSRT 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F++ EFD++YGEGIS+EG I+D+AVE  V +KSGAW++YG+ER+GQGR
Sbjct: 245 RVKVVKNKVAPPFKEVEFDILYGEGISKEGDILDLAVERNVVEKSGAWFSYGKERIGQGR 304

Query: 303 EAAKQTLKENPDLREELETKV 323
           E ++  LKE+P++  E+  K+
Sbjct: 305 ENSRLFLKEHPEITAEIREKL 325


>RECA_XYLFT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  346 bits (887), Expect = 2e-97
 Identities = 180/344 (52%), Positives = 232/344 (67%), Gaps = 3/344 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L +   QIE +FGKGS+M+ G+   +  +  IPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q  GG  AFIDAEHALDP+YA +LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKRGGTAAFIDAEHALDPIYAGKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              PRAEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGSIDIMVIDSVAALTPRAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  IFINQLR KIG+M    +PETTTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVIFINQLRMKIGIMMPGQSPETTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG +++M VEA + +K+GAWY+YG ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIEMGVEAKLVEKAGAWYSYGGERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAM 342
           GQG++ A+  L+ENP    +LE  +RE FE   ++R   + D +
Sbjct: 300 GQGKDNARGYLRENPHFAAKLEADLREKFEPTELSREEGDEDTL 343


>RECA_XYLF2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  346 bits (887), Expect = 2e-97
 Identities = 180/344 (52%), Positives = 232/344 (67%), Gaps = 3/344 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L +   QIE +FGKGS+M+ G+   +  +  IPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEA-VEAIPTGSLMLDLALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q  GG  AFIDAEHALDP+YA +LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKRGGTAAFIDAEHALDPIYAGKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              PRAEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGSIDIMVIDSVAALTPRAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  IFINQLR KIG+M    +PETTTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVIFINQLRMKIGIMMPGQSPETTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG +++M VEA + +K+GAWY+YG ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIEMGVEAKLVEKAGAWYSYGGERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAM 342
           GQG++ A+  L+ENP    +LE  +RE FE   ++R   + D +
Sbjct: 300 GQGKDNARGYLRENPHFAAKLEADLREKFEPTELSREEGDEDTL 343


>RECA_COXBU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  346 bits (887), Expect = 2e-97
 Identities = 175/323 (54%), Positives = 223/323 (69%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           + +S  L     QIE +FGKGS+M+ G+ G   +I VI TG+L LD ALG+GG+PRGRI+
Sbjct: 2   DNRSNALNAALSQIERQFGKGSVMRLGDPGLIPDIDVISTGSLGLDIALGVGGLPRGRII 61

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPE+SGKTTLALQ IA  Q MGG  AF+DAEHALD +YA +LGV ++++L+SQPDTG
Sbjct: 62  EIYGPEASGKTTLALQTIASCQRMGGTAAFVDAEHALDAIYAGKLGVKVEDLLVSQPDTG 121

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 122 EQALEITDMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 181

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            KSNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 EI+G   
Sbjct: 182 KKSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGEEILGSET 241

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ EFD++YG GISRE  ++D+ V+  + +K+GAWY+Y  ER+GQG+
Sbjct: 242 RVKVVKNKVAPPFRQVEFDILYGLGISRESELIDLGVKNELVEKAGAWYSYNGERIGQGK 301

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E  +Q   ENP +  E+ET++RE
Sbjct: 302 ENVRQFFLENPKIAGEIETRLRE 324


>RECA_BARHE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  346 bits (887), Expect = 2e-97
 Identities = 190/323 (58%), Positives = 235/323 (72%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE  FGKGSIM+ G+    + I  IPTG+L LD ALG+GG+P+GRIVE
Sbjct: 2   DKIKALDAALSQIERSFGKGSIMRLGQKEQVVEIETIPTGSLSLDIALGVGGLPKGRIVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GG+ AFIDAEHALDP+YA +LGVD++ + ISQPDTGE
Sbjct: 62  IYGPESSGKTTLALHAIAEAQKNGGVCAFIDAEHALDPIYARKLGVDLENLFISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEI+GE+GD   GLQARLMS+ALRKL  S+ 
Sbjct: 122 QALEITETLVRSGXXXXXXXXXXXXXTPRAEIDGEMGDALPGLQARLMSKALRKLTASIF 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  IVG    
Sbjct: 182 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDMIVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD++YGEGIS+ G ++D+ V+ G  +KSG+W++Y  +RLGQGRE
Sbjct: 242 VKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGTVEKSGSWFSYNSQRLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ L+E+P++  E+ET +R++
Sbjct: 302 NAKQFLREHPEIATEIETALRQN 324


>RECA_CHLTE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  344 bits (883), Expect = 6e-97
 Identities = 181/319 (56%), Positives = 234/319 (73%)

Query: 7   KMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYG 66
           K L L  + +E +FGKG+IM+ G+    +++ VI TG++ LD ALG+GG+PRGR+ E+YG
Sbjct: 20  KQLNLAIETLEKQFGKGAIMRLGDDSAVMHVQVISTGSMALDYALGVGGLPRGRVTEIYG 79

Query: 67  PESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQAL 126
           PESSGKTTLAL  IAEAQ  GGI A +DAEHA DP YA +LGVDI+ +L+SQP++GEQAL
Sbjct: 80  PESSGKTTLALHAIAEAQKNGGIAALVDAEHAFDPTYARKLGVDINALLVSQPESGEQAL 139

Query: 127 EICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSN 186
            I + LVRSG              P+AE+EGE+GD+ VGLQARLMSQALRKL G++SKS+
Sbjct: 140 SIVETLVRSGAVDIIVIDSVAALVPQAELEGEMGDSVVGLQARLMSQALRKLTGAISKSS 199

Query: 187 TTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXX 246
           + C+FINQLR+KIGVM+G+PETTTGG+ALKF+                 E+VG       
Sbjct: 200 SVCLFINQLRDKIGVMYGSPETTTGGKALKFYSSVRLDIRKIAQIKDGEELVGNRTXXXX 259

Query: 247 XXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAK 306
                   F+ AEFD++YGEGIS  G ++D+AVE G+ KKSGAW++YG E+LGQGRE  K
Sbjct: 260 XXXXXAPPFKTAEFDILYGEGISVLGELIDLAVEFGIIKKSGAWFSYGTEKLGQGRENVK 319

Query: 307 QTLKENPDLREELETKVRE 325
           + LKE+  LR  +  +VR+
Sbjct: 320 KLLKEDETLRNTIRQQVRD 338


>RECA_LEPIN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 366

 Score =  344 bits (882), Expect = 8e-97
 Identities = 196/338 (57%), Positives = 247/338 (73%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +++ K   ++    QIE +FGKGSIMK G       + VIP+G+L LD ALGIGG P GR
Sbjct: 16  VDDSKKLAIEQAMSQIEKQFGKGSIMKLGSDSAKQTVQVIPSGSLDLDIALGIGGYPIGR 75

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L  IAEAQ  GG+ AFIDAEHALDP YA +LGV+IDE+L+SQPD
Sbjct: 76  IVEIYGPESSGKTTLTLSAIAEAQKRGGVAAFIDAEHALDPSYAKKLGVNIDELLVSQPD 135

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GE+ALEIC+ LVRS               P+AEIEG++GD+ +GLQARLMSQALRKL G
Sbjct: 136 NGEEALEICESLVRSNAIDLIVIDSVAALVPKAEIEGDMGDSHMGLQARLMSQALRKLTG 195

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +++KS T  IFINQ+R KIGVMFG+PETTTGG ALKF+                   VG 
Sbjct: 196 TIAKSKTVVIFINQIRMKIGVMFGSPETTTGGNALKFYCSVRLDXXXXXXXXXXXXSVGX 255

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+++  GISREG +VD+ V+  +  K+GAWY+Y  E++GQ
Sbjct: 256 XXXXXXXXXXCAPPFKQAEFDIIFNAGISREGSLVDLGVKHDIIHKAGAWYSYNTEKIGQ 315

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           G+EAAK+ LK NP++   +E  VR+   +P++ +   +
Sbjct: 316 GKEAAKEYLKNNPEIALTIENMVRDLNSLPLLVQENNK 353


>RECA_LEPIC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 366

 Score =  344 bits (882), Expect = 8e-97
 Identities = 196/338 (57%), Positives = 247/338 (73%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +++ K   ++    QIE +FGKGSIMK G       + VIP+G+L LD ALGIGG P GR
Sbjct: 16  VDDSKKLAIEQAMSQIEKQFGKGSIMKLGSDSAKQTVQVIPSGSLDLDIALGIGGYPIGR 75

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L  IAEAQ  GG+ AFIDAEHALDP YA +LGV+IDE+L+SQPD
Sbjct: 76  IVEIYGPESSGKTTLTLSAIAEAQKRGGVAAFIDAEHALDPSYAKKLGVNIDELLVSQPD 135

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GE+ALEIC+ LVRS               P+AEIEG++GD+ +GLQARLMSQALRKL G
Sbjct: 136 NGEEALEICESLVRSNAIDLIVIDSVAALVPKAEIEGDMGDSHMGLQARLMSQALRKLTG 195

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +++KS T  IFINQ+R KIGVMFG+PETTTGG ALKF+                   VG 
Sbjct: 196 TIAKSKTVVIFINQIRMKIGVMFGSPETTTGGNALKFYCSVRLDXXXXXXXXXXXXSVGX 255

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+++  GISREG +VD+ V+  +  K+GAWY+Y  E++GQ
Sbjct: 256 XXXXXXXXXXCAPPFKQAEFDIIFNAGISREGSLVDLGVKHDIIHKAGAWYSYNTEKIGQ 315

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           G+EAAK+ LK NP++   +E  VR+   +P++ +   +
Sbjct: 316 GKEAAKEYLKNNPEIALTIENMVRDLNSLPLLVQENNK 353


>RECA_STRM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  343 bits (881), Expect = 1e-96
 Identities = 177/330 (53%), Positives = 229/330 (69%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  +  IPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALAAALGQIEKQFGKGSVMRMGDRVVE-PVEAIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKLGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGSVDILVVDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM V+A + +K+GAWY+YGEER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVITEILYGEGISREGELIDMGVDAKLVEKAGAWYSYGEERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++NP +  +LE ++RE F+
Sbjct: 300 GQGKDNARGYLRDNPTVAAKLEAELREKFQ 329


>RECA_STACT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  343 bits (881), Expect = 1e-96
 Identities = 186/329 (56%), Positives = 234/329 (71%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ E+ K L      +E  FGKG++MK G+      +  I +G++ LD ALG+GG P+GR
Sbjct: 1   MDNERQKALDTVIKNMEKSFGKGAVMKLGDN-KARRVSSISSGSVTLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDPVYA  LGVDID + +SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAIAEVQKQGGVAAFIDAEHALDPVYAEALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSN T +FINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNCTAVFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  +R+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGDRMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKE+P+++++++ K+R+   I
Sbjct: 300 GKENVKNYLKEHPEIKQDIDNKLRQKLGI 328


>RECA_LEPME RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 387

 Score =  343 bits (881), Expect = 1e-96
 Identities = 185/349 (53%), Positives = 241/349 (69%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +++ + +     QIE +FGKGSIM+ G       + V+ TG+L LD ALGIGG P GRIV
Sbjct: 15  DQRKQAIDAALGQIEKQFGKGSIMRLGADTRMAEMNVVSTGSLDLDIALGIGGFPSGRIV 74

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTL L  IAE Q  GGI AFIDAEHALDP YA +LGV++D++L++QPD G
Sbjct: 75  EIYGPESSGKTTLTLSAIAETQKKGGIAAFIDAEHALDPSYAKKLGVNVDDLLVAQPDNG 134

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           E+ALEIC+ LVRS               P+AEIEG++GD+ +GLQARLMSQALRKL G++
Sbjct: 135 EEALEICESLVRSNAIDLIVIDSVAALVPKAEIEGDMGDSHMGLQARLMSQALRKLTGTI 194

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKSNTT IFINQ+R KIGVMFG+PETTTGG ALKF+                 E VG   
Sbjct: 195 SKSNTTVIFINQIRMKIGVMFGSPETTTGGNALKFYASIRLDIRRIETLKEKEEPVGXXX 254

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQAEFD+MY  GI+RE  ++D+AV   +  K+G+WY+YG E++GQG+
Sbjct: 255 XXXXXXXXCAPPFRQAEFDIMYANGINRESSLIDLAVRHDLVAKAGSWYSYGGEKIGQGK 314

Query: 303 EAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKK 351
           E  K    ENPD+  ++E +VR+   +P++ +S  +   +  + +  K+
Sbjct: 315 EQVKNFFLENPDIAFKIENQVRDLNSLPLMDQSKIQTREVKSIERDPKE 363


>RECA_BORPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  343 bits (881), Expect = 1e-96
 Identities = 174/312 (55%), Positives = 221/312 (70%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM++G+   + +I V+ TG+L LD ALG+GG+PRGR++EVYGPESSGKTT
Sbjct: 23  QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESSGKTT 82

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAE Q +GG  AF+DAEHALD  YA++LGV++ ++LISQPDTGEQALEI D LVR
Sbjct: 83  LTLQVIAEMQKLGGTCAFVDAEHALDVQYASKLGVNLTDLLISQPDTGEQALEITDALVR 142

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+  GLQARLMSQALRKL  ++ ++N   IFINQ
Sbjct: 143 SGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFINQ 202

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 203 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEVVGNETRVKVVKNKVAPP 262

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD+MYG GISREG I+D+ V+A V  KSGAWY+Y   R+GQG++  ++ LKE+ +
Sbjct: 263 FKQAEFDIMYGSGISREGEIIDLGVQANVVDKSGAWYSYSGNRIGQGKDNVREYLKEHKE 322

Query: 315 LREELETKVRES 326
           +  E+E KVRE+
Sbjct: 323 MAIEIENKVREN 334


>RECA_BORPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  343 bits (881), Expect = 1e-96
 Identities = 174/312 (55%), Positives = 221/312 (70%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM++G+   + +I V+ TG+L LD ALG+GG+PRGR++EVYGPESSGKTT
Sbjct: 23  QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESSGKTT 82

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAE Q +GG  AF+DAEHALD  YA++LGV++ ++LISQPDTGEQALEI D LVR
Sbjct: 83  LTLQVIAEMQKLGGTCAFVDAEHALDVQYASKLGVNLTDLLISQPDTGEQALEITDALVR 142

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+  GLQARLMSQALRKL  ++ ++N   IFINQ
Sbjct: 143 SGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFINQ 202

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 203 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEVVGNETRVKVVKNKVAPP 262

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD+MYG GISREG I+D+ V+A V  KSGAWY+Y   R+GQG++  ++ LKE+ +
Sbjct: 263 FKQAEFDIMYGSGISREGEIIDLGVQANVVDKSGAWYSYSGNRIGQGKDNVREYLKEHKE 322

Query: 315 LREELETKVRES 326
           +  E+E KVRE+
Sbjct: 323 MAIEIENKVREN 334


>RECA_BORBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  343 bits (881), Expect = 1e-96
 Identities = 174/312 (55%), Positives = 221/312 (70%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM++G+   + +I V+ TG+L LD ALG+GG+PRGR++EVYGPESSGKTT
Sbjct: 23  QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESSGKTT 82

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAE Q +GG  AF+DAEHALD  YA++LGV++ ++LISQPDTGEQALEI D LVR
Sbjct: 83  LTLQVIAEMQKLGGTCAFVDAEHALDVQYASKLGVNLTDLLISQPDTGEQALEITDALVR 142

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+  GLQARLMSQALRKL  ++ ++N   IFINQ
Sbjct: 143 SGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFINQ 202

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 203 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEVVGNETRVKVVKNKVAPP 262

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD+MYG GISREG I+D+ V+A V  KSGAWY+Y   R+GQG++  ++ LKE+ +
Sbjct: 263 FKQAEFDIMYGSGISREGEIIDLGVQANVVDKSGAWYSYSGNRIGQGKDNVREYLKEHKE 322

Query: 315 LREELETKVRES 326
           +  E+E KVRE+
Sbjct: 323 MAIEIENKVREN 334


>RECA_PSEA6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  343 bits (879), Expect = 2e-96
 Identities = 187/341 (54%), Positives = 244/341 (71%), Gaps = 1/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K++ L     QIE +FGKG+IM+ G+    ++I  I TG+L +D ALGIGG+P GR
Sbjct: 1   MDDNKTRALTAALGQIEKQFGKGAIMRLGDN-QAMDIEAISTGSLTIDIALGIGGLPCGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAEAQ MG   AF+DAEHALDP+YA +LGV+ID++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAEAQKMGKTCAFVDAEHALDPIYAGKLGVNIDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICDMLVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL G
Sbjct: 120 TGEQALEICDMLVRSGXXXXXXXXXXXXLTPKAEIEGDMGDSHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYG+GI +E  ++D+ V+  + +K+GAWY+Y  ER+GQ
Sbjct: 240 ETRVKVVKNKVAPPFKQAEFQIMYGQGICKEAELIDLGVKQKLVEKAGAWYSYNGERIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
           G+    + LKE+ ++  ++E K+R    +    ++ E A A
Sbjct: 300 GKANVVKYLKEHTEMSNDIEQKLRAELLLKKTVKAEEPAKA 340


>RECA_DESAH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  343 bits (879), Expect = 2e-96
 Identities = 177/323 (54%), Positives = 221/323 (68%), Gaps = 1/323 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K ++    QIE +FGKGSIMK G       + +I TG+L LD ALG+GG PRGR++E
Sbjct: 6   EKDKAIQTAMGQIERQFGKGSIMKLGAREIQA-VPIISTGSLALDKALGVGGFPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GGI AFIDAEHALD  YA RLGV+ DE+L+SQPDTGE
Sbjct: 65  IYGPESSGKTTLALHAVAEAQRQGGIAAFIDAEHALDVAYARRLGVNCDELLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEG++GD+ +GLQARLMSQALRKL  ++ 
Sbjct: 125 QALEIVDMLVRSGAVDIIIVDSVAALVPRAEIEGDMGDSHMGLQARLMSQALRKLTATIG 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K++TT IFINQ+R KIGV++GNPETTTGG ALKF+                  I+G    
Sbjct: 185 KTHTTLIFINQIRMKIGVVYGNPETTTGGNALKFYASVRIEIRKATAIKDGENILGNRTK 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+  EFDLMYGEGIS+ G ++DM V+ G+  KSGAWY+Y  ER+GQGR+
Sbjct: 245 VKVVKNKLAPPFKSIEFDLMYGEGISKTGELLDMGVDMGIVDKSGAWYSYDGERIGQGRQ 304

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK    +NP++  +++ +VRE+
Sbjct: 305 NAKVFFTDNPEIFNQIQARVREA 327


>RECA_CORA7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  343 bits (879), Expect = 2e-96
 Identities = 191/321 (59%), Positives = 229/321 (71%), Gaps = 1/321 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +++ K L      IE  FGKG++M+ G+      I  I +G   +D ALG+GG PRGRIV
Sbjct: 14  DDRQKALDAAMAMIEKDFGKGAVMRLGDDDRP-PIQAISSGNTAIDIALGVGGFPRGRIV 72

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  IA AQ  GGI AFIDAEHALDP YA  LGVD D +L+SQPDTG
Sbjct: 73  EIYGPESSGKTTVALHAIASAQKTGGIAAFIDAEHALDPEYARLLGVDTDNLLVSQPDTG 132

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L
Sbjct: 133 EQALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKMTGAL 192

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + +G   
Sbjct: 193 YNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDIRRIQTLKDGQDAIGNRT 252

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD+MYGEGISRE  I+D+ VE G  KKSG+W+TY  ++LGQG+
Sbjct: 253 KLKVVKNKVSPPFKIAEFDIMYGEGISRESSIIDLGVEHGFIKKSGSWFTYEGDQLGQGK 312

Query: 303 EAAKQTLKENPDLREELETKV 323
           E A+  LK+NPDL +E+E K+
Sbjct: 313 EKARNFLKDNPDLADEIEKKI 333


>RECA_LACPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  342 bits (878), Expect = 2e-96
 Identities = 188/327 (57%), Positives = 234/327 (71%), Gaps = 1/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M + +   L     +IE  FGKG+IM+ G+      I  I +G+L LD ALG+GG PRGR
Sbjct: 1   MADARKAALDTALKKIEKNFGKGAIMRMGDAAQT-TISTISSGSLALDDALGVGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+ALDPVYA  LGV+ID++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAVAEVQKQGGTAAYIDAENALDPVYAEHLGVNIDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ LEI D LV SG              PRAEIEGE+GD  VGLQARLMSQALRKL+G
Sbjct: 120 TGEQGLEIADALVSSGAVDILVVDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L+K+ T  +FINQ+REK+GVMFGNPETT GGRALKF+                  I+G 
Sbjct: 180 TLNKTKTIALFINQIREKVGVMFGNPETTPGGRALKFYATIRLEVRRAEQIKEGTNIIGX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++AE D+MYG+GIS+ G IVDMA E  + KKSG+WY+YG++R+GQ
Sbjct: 240 XXXXXXXXXXXAPPFKRAEVDIMYGQGISQTGEIVDMAAEKDIVKKSGSWYSYGDDRIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESF 327
           GRE AK+ L E+PD+  E+  KVR+++
Sbjct: 300 GRENAKKYLDEHPDVMAEIRQKVRDAY 326


>RECA_CHLP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  342 bits (878), Expect = 2e-96
 Identities = 194/320 (60%), Positives = 247/320 (77%)

Query: 7   KMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYG 66
           K L L  + +E +FGKGSIM+ G+    +++  I TG++ LD ALG+GG PRGR+ E+YG
Sbjct: 21  KQLNLAIETLEKQFGKGSIMRLGDDSAVMHVKAISTGSMALDYALGVGGFPRGRVTEIYG 80

Query: 67  PESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQAL 126
           PESSGKTTLAL  IAEAQ  GGI A +DAEHA DP YA +LGVDI+ +L+SQP++GEQAL
Sbjct: 81  PESSGKTTLALHAIAEAQKEGGIAALVDAEHAFDPTYARKLGVDINSLLVSQPESGEQAL 140

Query: 127 EICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSN 186
            I + LVRSG              P+AE+EGE+GD+ VGLQARLMSQALRKL G++SKS+
Sbjct: 141 SIVETLVRSGXXXXXXXXXXXXXXPQAELEGEMGDSVVGLQARLMSQALRKLTGAISKSS 200

Query: 187 TTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXX 246
           + CIFINQLR+KIGVM+G+PETTTGG+ALKF+                 E+VG       
Sbjct: 201 SVCIFINQLRDKIGVMYGSPETTTGGKALKFYSSVRLDIRRIAQIKDGEEVVGNRTXXXX 260

Query: 247 XXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAK 306
                   F+ AEFD++YGEGIS  G ++D+AVE G+ KK+GAW++YG E+LGQGRE  K
Sbjct: 261 XXXXXAPPFKIAEFDILYGEGISVLGELIDLAVEFGIIKKAGAWFSYGSEKLGQGRENVK 320

Query: 307 QTLKENPDLREELETKVRES 326
           + LKE+  +R  +  +VR++
Sbjct: 321 RLLKEDETVRNTIRQQVRDT 340


>RECA_ACHLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 331

 Score =  342 bits (878), Expect = 2e-96
 Identities = 188/328 (57%), Positives = 232/328 (70%), Gaps = 1/328 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           + +K + L+L   QIE +FGKGSIMK G+G  D +I  IP+G++ LD ALGIGG PRGRI
Sbjct: 3   DNKKQQALELALKQIEKQFGKGSIMKLGDGA-DHSIEAIPSGSIALDIALGIGGYPRGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +EVYGPESSGKTTL L  +A AQ  GG VAFIDAEHALDP YA  LGVDID +++SQPDT
Sbjct: 62  IEVYGPESSGKTTLTLHAMASAQKQGGTVAFIDAEHALDPNYAKALGVDIDNLVLSQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQAL+I + L++SG              P AEI G++    VGLQAR+MSQA+RK++G 
Sbjct: 122 GEQALDIAEALIKSGSIDMIVIDSVAALVPEAEIAGDMSANHVGLQARMMSQAMRKMSGV 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SKSN   IFINQ+REK+GVMFGNPETT GGRALKFF                 E++G  
Sbjct: 182 ISKSNVVAIFINQIREKVGVMFGNPETTPGGRALKFFSSVRLEIRRAEAIKQGSEMIGIX 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                         + A  D+MYG GISR G ++D++VE  +  KSGAWY  GEE+LGQG
Sbjct: 242 XXXXXXXXXXAPPLKTASIDIMYGTGISRSGEVLDLSVELNLVNKSGAWYNIGEEKLGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRESFEI 329
           R+ AKQ L++ P+L  ELE KVR  F++
Sbjct: 302 RDNAKQYLEDKPELLNELEKKVRTHFKL 329


>RECA_DELAS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 367

 Score =  342 bits (877), Expect = 3e-96
 Identities = 187/317 (58%), Positives = 227/317 (71%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE +FGKG+IM+ GEG    +I V+ TG+L LD ALG+GG+PRGR++E+YGPESSGKTTL
Sbjct: 23  IEKQFGKGTIMRLGEGEAIQDIQVVSTGSLGLDIALGVGGLPRGRVIEIYGPESSGKTTL 82

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
            LQ+IAE Q  GG  AFIDAEHALD  YA +LGV+++EVLISQPDTGEQALEI D LVRS
Sbjct: 83  TLQVIAEMQKQGGTCAFIDAEHALDTSYAQKLGVNLNEVLISQPDTGEQALEIVDSLVRS 142

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
           G              PRAEIEGE+GD   GLQARLMSQALRKL  ++ K+N   IFINQ+
Sbjct: 143 GAVDMIVVDSVAALTPRAEIEGEMGDQLPGLQARLMSQALRKLTATIKKTNCMVIFINQI 202

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           R KIGVMFG+PETTTGG ALKF+                 E +G               F
Sbjct: 203 RMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGTIKKGDEAIGNETXXXXXXXXXSPPF 262

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AEFD+++GEGISREG I+DM V A +  KSGAWY Y  E++GQGR+ A++ L+EN  L
Sbjct: 263 KTAEFDILFGEGISREGEILDMGVNAKILDKSGAWYAYNGEKIGQGRDNAREFLRENSGL 322

Query: 316 REELETKVRESFEIPII 332
             E+E KVR+S  I ++
Sbjct: 323 AVEIENKVRDSLGIALL 339


>RECA_ACHLA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 331

 Score =  342 bits (876), Expect = 4e-96
 Identities = 187/328 (57%), Positives = 232/328 (70%), Gaps = 1/328 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           + +K + L+L   QIE +FGKGSIMK G+G  D +I  IP+G++ LD ALGIGG PRGRI
Sbjct: 3   DNKKQQALELALKQIEKQFGKGSIMKLGDGA-DHSIEAIPSGSIALDIALGIGGYPRGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +EVYGPESSGKTTL L  +A AQ  GG VAFIDAEHALDP YA  LGVD+D +++SQPDT
Sbjct: 62  IEVYGPESSGKTTLTLHAMASAQKQGGTVAFIDAEHALDPNYAKALGVDLDNLVLSQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQAL+I + L++SG              P AEI G++    VGLQAR+MSQA+RK++G 
Sbjct: 122 GEQALDIAEALIKSGSIDMIVIDSVAALVPEAEIAGDMSANHVGLQARMMSQAMRKMSGV 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SKSN   IFINQ+REK+GVMFGNPETT GGRALKFF                 E++G  
Sbjct: 182 ISKSNVVAIFINQIREKVGVMFGNPETTPGGRALKFFSSVRLEIRRAEAIKQGSEMIGIX 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                         + A  D+MYG GISR G ++D++VE  +  KSGAWY  GEE+LGQG
Sbjct: 242 XXXXXXXXXXAPPLKTASIDIMYGTGISRSGEVLDLSVELNLVNKSGAWYNIGEEKLGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRESFEI 329
           R+ AKQ L++ P+L  ELE KVR  F++
Sbjct: 302 RDNAKQYLEDKPELLNELEKKVRTHFKL 329


>RECA_XANCP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  341 bits (875), Expect = 5e-96
 Identities = 188/343 (54%), Positives = 241/343 (70%), Gaps = 3/343 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKLGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA +  K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVITEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
           GQG++ A+  L++NP +  +LE ++RE F+     R   E ++
Sbjct: 300 GQGKDNARGYLRDNPQVAIKLEAELREKFQPAEAPREAGETES 342


>RECA_XANCB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  341 bits (875), Expect = 5e-96
 Identities = 188/343 (54%), Positives = 241/343 (70%), Gaps = 3/343 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKLGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA +  K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVITEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
           GQG++ A+  L++NP +  +LE ++RE F+     R   E ++
Sbjct: 300 GQGKDNARGYLRDNPQVAIKLEAELREKFQPAEAPREAGETES 342


>RECA_XANC8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  341 bits (875), Expect = 5e-96
 Identities = 188/343 (54%), Positives = 241/343 (70%), Gaps = 3/343 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKLGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA +  K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVITEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
           GQG++ A+  L++NP +  +LE ++RE F+     R   E ++
Sbjct: 300 GQGKDNARGYLRDNPQVAIKLEAELREKFQPAEAPREAGETES 342


>RECA_PSEOL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  341 bits (874), Expect = 7e-96
 Identities = 179/325 (55%), Positives = 221/325 (68%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ KSK L+    QIE +FGKGSIM+ G     ++I VI TG+L LD ALG+GG+PRGR
Sbjct: 1   MDQAKSKALEAALSQIEKQFGKGSIMRLGSD-RTMDIDVISTGSLGLDIALGVGGLPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP+YAA+LGV+IDE+L SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQRQGLTCAFVDAEHALDPIYAAKLGVNIDELLCSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D+L RSG              P+AEIEGEIGD+ VGL AR+MSQA+RK+ G
Sbjct: 120 TGEQALEIVDILTRSGAVNLIVVDSVAALVPKAEIEGEIGDSHVGLAARMMSQAMRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  SNT CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKNSNTMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKEGEEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GIS+ G IVD+AV     +KSGAWY++   ++GQ
Sbjct: 240 ETRVKVVKNKVAAPFRQAEFQIVYGQGISKAGEIVDLAVANNFVEKSGAWYSFEGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    + L EN    ++LE  +RE
Sbjct: 300 GKANTMKWLLENKPTMDKLEGMIRE 324


>RECA_METPP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  341 bits (874), Expect = 7e-96
 Identities = 183/332 (55%), Positives = 233/332 (70%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +N E           IE +FGKG+IM+ GEG    +I V+ TG+L LD ALG+GG+PRGR
Sbjct: 8   LNTEXXXXXXXXXXXIEKQFGKGTIMRLGEGEVIDDIEVVSTGSLGLDIALGVGGLPRGR 67

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTL LQ+IAE Q + G  AFIDAEHALD  YA +LGV++ E+LISQPD
Sbjct: 68  VIEIYGPESSGKTTLTLQVIAEMQKLAGTCAFIDAEHALDSQYAQKLGVNLQELLISQPD 127

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AE+EGE+GD+  GLQARLMSQALRKL  
Sbjct: 128 TGEQALEIVDALVRSGSVDLIVVDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTA 187

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ KSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G 
Sbjct: 188 TIKKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKRGEEVIGN 247

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD+++GEG+SREG I+D+ V A V  KSGAWY Y  E++GQ
Sbjct: 248 ETXXXXXXXXXSPPFKTAEFDILFGEGVSREGEIIDLGVIAKVIDKSGAWYAYNGEKIGQ 307

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPII 332
           G++ +++ L+ENP+L  E+E K+RES  + ++
Sbjct: 308 GKDNSREFLRENPELAHEIENKIRESLGVALL 339


>RECA_LEIXX RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  340 bits (873), Expect = 8e-96
 Identities = 178/311 (57%), Positives = 213/311 (68%), Gaps = 1/311 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QI+ +FGKGS+M+ G       + V+PTG++ LD ALGIGG+PRGRIVE
Sbjct: 6   DREKALVTALAQIDRQFGKGSVMRLGSDER-APVEVVPTGSIALDVALGIGGLPRGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IA AQ  GGI AFIDAEHALDP YA +LGVDID +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTLTLHAIANAQRAGGIAAFIDAEHALDPDYARKLGVDIDALLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD  VGLQARLMSQALRKL G+LS
Sbjct: 125 QALEIADMLVRSGSIDLIVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLTGALS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++NTT IFINQLREK+GV FG+PETT GG+ALKF+                 + VG    
Sbjct: 185 QTNTTMIFINQLREKVGVFFGSPETTAGGKALKFYASVRLDIRRIETLKDGTDAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GIS EG ++D  VE  + KKSGAWYTY  ++LGQG+E
Sbjct: 245 VKVVKNKMAPPFKQAEFDILYGVGISHEGSLLDFGVEHALVKKSGAWYTYEGDQLGQGKE 304

Query: 304 AAKQTLKENPD 314
            ++  L  NPD
Sbjct: 305 NSRNFLIANPD 315


>RECA_ALHEH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  340 bits (873), Expect = 8e-96
 Identities = 183/326 (56%), Positives = 240/326 (73%), Gaps = 1/326 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDL-NIGVIPTGALPLDAALGIGGVPRG 59
           M+E + K L     QIE +FGKG++M+ G+      ++ VI TG+L LD ALG+GG+P+G
Sbjct: 1   MDENRKKALGAALGQIERQFGKGAVMRMGDARAVRGDVEVISTGSLQLDIALGVGGLPKG 60

Query: 60  RIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQP 119
           R+VE+YGPESSGKTTL L  IAEAQ  GG  AF+DAEHALDP YA +LGV++D++L+SQP
Sbjct: 61  RVVEIYGPESSGKTTLTLHAIAEAQKAGGTAAFVDAEHALDPDYAEKLGVNLDDLLVSQP 120

Query: 120 DTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLA 179
           DTGEQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL 
Sbjct: 121 DTGEQALEITDMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLT 180

Query: 180 GSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G
Sbjct: 181 ANIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRMDIRRLGAIKKGDEVLG 240

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+QAEF+++YG+GIS EG ++D+ V+ G+ +K+GAWY++  +R+G
Sbjct: 241 NETRVKVVKNKMAPPFKQAEFEILYGQGISHEGELIDLGVKEGLIEKAGAWYSHNGDRIG 300

Query: 300 QGREAAKQTLKENPDLREELETKVRE 325
           QG++  +  LKE+P+L  ELE ++R+
Sbjct: 301 QGKDNVRNYLKEHPELAAELEKQIRD 326


>RECA_SERMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  340 bits (872), Expect = 1e-95
 Identities = 190/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQIMYGEGINSRGELVDLGVKHKMIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+R+
Sbjct: 302 GKANACNFLKENPAIAAELDKKLRD 326


>RECA_CHLL2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  340 bits (872), Expect = 1e-95
 Identities = 195/321 (60%), Positives = 247/321 (76%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L L  D +E +FGKG+IM+ G+G   + +  I TG++ LD ALG+GG+PRGR+ E+
Sbjct: 19  KLKQLNLAVDALEKQFGKGAIMRLGDGSAVMQVQSISTGSMTLDFALGVGGLPRGRVAEI 78

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTTLAL +IAEAQ  GGI A +DAEHA DP YA +LGVDI+ +LISQP++GEQ
Sbjct: 79  YGPESSGKTTLALHVIAEAQKEGGIAAIVDAEHAFDPSYARKLGVDINALLISQPESGEQ 138

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           AL I +                    P+AE+EGE+GD+ VGLQARLMSQALRKL G++SK
Sbjct: 139 ALTIVETXXXXXXXXXXXXXXXXXXXPQAELEGEMGDSVVGLQARLMSQALRKLTGAISK 198

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           S+  CIFINQLR+KIGVM+G+PETTTGG+ALKF+                 EIVG     
Sbjct: 199 SSAVCIFINQLRDKIGVMYGSPETTTGGKALKFYASIRLDIRKIAQIKDGDEIVGNRTXX 258

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+ AEFD++YGEGIS  G +VD+AVE GV KKSG+W+++G+E+LGQGRE+
Sbjct: 259 XXXXXXXAPPFKSAEFDILYGEGISAMGELVDLAVEFGVVKKSGSWFSFGQEKLGQGRES 318

Query: 305 AKQTLKENPDLREELETKVRE 325
           AK+ L+E+  L +++  +VRE
Sbjct: 319 AKKALREDHALFQQVYIQVRE 339


>RECA_STAHJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  340 bits (871), Expect = 1e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-KXXXXXXXXXXXXTLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDPVYA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQKNGGVAAFIDAEHALDPVYAEALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  +R+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGEVIDLGVENDIVDKSGAWYSYNGDRMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKTYLKENPQVKEEIDRKLREKLGI 328


>RECA_CITK8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  340 bits (871), Expect = 1e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E KVRE
Sbjct: 302 GKANATAWLKENPATAKEIEKKVRE 326


>RECA_CHLCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  340 bits (871), Expect = 1e-95
 Identities = 182/325 (56%), Positives = 239/325 (73%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L L  D +E +FGKG+IM+ G+G   L +  I TG++ LD ALG+GG+PRGR
Sbjct: 15  VDSAKLKQLNLAVDALEKQFGKGTIMRMGDGSAGLTVQAISTGSMALDFALGVGGLPRGR 74

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           + E+YGPESSGKTTLAL +IAEAQ  GGI A +DAEHA DP YA +LGVDI+ +LISQP+
Sbjct: 75  VTEIYGPESSGKTTLALHVIAEAQKEGGITAIVDAEHAFDPSYARKLGVDINALLISQPE 134

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           +GEQAL I +                    P+AE+EGE+GD+++GLQARLMSQALRKL G
Sbjct: 135 SGEQALSIVETXXXXXXXXXXXXXXXXXXXPQAELEGEMGDSSMGLQARLMSQALRKLTG 194

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKS+T CIFINQLR+KIGVM+G+PETTTGG+ALKF+                 E+ G 
Sbjct: 195 AISKSSTVCIFINQLRDKIGVMYGSPETTTGGKALKFYSSVRLDIRKIAQLKDGDELTGS 254

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD++YGEGIS  G ++D+ VE GV KK+G+W++YG E+LGQ
Sbjct: 255 RTRVKVVKNKVAPPFKMAEFDILYGEGISALGELIDLGVEFGVIKKAGSWFSYGTEKLGQ 314

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GRE+ K+ L+E+P L +++  +V+E
Sbjct: 315 GRESVKKILREDPVLYQKIHMQVKE 339


>RECA_SHISS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SHISO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQLEGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SHIFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SHIF8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SHIDS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SHIBS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SHIB3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_SALTY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALTI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALSV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALPK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAAMGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALPB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAAMGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALNS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALHS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALG2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALEP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALDC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_SALA4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E +VRE
Sbjct: 302 GKANATTWLKENPATAKEIEKRVRE 326


>RECA_ESCF3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ENT38 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  VVEIYGPESSGKTTLTLQVIASAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  ++G 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDNVIGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFFGELVDLGVKEKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E KVRE
Sbjct: 302 GKANAISWLKENPAAAKEIEKKVRE 326


>RECA_ECOUT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOSM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOLU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOLC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOL6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOL5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOHS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECOBW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO8A RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO81 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO7I RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO5E RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO57 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO55 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO45 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO27 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_ECO24 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  339 bits (870), Expect = 2e-95
 Identities = 190/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK+NP+  +E+E KVRE
Sbjct: 302 GKANATAWLKDNPETAKEIEKKVRE 326


>RECA_BRAJA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  339 bits (870), Expect = 2e-95
 Identities = 191/340 (56%), Positives = 237/340 (69%), Gaps = 2/340 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE +FGKGS+MK G+    +++  +                P+GR+VE
Sbjct: 15  DKSKALAAALSQIERQFGKGSVMKLGKNDRSMDVEAVXXXXXXXXXXXXXXXXPKGRVVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GGI AFIDAEHALDPVYA +LGV+IDE+LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALHTVAEAQKKGGICAFIDAEHALDPVYARKLGVNIDELLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEICD LVRSG              P+AE+EGE+GD   GLQARLMSQALRKL  S++
Sbjct: 135 QALEICDTLVRSGXXXXXXXXXXXXXXPKAELEGEMGDALPGLQARLMSQALRKLTASIN 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS+T  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSHTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNTTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G I+D+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRESFEI--PIITRSTEEADA 341
            +K  LK NPD+  ++ET +R++  +    I   T E DA
Sbjct: 315 NSKAFLKANPDITAKIETAIRQNSGLIAEQILAGTPERDA 354


>RECA_YERPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  339 bits (869), Expect = 2e-95
 Identities = 193/348 (55%), Positives = 238/348 (68%), Gaps = 7/348 (2%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRESF------EIPIITRSTEEADAM 342
           G+  A   LKENP +  EL+ K+RE        E P+   + E AD +
Sbjct: 302 GKANASNYLKENPAIAAELDKKLREMLLNGGNGEQPVAAATAEFADGV 349


>RECA_YERPB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  339 bits (869), Expect = 2e-95
 Identities = 193/348 (55%), Positives = 238/348 (68%), Gaps = 7/348 (2%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRESF------EIPIITRSTEEADAM 342
           G+  A   LKENP +  EL+ K+RE        E P+   + E AD +
Sbjct: 302 GKANASNYLKENPAIAAELDKKLREMLLNGGNGEQPVAAATAEFADGV 349


>RECA_YERP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  339 bits (869), Expect = 2e-95
 Identities = 193/348 (55%), Positives = 238/348 (68%), Gaps = 7/348 (2%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRESF------EIPIITRSTEEADAM 342
           G+  A   LKENP +  EL+ K+RE        E P+   + E AD +
Sbjct: 302 GKANASNYLKENPAIAAELDKKLREMLLNGGNGEQPVAAATAEFADGV 349


>RECA_XANOR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  339 bits (869), Expect = 2e-95
 Identities = 185/330 (56%), Positives = 236/330 (71%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALG GG+P+GR
Sbjct: 1   MDENKKRALAAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGTGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q +GG  AFIDAEHALDPVYAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKLGGTAAFIDAEHALDPVYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA + +K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVEKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++NP +   LE ++RE F+
Sbjct: 300 GQGKDNARTYLRDNPQVAVRLEAELREKFQ 329


>RECA_XANOP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  339 bits (869), Expect = 2e-95
 Identities = 185/330 (56%), Positives = 236/330 (71%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALG GG+P+GR
Sbjct: 1   MDENKKRALAAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGTGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q +GG  AFIDAEHALDPVYAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKLGGTAAFIDAEHALDPVYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA + +K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVEKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++NP +   LE ++RE F+
Sbjct: 300 GQGKDNARTYLRDNPQVAVRLEAELREKFQ 329


>RECA_XANOM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  339 bits (869), Expect = 2e-95
 Identities = 185/330 (56%), Positives = 236/330 (71%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALG GG+P+GR
Sbjct: 1   MDENKKRALAAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGTGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q +GG  AFIDAEHALDPVYAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKLGGTAAFIDAEHALDPVYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA + +K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVEKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++NP +   LE ++RE F+
Sbjct: 300 GQGKDNARTYLRDNPQVAVRLEAELREKFQ 329


>RECA_STAAW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAA9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  339 bits (869), Expect = 2e-95
 Identities = 188/329 (57%), Positives = 228/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L      +E  FGKG++MK G+                LD ALG+GG P+GR
Sbjct: 1   MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-IXXXXXXXXXXXXXLDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q+ GG+ AFIDAEHALDP YA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 EIVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  ER+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKMYLKENPQIKEEIDRKLREKLGI 328


>RECA_RHIEC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  339 bits (869), Expect = 2e-95
 Identities = 189/323 (58%), Positives = 228/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G   + + I  + T              P+GRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSNENVVEIETVSTXXXXXXXXXXXXXXPKGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAE+Q  GGI AF+DAEHALDPVYA +LGVD+  +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  G+QARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXXTPRAEIEGEMGDSLPGMQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G +VD+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 315 NAKTFLRDNPDLAREIELALRQN 337


>RECA_PHOLL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  339 bits (869), Expect = 2e-95
 Identities = 189/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKSSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSVKNGEEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G ++D+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQIMYGEGINTYGELIDLGVKHKLVEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKE+P++  EL+ K+RE
Sbjct: 302 GKANATIYLKEHPEVATELDKKLRE 326


>RECA_MAGMG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  339 bits (869), Expect = 2e-95
 Identities = 193/323 (59%), Positives = 229/323 (70%), Gaps = 1/323 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+    QIE  FGKGSIMK G     +   V+ T  L LD ALGIGGVPRGRI+E
Sbjct: 2   DRQKALEAAVSQIERAFGKGSIMKLGGKDQVVETEVVSTRILGLDVALGIGGVPRGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTLAL IIAEAQ  GG  AF+DAEHALDP YA +LG  +DE+LIS+PD GE
Sbjct: 62  VYGPESSGKTTLALHIIAEAQKKGGTCAFVDAEHALDPSYARKLGA-LDELLISEPDAGE 120

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVR G              PR E+EGE+GD  +GL ARLMSQALRKL GS+S
Sbjct: 121 QALEIADTLVRPGXXXXXXXXXXXXXXPRGELEGEMGDNHMGLHARLMSQALRKLTGSVS 180

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS T  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG    
Sbjct: 181 KSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVGAIKDRDEVVGNQTR 240

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+  +FD+MYGEGIS+ G ++D+ V+A V KKSGAW++Y   R+GQGRE
Sbjct: 241 VKVVKNKLAPPFKVVDFDIMYGEGISKMGELIDLGVKANVVKKSGAWFSYNSTRIGQGRE 300

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ L++NP +  E+E  +R++
Sbjct: 301 NAKQFLRDNPAMAAEIEGAIRQN 323


>RECA_RHIME RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  338 bits (868), Expect = 3e-95
 Identities = 176/323 (54%), Positives = 215/323 (66%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G     + I  + T              P+GRI+E
Sbjct: 2   DKSKALEAALSQIERSFGKGSIMKLGAKDSVVEIETVSTXXXXXXXXXXXXXXPKGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI  F+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 62  IYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVDLENLLISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  G+QARLMSQALRKL  S+S
Sbjct: 122 QALEITDTLVRSGAIDILVIDSVAALVPRAEIEGEMGDSLPGMQARLMSQALRKLTASIS 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 182 KSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G ++D+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 242 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L+ENP+L  E+ET +R++
Sbjct: 302 NAKLFLRENPELLREIETALRQN 324


>RECA_MANSM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  338 bits (868), Expect = 3e-95
 Identities = 184/323 (56%), Positives = 231/323 (71%), Gaps = 1/323 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N+EKSK L     QIE +FGKG+IMK G+    L++  I TG++ LD ALGIGG+P GR+
Sbjct: 4   NDEKSKALAAALGQIEKQFGKGAIMKLGDT-QALDVESISTGSIGLDVALGIGGLPMGRV 62

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE++GPESSGKTTL L +IA+AQ  G + AFIDAEHALDP+YAA+LGVD+ E+L+SQPD 
Sbjct: 63  VEIFGPESSGKTTLTLSVIAQAQKAGKVCAFIDAEHALDPIYAAKLGVDVKELLVSQPDN 122

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICD LVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL G 
Sbjct: 123 GEQALEICDALVRSGXXXXXXXXXXXXLTPKAEIEGDMGDSHVGLQARLMSQALRKLTGQ 182

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +  +N   +FINQ+R KIGVMFGNPETTTGG ALKF+                 EI+G  
Sbjct: 183 IKNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRVGAVKDGDEIIGNE 242

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FRQ +F ++YGEGIS+ G ++++ V+  +  KSGAWY Y  +++GQG
Sbjct: 243 TRVKVVKNKLAPPFRQVDFQILYGEGISKNGELIELGVKHKLVDKSGAWYAYNGDKIGQG 302

Query: 302 REAAKQTLKENPDLREELETKVR 324
           +  A + L ENP +  ELE K+R
Sbjct: 303 KANAMKWLAENPTVAAELENKIR 325


>RECA_LACJO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 360

 Score =  338 bits (868), Expect = 3e-95
 Identities = 177/313 (56%), Positives = 232/313 (74%), Gaps = 1/313 (0%)

Query: 17  ETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLA 76
           E  FGKG++M+ GE   D  I  IP+G+L LDAALG+GG PRGRI+EVYGPESSGKTT+A
Sbjct: 18  EKDFGKGAVMRMGEKV-DTQISTIPSGSLALDAALGVGGYPRGRIIEVYGPESSGKTTVA 76

Query: 77  LQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSG 136
           L  +AE Q  GG  A+IDAE+A+DP YA  LGVDID +++SQP+TGE+ L+I D L+ SG
Sbjct: 77  LHAVAEVQKRGGTAAYIDAENAMDPAYAEALGVDIDSLILSQPNTGEEGLQIADTLIASG 136

Query: 137 XXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLR 196
                         PRAEI+G++GD+ VGLQARLMSQALRKL+G++SK+ T  +FINQ+R
Sbjct: 137 AIDILVVDSVAALVPRAEIDGDMGDSHVGLQARLMSQALRKLSGNISKTKTIAVFINQIR 196

Query: 197 EKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFR 256
           EK+GVMFGNPETT GGRALKF+                 +++G               F+
Sbjct: 197 EKVGVMFGNPETTPGGRALKFYSTIRLEVRRAEQIKQGSDVIGNRXXXXXXXXXXAPPFK 256

Query: 257 QAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLR 316
            AE D+MYG+GIS+ G ++DMA +  + KK+G+WY+YG++R+GQGRE AKQ L+E+PD+ 
Sbjct: 257 VAEVDIMYGKGISQTGELIDMAADKDIIKKAGSWYSYGDDRIGQGRENAKQYLEEHPDVY 316

Query: 317 EELETKVRESFEI 329
           EE++ KVRE++ I
Sbjct: 317 EEVKEKVREAYGI 329


>RECA_ERWCT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  338 bits (868), Expect = 3e-95
 Identities = 189/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGEEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGEGINIHGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANACNFLKENPTISAELDKKLRE 326


>RECA_YERPP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  338 bits (867), Expect = 4e-95
 Identities = 189/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTLALQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLALQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAIAAELDKKLRE 326


>RECA_XENBV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 358

 Score =  338 bits (867), Expect = 4e-95
 Identities = 190/324 (58%), Positives = 231/324 (71%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           +E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GRI
Sbjct: 4   DENKQKALAAALGQIEKQFGKGSIMRLGEN-RSMDVETISTGSLSLDIALGAGGLPMGRI 62

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPDT
Sbjct: 63  VEIYGPESSGKTTLTLQVIASAQREGKTCAFIDAEHALDPVYAKKLGVDIDNLLCSQPDT 122

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG+
Sbjct: 123 GEQALEICDALSRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGN 182

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           L  SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG  
Sbjct: 183 LKNSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSVKNGDEVVGSE 242

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQG
Sbjct: 243 TRVKVVKNKIAAPFKQAEFQILYGEGINTFGELVDLGVKHKMVEKAGAWYSYNGDKIGQG 302

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           +  A   LKE+P++  EL+ K+RE
Sbjct: 303 KANATIYLKEHPEVSAELDKKLRE 326


>RECA_VIBCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  338 bits (867), Expect = 4e-95
 Identities = 190/352 (53%), Positives = 245/352 (69%), Gaps = 5/352 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGV+IDE+L+SQPD
Sbjct: 60  IVEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDELLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGEEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A   +MYG+G +REG ++D+ V+  + +KSGAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKHKMVEKSGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIP----IITRSTEEADAMSPVAKP 348
           G+  A + LKENP++ + L+ K+RE    P    +I  ++  AD +   A P
Sbjct: 300 GKANACKYLKENPEIAKTLDKKLREMLLNPENMQLIAETSSAADDVEFGAVP 351


>RECA_STAES RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  338 bits (867), Expect = 4e-95
 Identities = 187/329 (56%), Positives = 227/329 (68%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ E+ K L      +E  FGKG++MK G+                 D ALG+GG P+GR
Sbjct: 1   MDNERQKALDTVIKNMEKSFGKGAVMKLGDN-KXXXXXXXXXXXXXXDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDPVYA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQKNGGVAAFIDAEHALDPVYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 +IVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQDIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  +R+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGDRMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKNYLKENPQIKEEIDRKLREKLGI 328


>RECA_STAEQ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  338 bits (867), Expect = 4e-95
 Identities = 187/329 (56%), Positives = 227/329 (68%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ E+ K L      +E  FGKG++MK G+                 D ALG+GG P+GR
Sbjct: 1   MDNERQKALDTVIKNMEKSFGKGAVMKLGDN-KXXXXXXXXXXXXXXDNALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDPVYA  LGVDID + +SQPD
Sbjct: 60  IIEIYGPESSGKTTVALHAIAEVQKNGGVAAFIDAEHALDPVYAQALGVDIDNLYLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQ LEI +  VRSG              P+AEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 HGEQGLEIAEAFVRSGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSNTT IFINQ+REK+GVMFGNPETT GGRALKF+                 +IVG 
Sbjct: 180 AISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQDIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AE D+MYG+GIS+EG ++D+ VE  +  KSGAWY+Y  +R+GQ
Sbjct: 240 RTKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGDRMGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G+E  K  LKENP ++EE++ K+RE   I
Sbjct: 300 GKENVKNYLKENPQIKEEIDRKLREKLGI 328


>RECA_MARAV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  338 bits (867), Expect = 4e-95
 Identities = 190/341 (55%), Positives = 235/341 (68%), Gaps = 1/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M + + K L     QIE +FGKG++MK G+   +  I  + TG+L LD ALGIGG+P GR
Sbjct: 1   MEDNRKKALGAALSQIERQFGKGAVMKMGDQPREA-IPAVSTGSLGLDVALGIGGLPYGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAEAQ  G   AF+DAEHALDPVYA +LGV++DE+L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLQVIAEAQKQGKTCAFVDAEHALDPVYAEKLGVNVDELLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSNXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NVKHANCLMVFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSVKDGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF +MYG+GI     ++DM V+ G   KSGAWY Y  +++GQ
Sbjct: 240 ETRVKVVKNKVSPPFRQAEFQIMYGKGIYHMAEVLDMGVKEGFVDKSGAWYAYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
           G+  A + L+EN D+  E+E KVR+      + + T EA A
Sbjct: 300 GKANACKFLEENLDIANEIEAKVRDKLMPKPVKKETAEAPA 340


>RECA_KLEP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  338 bits (867), Expect = 4e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RTMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E KVRE
Sbjct: 302 GKANAITWLKENPAAAKEIEKKVRE 326


>RECA_KLEP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  338 bits (867), Expect = 4e-95
 Identities = 191/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINFFGELVDLGVKEKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP   +E+E KVRE
Sbjct: 302 GKANAITWLKENPAAAKEIEKKVRE 326


>RECA_ENTS8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  338 bits (867), Expect = 4e-95
 Identities = 191/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RTMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQRAGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXXTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKNSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGEEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGEGINFYGELVDLGVKHKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKEN  + +E+E K+R+
Sbjct: 302 GKANATNFLKENKPMADEIEKKLRD 326


>RECA_DESPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  338 bits (867), Expect = 4e-95
 Identities = 186/348 (53%), Positives = 238/348 (68%), Gaps = 1/348 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           ++K+  ++    QI+ +FGKGSIM+ GE   +  I VI TGAL LD ALG+GG+P+GR+ 
Sbjct: 7   KDKAGSVENAISQIQKQFGKGSIMRLGEQALEA-IPVISTGALSLDIALGVGGLPKGRMT 65

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTLAL ++AEAQ +GGI AFIDAEHALD  YA +LGV+ID +L+SQPD G
Sbjct: 66  EIYGPESSGKTTLALHVVAEAQKLGGIAAFIDAEHALDTAYAEKLGVNIDNLLVSQPDFG 125

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI ++L+RSG              P+AEI+G +GD  VGLQARLMSQA+RK AG L
Sbjct: 126 EQALEIAEILIRSGGVDIIVVDSVAALTPKAEIDGNVGDVHVGLQARLMSQAMRKFAGVL 185

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           ++SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI G   
Sbjct: 186 NRSNTVLIFINQIRMKIGVMFGSPETTTGGNALKFYCSERLDIRRIGAIKDGQEITGNRT 245

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD++YGEGIS+ G + D+AV   +  KSG+WY+Y  ER+GQGR
Sbjct: 246 RXXXXXXXXAPPFKIAEFDIIYGEGISKIGDMFDLAVGLDIIDKSGSWYSYKNERIGQGR 305

Query: 303 EAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAK 350
           E +KQ L + P +  E+E KVR ++ +P    +  E  A  P  +  K
Sbjct: 306 ENSKQFLMDTPAICHEIEEKVRSAYGLPDREETKREETAQIPDTEKTK 353


>RECA_AERHH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  338 bits (867), Expect = 4e-95
 Identities = 187/325 (57%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L     QIE +FGKGSIM+ G+    ++I  I TG+L LD ALGIGG+P GR
Sbjct: 1   MDQNKQKALAAALGQIEKQFGKGSIMRLGDS-KTMDIEAISTGSLSLDVALGIGGLPCGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAEAQ  G   AF+DAEHALDP+YAA+LGV++D++LISQPD
Sbjct: 60  IVEIYGPESSGKTTLTLQVIAEAQKKGKTCAFVDAEHALDPIYAAKLGVNVDDLLISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICDMLVRS               P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEICDMLVRSNXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N  CIFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLCIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF + YG GIS+EG +VD+ V+  +  K+GAWY+Y  E++GQ
Sbjct: 240 ETRVKVVKNKVAPPFKQAEFQIFYGAGISKEGELVDLGVKHKLIDKAGAWYSYNGEKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +   EN  +  E+E ++RE
Sbjct: 300 GKANVMKLFAENKAMAGEVEARLRE 324


>RECA2_MYXXA RecName: Full=Protein recA 2;AltName: Full=Recombinase
           A 2;
          Length = 358

 Score =  338 bits (867), Expect = 4e-95
 Identities = 180/330 (54%), Positives = 239/330 (72%), Gaps = 1/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDL-NIGVIPTGALPLDAALGIGGVPRG 59
           +N+EK K ++L    +E +FGKGSIM+ G     + ++  IPTG++ LD ALG+GGVP+G
Sbjct: 3   VNQEKEKAIELAMSAVERQFGKGSIMRLGNDEPMMRDVQAIPTGSISLDIALGVGGVPKG 62

Query: 60  RIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQP 119
           RI+E++GPESSGKTTL L I+AEAQ  GGI  ++DAEHALD  YA +LGV  D++L+SQP
Sbjct: 63  RIIEIFGPESSGKTTLCLHIVAEAQKRGGICGYVDAEHALDVGYARKLGVRTDDLLLSQP 122

Query: 120 DTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLA 179
           DTGEQALEI +MLVRSG              P+AE+EGE+GD  +G+QARLMSQALRKL 
Sbjct: 123 DTGEQALEIAEMLVRSGAIXXXXXXXXXXXXPKAELEGEMGDAHMGVQARLMSQALRKLT 182

Query: 180 GSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
           G+++KS T  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG
Sbjct: 183 GTIAKSQTCVIFINQIRMKIGVMFGNPETTTGGNALKFYASQRLDIRRIGAIKNGDNVVG 242

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++ EFD+MYG GISREG ++D+A    + +KSG+W+++  ER+G
Sbjct: 243 SRTRVKVVKNKVAPPFKEVEFDIMYGTGISREGDLIDLASNENIVEKSGSWFSFNGERIG 302

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEI 329
           QGRE  K+ L+E+P++ +++E +V E + I
Sbjct: 303 QGRENVKEYLREHPEIAKDIEGRVLEKYGI 332


>RECA_SHEAM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  338 bits (866), Expect = 6e-95
 Identities = 192/325 (59%), Positives = 233/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDPNKEKALAAVLGQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G + AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKVCAFIDAEHALDPVYARKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ VGL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXXXPKAEIEGEIGDSHVGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQA+F ++YG+GI+R G +VD+ V   + +KSGAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFRQADFQILYGQGINRTGELVDLGVLHKLIEKSGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L EN ++  E+E  +RE
Sbjct: 302 GRANATKFLAENTEIAAEIEKTLRE 326


>RECA_PECCP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  338 bits (866), Expect = 6e-95
 Identities = 189/325 (58%), Positives = 232/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGEEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGEGINIHGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANACNFLKENPAVAAELDKKLRE 326


>RECA_SHEDO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  337 bits (865), Expect = 7e-95
 Identities = 188/321 (58%), Positives = 230/321 (71%), Gaps = 1/321 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GRIVE+
Sbjct: 7   KEKALAAVLSQIEKQFGKGSIMKLGED-RTMDVETISTGSLSLDVALGAGGLPMGRIVEI 65

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPDTGEQ
Sbjct: 66  YGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPDTGEQ 125

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG+L +
Sbjct: 126 ALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQ 185

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG     
Sbjct: 186 SNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGNETRV 245

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQGR  
Sbjct: 246 KVVKNKIAAPFKQAEFQILYGQGINRTGELVDLGVAHKLVEKAGAWYSYKGDKIGQGRAN 305

Query: 305 AKQTLKENPDLREELETKVRE 325
           A + L ENP + +E++T +RE
Sbjct: 306 AGRYLTENPAIAQEIDTLLRE 326


>RECA_RHISN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  337 bits (865), Expect = 7e-95
 Identities = 187/323 (57%), Positives = 226/323 (69%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G     + I  + T              P+GRI+E
Sbjct: 15  DKSKALEAALSQIERSFGKGSIMKLGSKDSVIEIETVSTXXXXXXXXXXXXXXPKGRIIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI  F+DAEHALDPVYA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  G+QARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGAIXXXXXXXXXXXXPRAEIEGEMGDSLPGMQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G ++D+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NPDL  E+E  +R++
Sbjct: 315 NAKLFLRDNPDLLREIEMALRQN 337


>RECA_BDEBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  337 bits (865), Expect = 7e-95
 Identities = 190/323 (58%), Positives = 233/323 (72%), Gaps = 1/323 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDL-NIGVIPTGALPLDAALGIGGVPRGR 60
           N EK K L+L    IE +FGKGSIM+ G     + ++  I TGAL LD ALGIGG+P+GR
Sbjct: 11  NSEKIKALELAVSTIEKQFGKGSIMRLGANESLVKDVEAISTGALSLDIALGIGGLPKGR 70

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I E+YGPESSGKTTL L +IA+AQ  GG+VAF+DAEHALD  YA +LGV+ +++LISQPD
Sbjct: 71  ICEIYGPESSGKTTLCLSVIAQAQKKGGVVAFVDAEHALDINYARKLGVNTEDLLISQPD 130

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + LVRSG              PRAEIEG++GD+ VGLQARLMSQALRKL  
Sbjct: 131 TGEQALEITETLVRSGAIXXXXXXXXXXXXPRAEIEGDMGDSHVGLQARLMSQALRKLTA 190

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++++SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G 
Sbjct: 191 AINRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDVRRVGAIKNGEDVTGN 250

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F + EFDLMYGEGIS EG ++D+AV A + +KSGAW++   ER+GQ
Sbjct: 251 RTAVKVVKNKMAPPFTKVEFDLMYGEGISEEGDLLDLAVTANMVEKSGAWFSINGERMGQ 310

Query: 301 GREAAKQTLKENPDLREELETKV 323
           GR+AAK  LKE+P+   EL  K+
Sbjct: 311 GRDAAKNFLKEHPEYMVELRKKI 333


>RECA_VIBC3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  337 bits (864), Expect = 9e-95
 Identities = 184/325 (56%), Positives = 235/325 (72%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGV+IDE+L+SQPD
Sbjct: 60  IVEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDELLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGEEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A   +MYG+G +REG ++D+ V+  + +KSGAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKHKMVEKSGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + LKENP++ + L+ K+RE
Sbjct: 300 GKANACKYLKENPEIAKTLDKKLRE 324


>RECA_VIBAN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  337 bits (864), Expect = 9e-95
 Identities = 177/348 (50%), Positives = 230/348 (66%), Gaps = 9/348 (2%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RTMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVEVYGPESSGKTTL L++IA AQ +G   AFIDAEHALDP+YA +LGV+IDE+L+SQPD
Sbjct: 60  IVEVYGPESSGKTTLTLELIAAAQRVGKTCAFIDAEHALDPIYAKKLGVNIDELLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGAIDVIVIDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E VG 
Sbjct: 180 NLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIKEGDEAVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QA+  ++YG+G +REG +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKQADTQILYGQGFNREGELVDLGVKHKLVEKAGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESF--------EIPIITRSTEEAD 340
           G+  A + L+ENP     L+TK+RE          E PI++   +E +
Sbjct: 300 GKANACKFLRENPAAAMALDTKLREMLLNPAELIVEEPILSEMPQEEE 347


>RECA_SINMW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 361

 Score =  337 bits (864), Expect = 9e-95
 Identities = 187/323 (57%), Positives = 227/323 (70%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIMK G     + I  + T              P+GRIVE
Sbjct: 15  DKSKALEAALSQIERAFGKGSIMKLGAKDSVVEIETVSTXXXXXXXXXXXXXXPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLALQ IAEAQ  GGI  F+DAEHALDP+YA +LGVD++ +LISQPDTGE
Sbjct: 75  IYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPIYARKLGVDLENLLISQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+  G+QARLMSQALRKL  S+S
Sbjct: 135 QALEITDTLVRSGAIXXXXXXXXXXXXPRAEIEGEMGDSLPGMQARLMSQALRKLTASIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 195 KSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G ++D+ V+AG+ +KSGAW++Y  +RLGQGRE
Sbjct: 255 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L++NP+L  E+ET +R++
Sbjct: 315 NAKLFLRDNPELLREIETALRQN 337


>RECA_YERPY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  337 bits (863), Expect = 1e-94
 Identities = 188/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAIAAELDKKLRE 326


>RECA_YERPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  337 bits (863), Expect = 1e-94
 Identities = 188/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAIAAELDKKLRE 326


>RECA_YERPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  337 bits (863), Expect = 1e-94
 Identities = 188/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAIAAELDKKLRE 326


>RECA_YERPE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  337 bits (863), Expect = 1e-94
 Identities = 188/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAIAAELDKKLRE 326


>RECA_YERPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  337 bits (863), Expect = 1e-94
 Identities = 188/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAIAAELDKKLRE 326


>RECA_VIBVY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  337 bits (863), Expect = 1e-94
 Identities = 185/330 (56%), Positives = 236/330 (71%), Gaps = 1/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGV+ID++L+SQPD
Sbjct: 60  IVEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDQLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A   +MYG+G +REG ++D+ V+  + +KSGAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKCKLIEKSGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIP 330
           G+  A + LKEN D+ + L+TK+RE    P
Sbjct: 300 GKANACKYLKENVDVAKVLDTKLREMLLSP 329


>RECA_VIBVU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  337 bits (863), Expect = 1e-94
 Identities = 185/330 (56%), Positives = 236/330 (71%), Gaps = 1/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGV+ID++L+SQPD
Sbjct: 60  IVEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDQLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A   +MYG+G +REG ++D+ V+  + +KSGAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKCKLIEKSGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIP 330
           G+  A + LKEN D+ + L+TK+RE    P
Sbjct: 300 GKANACKYLKENVDVAKVLDTKLREMLLSP 329


>RECA_TOLAT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 360

 Score =  337 bits (863), Expect = 1e-94
 Identities = 173/312 (55%), Positives = 215/312 (68%), Gaps = 1/312 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+  K K L     QIE +FGKGSIM+ G+    L+I  IPTG+L LD ALGIGG+P GR
Sbjct: 1   MDSNKEKALAAALGQIEKQFGKGSIMRLGDT-QSLDIDSIPTGSLSLDIALGIGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTL L++IA+AQ  G   AFIDAEHALDP+YA +LGV +D++L+SQPD
Sbjct: 60  IVEIFGPESSGKTTLTLEVIAQAQKAGKTCAFIDAEHALDPIYAGKLGVKVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICDMLVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL G
Sbjct: 120 TGEQALEICDMLVRSGAVDVIIIDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 EIVG 
Sbjct: 180 NIKNANCLCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGEEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QA+F ++YGEGIS+E  ++D+ V+  +  KSGAWY Y  +++GQ
Sbjct: 240 ETRVKVVKNKVAPPFKQADFQILYGEGISKESELIDLGVKCKLIDKSGAWYAYKGDKIGQ 299

Query: 301 GREAAKQTLKEN 312
           G+  A + LKEN
Sbjct: 300 GKANAMKYLKEN 311


>RECA_SHEWM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  337 bits (863), Expect = 1e-94
 Identities = 186/324 (57%), Positives = 232/324 (71%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDANKEKALNAVLGQIEKQFGKGSIMKLGEN-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G + AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLELIAAAQREGKVCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQTNTMLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKERDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGQGINRTGELVDLGVAHKLVEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GR  A + L +NP + EE++T +R
Sbjct: 302 GRANAGKFLLDNPAIAEEIDTALR 325


>RECA_SHEHH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  337 bits (863), Expect = 1e-94
 Identities = 187/320 (58%), Positives = 228/320 (71%), Gaps = 1/320 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GRIVE+
Sbjct: 7   KEKALNAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEI 65

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPDTGEQ
Sbjct: 66  YGPESSGKTTLTLEVIAAAQKQGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPDTGEQ 125

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG+L +
Sbjct: 126 ALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQ 185

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G     
Sbjct: 186 SNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDREEVIGNETRV 245

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEF ++YG+GI+  G +VD+ V+  + +KSGAWY Y   ++GQGR  
Sbjct: 246 KVVKNKIAAPFKQAEFQILYGQGINSTGELVDLGVQHKLIEKSGAWYAYKGNKIGQGRAN 305

Query: 305 AKQTLKENPDLREELETKVR 324
           A + L ENP++ +E+ET +R
Sbjct: 306 AGKYLIENPEVSDEIETTLR 325


>RECA_LEPBP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 387

 Score =  337 bits (863), Expect = 1e-94
 Identities = 180/349 (51%), Positives = 240/349 (68%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +++ + +     QIE +FGKGSIM+ G       + V+ TG+L LD ALGIGG P GRI+
Sbjct: 15  DQRKQAIDAALGQIEKQFGKGSIMRLGADTRMSEMNVVSTGSLDLDIALGIGGFPSGRII 74

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTL L  IAE Q  GGI AFIDAEHALDP YA +LGV++D++L++QPD G
Sbjct: 75  EIYGPESSGKTTLTLSAIAETQKKGGIAAFIDAEHALDPSYAKKLGVNVDDLLVAQPDNG 134

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           E+ALEIC+ LVRS               P+AEIEG++GD+ +GLQARLMSQALRKL G++
Sbjct: 135 EEALEICESLVRSNAIDLIVIDSVAALVPKAEIEGDMGDSHMGLQARLMSQALRKLTGTI 194

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKS+TT IFINQ+R KIGVMFG+PETTTGG ALKF+                 E VG   
Sbjct: 195 SKSSTTVIFINQIRMKIGVMFGSPETTTGGNALKFYASIRLDIRRIETLKEKEEPVGXXX 254

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQAEFD+MY  GI+RE  ++D+AV   +  K+G+WY+Y  E++GQG+
Sbjct: 255 XXXXXXXXCAPPFRQAEFDIMYANGINRESSLIDLAVRHDLVAKAGSWYSYNGEKIGQGK 314

Query: 303 EAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKK 351
           E  +    ENPD+  ++E +VR+   +P++ ++  +   +  + +  K+
Sbjct: 315 EQVRNFFLENPDIAFKIENQVRDLNALPLLDQAKIQTREVKSIERDTKE 363


>RECA_LEPBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 387

 Score =  337 bits (863), Expect = 1e-94
 Identities = 180/349 (51%), Positives = 240/349 (68%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +++ + +     QIE +FGKGSIM+ G       + V+ TG+L LD ALGIGG P GRI+
Sbjct: 15  DQRKQAIDAALGQIEKQFGKGSIMRLGADTRMSEMNVVSTGSLDLDIALGIGGFPSGRII 74

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTL L  IAE Q  GGI AFIDAEHALDP YA +LGV++D++L++QPD G
Sbjct: 75  EIYGPESSGKTTLTLSAIAETQKKGGIAAFIDAEHALDPSYAKKLGVNVDDLLVAQPDNG 134

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           E+ALEIC+ LVRS               P+AEIEG++GD+ +GLQARLMSQALRKL G++
Sbjct: 135 EEALEICESLVRSNAIDLIVIDSVAALVPKAEIEGDMGDSHMGLQARLMSQALRKLTGTI 194

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           SKS+TT IFINQ+R KIGVMFG+PETTTGG ALKF+                 E VG   
Sbjct: 195 SKSSTTVIFINQIRMKIGVMFGSPETTTGGNALKFYASIRLDIRRIETLKEKEEPVGXXX 254

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQAEFD+MY  GI+RE  ++D+AV   +  K+G+WY+Y  E++GQG+
Sbjct: 255 XXXXXXXXCAPPFRQAEFDIMYANGINRESSLIDLAVRHDLVAKAGSWYSYNGEKIGQGK 314

Query: 303 EAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKK 351
           E  +    ENPD+  ++E +VR+   +P++ ++  +   +  + +  K+
Sbjct: 315 EQVRNFFLENPDIAFKIENQVRDLNALPLLDQAKIQTREVKSIERDTKE 363


>RECA_LACBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  337 bits (863), Expect = 1e-94
 Identities = 181/329 (55%), Positives = 235/329 (71%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +E+   L     +IE  FGKGSIM+ G+  + L +  +P+G+L LD ALG+GG PRGR
Sbjct: 1   MADERQAALDKALKKIEKDFGKGSIMRLGDNSN-LEVETVPSGSLALDVALGVGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+ALDP YA  LGV+ID++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAVAEVQKRGGTAAYIDAENALDPAYATALGVNIDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ L+I D L                  PRAEIEGE+GD  VGLQARLMSQALRKL+G
Sbjct: 120 TGEQGLQIADALXXXXXXXXXXXXXXXXLVPRAEIEGEMGDAHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +++K+ T  +FINQ+REK+GVMFGNPETT GGRALKF+                 +++G 
Sbjct: 180 TINKTKTIALFINQIREKVGVMFGNPETTPGGRALKFYATVRLEVRRAEQIKDGTDVIGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++AE D+MYG+GIS+ G ++DMAVE  +  KSG+WY+YGE+R+GQ
Sbjct: 240 RTRIKVVKNKVAPPFKRAEVDIMYGQGISQTGELLDMAVEKDIVDKSGSWYSYGEDRIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           GRE AKQ L ++PD+  E+  +VR ++ +
Sbjct: 300 GRENAKQYLADHPDMMAEVNQRVRAAYGV 328


>RECA_CLONN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  337 bits (863), Expect = 1e-94
 Identities = 201/352 (57%), Positives = 239/352 (67%), Gaps = 5/352 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           MN EK K L+    QIE +FGKGS+MK GE  H LN+  I TG+L LD AL         
Sbjct: 1   MNNEKMKALQAAITQIEKQFGKGSVMKLGEE-HVLNVEAISTGSLSLDIALXXXXXXXXX 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
                  ESSGKTT+AL IIAEAQ  GG  AFIDAEHALDPVYA  LGVDID +++SQPD
Sbjct: 60  XXXXXXXESSGKTTVALHIIAEAQKSGGTAAFIDAEHALDPVYAKALGVDIDNLIVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEIC+ LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 120 TGEQALEICEALVRSGXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S++KS    IFINQLREK+G+MFGNPETT GGRALKF+                 E +G 
Sbjct: 180 SINKSKCATIFINQLREKVGIMFGNPETTPGGRALKFYSSVRLDVRKIETIKQGDEFLGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MYG GIS EG ++D+ V+  + +KSG+W++Y + RLGQ
Sbjct: 240 RTRVKVVKNKVAPPFKQAEFDIMYGTGISFEGNVLDVGVDNEIIQKSGSWFSYNDTRLGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           GRE  KQ L+ENP +  E+E K+RE   +   TR+T  AD+    AK  K K
Sbjct: 300 GRENVKQFLRENPSILLEVENKIREKHNLK--TRNT--ADSKVTGAKDEKSK 347


>RECA_YERE8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  336 bits (862), Expect = 2e-94
 Identities = 188/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ K+RE
Sbjct: 302 GKANASNYLKENPAVAAELDKKLRE 326


>RECA_SHELP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  336 bits (862), Expect = 2e-94
 Identities = 187/324 (57%), Positives = 231/324 (71%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDANKEKALSAVLGQIEKQFGKGSIMKLGEN-RSMDVETISTGSLSLDVALGAGGLPLGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G + AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKVCAFIDAEHALDPIYAQKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDREEVIGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+R G +VD+ V   + +KSGAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINRTGELVDLGVMHKLIEKSGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GR  A + L ENP++  E++  +R
Sbjct: 302 GRANAGKYLVENPEIGAEIDQALR 325


>RECA_SERP5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  336 bits (862), Expect = 2e-94
 Identities = 187/325 (57%), Positives = 231/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGINSRGELVDLGVKHKMIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LKENP +  EL+ ++R+
Sbjct: 302 GKANACNFLKENPAVAAELDKRLRD 326


>RECA_VIBPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  336 bits (861), Expect = 2e-94
 Identities = 171/330 (51%), Positives = 223/330 (67%), Gaps = 1/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGVDID +L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVDIDALLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGAIDVMVVDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A   +MYG+G +REG ++D+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKHKLVEKAGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIP 330
           G+  A   L+E+P++ + ++TK+RE    P
Sbjct: 300 GKANACNYLREHPEIAKTIDTKLREMLLSP 329


>RECA_SHEPW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  336 bits (861), Expect = 2e-94
 Identities = 188/320 (58%), Positives = 227/320 (70%), Gaps = 1/320 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GRIVE+
Sbjct: 7   KEKALNAVLGQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGRIVEI 65

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPDTGEQ
Sbjct: 66  YGPESSGKTTLTLEVIAAAQKQGKTCAFIDAEHALDPVYAQKLGVDIDNLLCSQPDTGEQ 125

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG+L +
Sbjct: 126 ALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQ 185

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G     
Sbjct: 186 SNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDRDEVIGNETRV 245

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEF ++YG+GI+  G +VD+ V   + +KSGAWY Y   ++GQGR  
Sbjct: 246 KVVKNKIAAPFKQAEFQILYGQGINSTGELVDLGVVHKLIEKSGAWYAYKGSKIGQGRAN 305

Query: 305 AKQTLKENPDLREELETKVR 324
           A + L ENP++ +E+ET +R
Sbjct: 306 AGKYLIENPEISDEIETALR 325


>RECA_CORJK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 375

 Score =  336 bits (861), Expect = 2e-94
 Identities = 176/336 (52%), Positives = 222/336 (66%), Gaps = 1/336 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +++SK L+L   QIE  FGKG+IM+ G+                    LGIGG PRGR+V
Sbjct: 13  KDRSKALELAMAQIEKDFGKGAIMRLGDDTRP-PXXXXXXXXXXXXXXLGIGGFPRGRVV 71

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  IAEAQ  GGI AF+DAEHALDP YA  LGVD D +L+SQPDTG
Sbjct: 72  EIYGPESSGKTTVALHAIAEAQRAGGIAAFVDAEHALDPEYARALGVDTDALLVSQPDTG 131

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DML+RSG              P+AEI+G++GD+ VGLQARLMSQALRK+ G+L
Sbjct: 132 EQALEIADMLIRSGAIDIIVVDSVAALTPKAEIDGDMGDSHVGLQARLMSQALRKMTGAL 191

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            ++ TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 ++VG   
Sbjct: 192 YQTGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDIRRIQALKDGQDVVGNRT 251

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD++YGEGISREG I+D+ VE G+ KKSG+W+TY  ++LGQG+
Sbjct: 252 RLKVVKNKVSPPFKIAEFDILYGEGISREGSIIDLGVETGLIKKSGSWFTYDGDQLGQGK 311

Query: 303 EAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           E A++ LK N DL  ELE ++    +I    +  +E
Sbjct: 312 EKAREFLKNNRDLSAELEDRIARELKIGPYAKMKDE 347


>RECA_LACRJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  335 bits (860), Expect = 3e-94
 Identities = 189/339 (55%), Positives = 241/339 (71%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +++   L +   +IE  FGKGSIM+ G+   D+ +  + +G+L +D ALGIGG PRGR
Sbjct: 1   MADQRKAALDVAIRKIEKNFGKGSIMRMGDAT-DMKVASVSSGSLAIDKALGIGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+ALDP YA  LGV+ID++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAVAEVQRQGGTAAYIDAENALDPQYAEALGVNIDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           +GE+ LEI D L+ SG              PRAEI+G++GDT VGLQARLMSQALRKL+G
Sbjct: 120 SGEEGLEIADALISSGAVDLVIVDSVAALVPRAEIDGDMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            ++K+ T  IFINQ+REK+GVMFGNPETTTGGRALKF+                 +    
Sbjct: 180 EINKTKTIAIFINQIREKVGVMFGNPETTTGGRALKFYSTIRMEIRRAEQIKNGTDXXXX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++ E D+MYGEGIS+ G ++DMAVE  +  KSGAWY+YG ER+GQ
Sbjct: 240 XXXXXXXXXXXXPPFKRCEVDIMYGEGISKTGELLDMAVENDLVDKSGAWYSYGSERIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI-PIITRSTEE 338
           GRE AK+ LKE+PD   EL  KVR +  + P+  +ST+E
Sbjct: 300 GRENAKKWLKEHPDSMNELMDKVRVANGMEPLNEKSTKE 338


>RECA_LACRD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  335 bits (860), Expect = 3e-94
 Identities = 189/339 (55%), Positives = 241/339 (71%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +++   L +   +IE  FGKGSIM+ G+   D+ +  + +G+L +D ALGIGG PRGR
Sbjct: 1   MADQRKAALDVAIRKIEKNFGKGSIMRMGDAT-DMKVASVSSGSLAIDKALGIGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+ALDP YA  LGV+ID++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTVALHAVAEVQRQGGTAAYIDAENALDPQYAEALGVNIDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           +GE+ LEI D L+ SG              PRAEI+G++GDT VGLQARLMSQALRKL+G
Sbjct: 120 SGEEGLEIADALISSGAVDLVIVDSVAALVPRAEIDGDMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            ++K+ T  IFINQ+REK+GVMFGNPETTTGGRALKF+                 +    
Sbjct: 180 EINKTKTIAIFINQIREKVGVMFGNPETTTGGRALKFYSTIRMEIRRAEQIKNGTDXXXX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++ E D+MYGEGIS+ G ++DMAVE  +  KSGAWY+YG ER+GQ
Sbjct: 240 XXXXXXXXXXXXPPFKRCEVDIMYGEGISKTGELLDMAVENDLVDKSGAWYSYGSERIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI-PIITRSTEE 338
           GRE AK+ LKE+PD   EL  KVR +  + P+  +ST+E
Sbjct: 300 GRENAKKWLKEHPDSMNELMDKVRVANGMEPLNEKSTKE 338


>RECA_TROWT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 437

 Score =  335 bits (859), Expect = 4e-94
 Identities = 178/319 (55%), Positives = 227/319 (71%), Gaps = 1/319 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           +++ L+L    I+ ++GKG++M+  +      I VIPTG++ LD ALG+GG+PRGRIVE+
Sbjct: 9   RTRALELALANIDRQYGKGAVMRMNDA-QKAYIDVIPTGSIALDYALGVGGLPRGRIVEI 67

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTTL L  IA  Q  GGI AFIDAEHALDP YA +LGVDID +L+SQPD+GEQ
Sbjct: 68  YGPESSGKTTLTLHAIASVQRAGGIAAFIDAEHALDPEYAKKLGVDIDALLVSQPDSGEQ 127

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI DML+RS               PRAE+EG++GD  VGLQARLMSQALRK+   L++
Sbjct: 128 ALEISDMLIRSTAIDLIVIDSVAALVPRAELEGDMGDMHVGLQARLMSQALRKITSGLNQ 187

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           + TT IFINQLREK+GV FG+PETT GGRALKF+                 E VG     
Sbjct: 188 TGTTAIFINQLREKVGVFFGSPETTPGGRALKFYASVRLDIRRVETIKQGTEAVGNRTRX 247

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEFD++YG GISRE  ++D AV+ G+ KKSG+WY YG+++LGQG+E 
Sbjct: 248 XXXXXXXAPPFKQAEFDVLYGVGISRESGLIDFAVDRGIIKKSGSWYVYGDDQLGQGKEN 307

Query: 305 AKQTLKENPDLREELETKV 323
           A++ L EN  + +E+E K+
Sbjct: 308 ARRFLLENKSVADEIENKI 326


>RECA_TROW8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 437

 Score =  335 bits (859), Expect = 4e-94
 Identities = 178/319 (55%), Positives = 227/319 (71%), Gaps = 1/319 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           +++ L+L    I+ ++GKG++M+  +      I VIPTG++ LD ALG+GG+PRGRIVE+
Sbjct: 9   RTRALELALANIDRQYGKGAVMRMNDA-QKAYIDVIPTGSIALDYALGVGGLPRGRIVEI 67

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTTL L  IA  Q  GGI AFIDAEHALDP YA +LGVDID +L+SQPD+GEQ
Sbjct: 68  YGPESSGKTTLTLHAIASVQRAGGIAAFIDAEHALDPEYAKKLGVDIDALLVSQPDSGEQ 127

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI DML+RS               PRAE+EG++GD  VGLQARLMSQALRK+   L++
Sbjct: 128 ALEISDMLIRSTAIDLIVIDSVAALVPRAELEGDMGDMHVGLQARLMSQALRKITSGLNQ 187

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           + TT IFINQLREK+GV FG+PETT GGRALKF+                 E VG     
Sbjct: 188 TGTTAIFINQLREKVGVFFGSPETTPGGRALKFYASVRLDIRRVETIKQGTEAVGNRTRX 247

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEFD++YG GISRE  ++D AV+ G+ KKSG+WY YG+++LGQG+E 
Sbjct: 248 XXXXXXXAPPFKQAEFDVLYGVGISRESGLIDFAVDRGIIKKSGSWYVYGDDQLGQGKEN 307

Query: 305 AKQTLKENPDLREELETKV 323
           A++ L EN  + +E+E K+
Sbjct: 308 ARRFLLENKSVADEIENKI 326


>RECA_LACSS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  335 bits (859), Expect = 4e-94
 Identities = 172/327 (52%), Positives = 219/327 (66%), Gaps = 1/327 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+   L     +IE  FGKGSIM+ GE   D  +  + +G+L LD ALG+GG PRGRIV
Sbjct: 4   DERQAALDAALKKIEKNFGKGSIMRMGEKV-DTQVSTVSSGSLALDEALGVGGYPRGRIV 62

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+A+DP YA  LGV+ID++L+SQPDTG
Sbjct: 63  EIYGPESSGKTTVALHAVAEVQKQGGTAAYIDAENAMDPKYATALGVNIDDLLLSQPDTG 122

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI D LV SG              PRAEIEGE+GD  VGLQARLMSQALRKL+G++
Sbjct: 123 EQGLEIADALVSSGAVDILVVDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKLSGTI 182

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           +K+ T  +FINQ+REK+GVMFGNPE T GGRALKF+                 +++G   
Sbjct: 183 NKTKTIALFINQIREKVGVMFGNPEVTPGGRALKFYSTVRLEVRRAETIKNGTDMIGNRA 242

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AE D+MYG+GISR G +VDMAVE  +  KSG+WY+YG ER+GQGR
Sbjct: 243 RIKVVKNKVAPPFKVAEVDIMYGQGISRTGELVDMAVEKDIINKSGSWYSYGSERIGQGR 302

Query: 303 EAAKQTLKENPDLREELETKVRESFEI 329
           E AK  L ++ D+ +E+  KVR ++ I
Sbjct: 303 ENAKNYLADHEDVEDEVRLKVRAAYGI 329


>RECA_ENTAG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  335 bits (859), Expect = 4e-94
 Identities = 190/347 (54%), Positives = 238/347 (68%), Gaps = 6/347 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKEGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G ++D+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGEGININGELIDLGVKHKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRESF-----EIPIITRSTEEADAM 342
           G+  +   LKENP +  EL+ K+R+       E+ + T + +  D M
Sbjct: 302 GKANSCNYLKENPKVAAELDKKLRDMLLSGTGELSVATTAEDADDNM 348


>RECA_EDWI9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  335 bits (859), Expect = 4e-94
 Identities = 187/325 (57%), Positives = 233/325 (71%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGSIM+ G+    L+I  I TG+L LD ALGIGG+P GR
Sbjct: 1   MDENKQRALAAALGQIEKQFGKGSIMRLGDT-QTLDIESISTGSLSLDVALGIGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTL L +IA AQA G   AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  IVEIFGPESSGKTTLTLSVIACAQAAGKTCAFIDAEHALDPIYAAKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEICDALVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   +FINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG GIS+E  ++D+ V+  +  KSGAWY+Y  +++GQ
Sbjct: 240 ETRVKVVKNKVAPPFRQAEFQILYGAGISKESELIDLGVKHKLLDKSGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  + + L+EN  +  ELE K+RE
Sbjct: 300 GKANSMKFLQENTTISAELEGKLRE 324


>RECA_BARQU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  335 bits (859), Expect = 4e-94
 Identities = 185/309 (59%), Positives = 226/309 (73%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  IPTG+L LD ALG+GG+P+GRIVE
Sbjct: 2   DKTKALDAALSQIERSFGKGSIMRLGQKEQVVEIETIPTGSLSLDIALGVGGLPKGRIVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GG+ AFIDAEHALDP+YA +LGVD++ + ISQPDTGE
Sbjct: 62  IYGPESSGKTTLALHAIAEAQKNGGVCAFIDAEHALDPIYARKLGVDLENLFISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEI+GE+GD   GLQARLMS+ALRKL  S+ 
Sbjct: 122 QALEITETLVRSGXXXXXXXXXXXXXTPRAEIDGEMGDALPGLQARLMSKALRKLTASIF 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  IVG    
Sbjct: 182 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGSIKDRDMIVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD++YGEGIS+ G ++D+ V+ G+ +KSG+W++Y  +RLGQGRE
Sbjct: 242 VKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGSWFSYNSQRLGQGRE 301

Query: 304 AAKQTLKEN 312
            AKQ L+E+
Sbjct: 302 NAKQFLREH 310


>RECA_XANC5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  335 bits (858), Expect = 5e-94
 Identities = 183/330 (55%), Positives = 233/330 (70%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IA+ Q  GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAQCQKNGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DML                  P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLXXXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA +  K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++NP +   LE ++RE F+
Sbjct: 300 GQGKDNARTYLRDNPQVATRLEAELREKFQ 329


>RECA_SHESW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  335 bits (858), Expect = 5e-94
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIAAEIDKTLRE 326


>RECA_SHESA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  335 bits (858), Expect = 5e-94
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIAAEIDKTLRE 326


>RECA_SHEPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  335 bits (858), Expect = 5e-94
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIAAEIDKTLRE 326


>RECA_SHEON RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  335 bits (858), Expect = 5e-94
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIAAEIDKTLRE 326


>RECA_ACICJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  334 bits (857), Expect = 6e-94
 Identities = 189/337 (56%), Positives = 228/337 (67%), Gaps = 3/337 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK+K L     QIE  FGKGSIM+ G       I VI T              PRGR++E
Sbjct: 2   EKNKALDAALAQIERAFGKGSIMRMGSRSESEAIDVISTXXXXXXXXXXXXXXPRGRVIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  +AEAQ  GG  AF+DAEHALDP+YA +LGVD+D +LISQPDTGE
Sbjct: 62  IYGPESSGKTTLALHAVAEAQKRGGTCAFVDAEHALDPIYARKLGVDVDNLLISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD+ VGL ARLMSQALRKL GS+S
Sbjct: 122 QALEIADTLVRSGAIXXXXXXXXXXXXPRAELEGEMGDSHVGLHARLMSQALRKLTGSIS 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S T  IF+NQ+R KIGVMFGNPETTTGG ALKF+                 E+ G    
Sbjct: 182 RSKTLVIFLNQIRLKIGVMFGNPETTTGGNALKFYASIRMDIRRIGSIKDREEVTGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQ EFD+MYGEGIS+ G ++D+ V+AG+ +KSGAW++   +R+GQGRE
Sbjct: 242 VKVVKNKLAPPFRQVEFDIMYGEGISKVGELLDLGVKAGIVEKSGAWFSCDSQRIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRES---FEIPIITRSTE 337
            AKQ L++NPD+   +E ++R      E  +IT  TE
Sbjct: 302 NAKQFLRDNPDVAASIEQRIRAQANLVEAAMITDETE 338


>RECA_ERWT9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  334 bits (856), Expect = 8e-94
 Identities = 192/345 (55%), Positives = 235/345 (68%), Gaps = 6/345 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +++ K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDDNKQKALAAALGQIEKQFGKGSIMRLGED-RTMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQRKGKTCAFIDAEHALDPVYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALARSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  S T  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKNSGTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQIMYGEGINIFGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRESF-----EIPIITRSTEEAD 340
           G+  A   LKEN  +  E++ K+RE       + P  T +  E D
Sbjct: 302 GKANAGNFLKENSAIANEIDAKLREMLLGNQDDKPDFTPAAHEVD 346


>RECA_SHEB9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  333 bits (855), Expect = 1e-93
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIATEIDKTLRE 326


>RECA_SHEB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  333 bits (855), Expect = 1e-93
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIATEIDKTLRE 326


>RECA_SHEB5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  333 bits (855), Expect = 1e-93
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIATEIDKTLRE 326


>RECA_SHEB2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  333 bits (855), Expect = 1e-93
 Identities = 187/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLIQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GR  A + L ENP +  E++  +RE
Sbjct: 302 GRANAGKYLTENPAIATEIDKTLRE 326


>RECA_RICB8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  333 bits (855), Expect = 1e-93
 Identities = 179/324 (55%), Positives = 229/324 (70%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K +     QIE  +GKGS+MK G+  + ++I  + TG+L LD ALGIGGVP+GRI
Sbjct: 3   NIDKEKAVAAALAQIEKSYGKGSVMKLGQRPN-VDIESVSTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIIEKSGSWFSYNSVRIGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  KQ LK+NP +  E+E  VRE
Sbjct: 302 RENVKQYLKDNPKISNEIEKLVRE 325


>RECA_XANCI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  333 bits (853), Expect = 2e-93
 Identities = 183/330 (55%), Positives = 232/330 (70%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q  GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKNGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DML                  P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLXXXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA +  K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++N  +   LE ++RE F+
Sbjct: 300 GQGKDNARTYLRDNSQVATRLEAELREKFQ 329


>RECA_XANAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  333 bits (853), Expect = 2e-93
 Identities = 183/330 (55%), Positives = 232/330 (70%), Gaps = 3/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKGS+M+ G+   +  + VIPTG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEA-VEVIPTGSLMLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ IAE Q  GG  AFIDAEHALDP+YAA+LGV++D++L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLTLQAIAECQKNGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DML                  P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLXXXXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMF--GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           ++ +SNT  +FINQLR KIGVM    +PE TTGG ALKF+                 EI+
Sbjct: 180 NIKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEII 239

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+Q   +++YGEGISREG ++DM VEA +  K+GAWY+YG+ER+
Sbjct: 240 GNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERI 299

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFE 328
           GQG++ A+  L++N  +   LE ++RE F+
Sbjct: 300 GQGKDNARTYLRDNSQVATRLEAELREKFQ 329


>RECA_TERTT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 342

 Score =  333 bits (853), Expect = 2e-93
 Identities = 166/324 (51%), Positives = 222/324 (68%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+  K K L+    QI+ +FGKG++M+ G+   +  I  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDANKEKALQAALQQIDRQFGKGTVMRMGDKELEA-IPAVSTGSLGLDVALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAEAQ  GG  AF+DAEHALDP+YAA+LGV++D++++SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLQVIAEAQRKGGTCAFVDAEHALDPIYAAKLGVNVDDLIVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALE+ DMLVRSG              P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEVADMLVRSGAIDVLVVDSVAALTPKAEIEGEMGDHHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 180 NIKNANCLAIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSVKDGDEVIGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q EF ++YG GI+R G ++D  V+ G+  K+GAWY+Y  +++GQ
Sbjct: 240 ETRVKVVKNKVAPPFKQTEFQILYGTGINRLGEVIDYGVKLGLIDKAGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G+  A Q L+E+ D+ + LE +++
Sbjct: 300 GKNNAIQYLREHSDVAQTLEDRLK 323


>RECA_STRAW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  333 bits (853), Expect = 2e-93
 Identities = 183/328 (55%), Positives = 225/328 (68%), Gaps = 1/328 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE +FGKG++M+ GE  ++  I VIPTG+  LD              E
Sbjct: 5   DREKALDAALAQIERQFGKGAVMRLGERPNE-PIEVIPTGSTALDXXXXXXXXXXXXXXE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  +A AQ  GG VAF+DAEHALDP YA +LGVDID +++SQPD GE
Sbjct: 64  VYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPDNGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S TT IFINQLREKIGVMFG+PETTTGGRALKF+                 + VG    
Sbjct: 184 QSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDIRRIETLKDGTDAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +K+GAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFKQAEFDILYGQGISREGGLIDMGVENGFVRKAGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPI 331
            A+  LK+NPDL  E+E K++E   + +
Sbjct: 304 NARNFLKDNPDLANEIEKKIKEKLGVGV 331


>RECA_SHESR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  333 bits (853), Expect = 2e-93
 Identities = 186/324 (57%), Positives = 229/324 (70%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GR  A + L ENP +  E++  +R
Sbjct: 302 GRANAGKYLTENPAIAAEIDKTLR 325


>RECA_SHESM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  333 bits (853), Expect = 2e-93
 Identities = 186/324 (57%), Positives = 229/324 (70%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RSMDVETISTGSLSLDVALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GR  A + L ENP +  E++  +R
Sbjct: 302 GRANAGKYLTENPAIAAEIDKTLR 325


>RECA_ENTGA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  333 bits (853), Expect = 2e-93
 Identities = 187/314 (59%), Positives = 229/314 (72%), Gaps = 1/314 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE  +GKG+IMK GE   D  I  IP+G+L LD ALG+GG PRGRIVEVYGPESSGKTT+
Sbjct: 16  IEKNYGKGAIMKLGEKV-DQQISTIPSGSLALDVALGVGGYPRGRIVEVYGPESSGKTTV 74

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
           AL  IAE Q  GG  AFIDAEHALDP YA +LGV+ID++L+SQPDTGEQ LEI D L   
Sbjct: 75  ALHAIAEVQKGGGTAAFIDAEHALDPQYAQKLGVNIDDLLLSQPDTGEQGLEIADALXXX 134

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
                          PRAEI+GE+GDT VGLQARLMSQALRKL+GS++K+ T  IFINQ+
Sbjct: 135 XXXXXXXXXXXXXXXPRAEIDGEMGDTHVGLQARLMSQALRKLSGSINKTKTIAIFINQI 194

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           REK+G+MFGNPETT GGRALKF+                 +I+G               F
Sbjct: 195 REKVGIMFGNPETTPGGRALKFYSTIRLEVRRAEQLKSGTDIIGNRTKIKVVKNKVAPPF 254

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AE D+MYG+GIS+EG ++DMAVE  +  KSGAWY Y  +R+GQGRE AK  ++E+ ++
Sbjct: 255 KVAEVDMMYGQGISQEGELLDMAVEQDIVDKSGAWYAYKGDRIGQGRENAKNYMREHQEM 314

Query: 316 REELETKVRESFEI 329
             E+  +VR+++ I
Sbjct: 315 MMEVSARVRDAYGI 328


>RECA_BART1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  333 bits (853), Expect = 2e-93
 Identities = 185/307 (60%), Positives = 224/307 (72%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+    + I  +PTG+L LD ALGIGG+P+GRIVE
Sbjct: 2   DKTKALDAALSQIERSFGKGSIMRLGQKEQVVEIETVPTGSLSLDIALGIGGLPKGRIVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GGI AFIDAEHALDP+YA +LGVD++ + ISQPDTGE
Sbjct: 62  IYGPESSGKTTLALHAIAEAQKGGGICAFIDAEHALDPIYARKLGVDLENLFISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEI+GE+GD   GLQARLMS+ALRKL  S+ 
Sbjct: 122 QALEITETLVRSGXXXXXXXXXXXXXTPRAEIDGEMGDALPGLQARLMSKALRKLTASIF 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  IVG    
Sbjct: 182 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDMIVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD++YGEGIS+ G ++D+ V+ G+ +KSG+W++Y  +RLGQGRE
Sbjct: 242 VKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGSWFSYNSQRLGQGRE 301

Query: 304 AAKQTLK 310
            AKQ L+
Sbjct: 302 NAKQFLR 308


>RECA_SHEFN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  332 bits (852), Expect = 2e-93
 Identities = 187/324 (57%), Positives = 228/324 (70%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   VDPNKEKALAAVLSQIEKQFGKGSIMKLGED-RTMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+R G +VD+ V   +  K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGQGINRTGELVDLGVAHKLVDKAGAWYSYKGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GR  A + L ENP +  E+ T +R
Sbjct: 302 GRANAGKFLTENPVIASEINTTLR 325


>RECA_SACD2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  332 bits (852), Expect = 2e-93
 Identities = 180/310 (58%), Positives = 230/310 (74%), Gaps = 1/310 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QI+ +FGKG++M+ G+ G +  +  I TG+L LD ALGIGG+P+GRIVE+YGPESSGKTT
Sbjct: 15  QIDRQFGKGTVMRLGDKGRE-KMPAISTGSLGLDVALGIGGLPKGRIVEIYGPESSGKTT 73

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAEAQ  GG  AF+DAEHALDPVYA +LGV++D+++ISQPD GEQALE+ DMLVR
Sbjct: 74  LTLQVIAEAQRQGGTCAFVDAEHALDPVYAEKLGVNVDDLIISQPDNGEQALEVADMLVR 133

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD  VGLQARLMSQALRK+ G++  +N   IFINQ
Sbjct: 134 SGXXXXXXXXXXXXXTPKAEIEGDMGDHHVGLQARLMSQALRKITGNIKNANCLAIFINQ 193

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 194 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSVKEGDEVVGSDTRVKVVKNKVAPP 253

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEF ++YG+GI+R G IVD  V+ G+  K+GAWY+Y  +++GQG+  A Q L++N +
Sbjct: 254 FKQAEFQILYGQGINRLGEIVDFGVKLGLIDKAGAWYSYNGDKIGQGKANAMQYLRDNKE 313

Query: 315 LREELETKVR 324
           + E LE K++
Sbjct: 314 VAEFLEQKIK 323


>RECA_ENTHR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  332 bits (852), Expect = 2e-93
 Identities = 191/330 (57%), Positives = 231/330 (70%), Gaps = 1/330 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE  +GKGSIMK GE   D  +  IP+G+L LD ALG+GG PRGRI+EVYGPESSGKTT+
Sbjct: 16  IEKNYGKGSIMKLGEK-IDQQVSTIPSGSLALDVALGVGGYPRGRIIEVYGPESSGKTTV 74

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
           AL  IAE Q  GG  AFIDAEHALDP YA +LGV+IDE+L+SQPDTGEQ LEI D     
Sbjct: 75  ALHAIAEVQKNGGTAAFIDAEHALDPQYAQKLGVNIDELLLSQPDTGEQGLEIADAXXXX 134

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
                          PRAEI+GE+GD+ VGLQARLMSQALRKL+GS++K+ T  IFINQ+
Sbjct: 135 XXXXXXXXXXXXXXXPRAEIDGEMGDSHVGLQARLMSQALRKLSGSINKTKTIAIFINQI 194

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           REK+GVMFGNPE T GGRALKF+                 +IVG               F
Sbjct: 195 REKVGVMFGNPEITPGGRALKFYATIRLEVRRAEQLKQGTDIVGNRTKIKVVKNKVAPPF 254

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AE D+MYG+GIS+EG ++DMAVE  +  KSGAWY+Y E+R+GQGRE AK  +  +P++
Sbjct: 255 KIAEVDVMYGQGISQEGELLDMAVEKDIVDKSGAWYSYKEDRIGQGRENAKNYMSTHPEM 314

Query: 316 REELETKVRESFEIPIITRSTEEADAMSPV 345
             E+   VR ++ I       EE  A  P+
Sbjct: 315 MAEVSALVRAAYGIGEDVEIPEETQAELPL 344


>RECA_CLOD6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  332 bits (852), Expect = 2e-93
 Identities = 185/329 (56%), Positives = 230/329 (69%), Gaps = 1/329 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +++EK K L     +IE  FGKGS+MK GE    ++I VI T              PRGR
Sbjct: 3   VDQEKLKALNEALGKIEKDFGKGSVMKLGEAT-SMSIDVISTXXXXXXXXXXXXXXPRGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVEVYGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDPVYA  LGVD+D ++ISQPD
Sbjct: 62  IVEVYGPESSGKTTVALSCVASAQKDGGIAAFIDAEHALDPVYAKALGVDVDNLIISQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + L+RSG              P+AEI+G++GD+ VGLQARLMSQALRKL G
Sbjct: 122 TGEQALEIAEALIRSGXXXXXXXXXXXXLVPKAEIDGDMGDSHVGLQARLMSQALRKLTG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S+ KSN   IFINQLREK+G+MFGNPETTTGGRALKF+                 +++G 
Sbjct: 182 SIKKSNCVAIFINQLREKVGIMFGNPETTTGGRALKFYSSVRLDVRKIDTIKQGDKVIGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD+MYGEGIS+ G ++D+A +  + KKSG+WY+Y + +LGQ
Sbjct: 242 RTRVKVVKNKVAPPFKQAEFDIMYGEGISKIGDLLDIAADVDIVKKSGSWYSYNDTKLGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           GRE  K+ L++N DL  E++ KVR  + +
Sbjct: 302 GRENVKKFLEDNLDLTTEIDEKVRAFYNL 330


>RECA_CHLT3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  332 bits (852), Expect = 2e-93
 Identities = 192/325 (59%), Positives = 246/325 (75%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           + +EK K L L  + +E +FGKG+IM+ G+    + + V+ TG++ LD ALG+GG+P+GR
Sbjct: 15  VKDEKLKQLNLAVESLEKQFGKGAIMRLGDDAV-VQVPVVSTGSISLDYALGVGGLPKGR 73

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTLAL  IAEAQ  GGI AF+DAEHA D  YA +LG+DI  +LISQP+
Sbjct: 74  IVEIYGPESSGKTTLALHAIAEAQKAGGIAAFVDAEHAFDQSYARKLGIDIKSLLISQPE 133

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           +GEQAL I + LVRSG              P+AE+EGE+GD+ +GLQARLMSQALRKL G
Sbjct: 134 SGEQALSITETLVRSGXXXXXXXXXXXXXXPQAELEGEMGDSQMGLQARLMSQALRKLTG 193

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKSN   IFINQLR+KIGVM+G+PETTTGG+ALKF+                 EIVG 
Sbjct: 194 AISKSNCVAIFINQLRDKIGVMYGSPETTTGGKALKFYASVRLDIRKIAQIKDGTEIVGN 253

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+  EFD++YGEG+SR G ++D+AVE G+ KK+GAW++Y  ++LGQ
Sbjct: 254 RTXXXXXXXXXAPPFKTVEFDIIYGEGVSRIGELIDLAVELGIVKKAGAWFSYENDKLGQ 313

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GRE  K  LK +  L  ++  +V+E
Sbjct: 314 GRETVKTLLKADEALFNKIYAQVKE 338


>RECA_RICTY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  332 bits (851), Expect = 3e-93
 Identities = 177/324 (54%), Positives = 229/324 (70%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  + ++I  I TG+L LD ALGIGGVP+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPN-IDIEAISTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAE+Q  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAESQKNGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W+ Y + R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLEIIEKSGSWFAYNKVRIGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  KQ LKE+P +  E+E  +RE
Sbjct: 302 RENVKQYLKEHPQIANEIEKIIRE 325


>RECA_METS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  332 bits (851), Expect = 3e-93
 Identities = 180/326 (55%), Positives = 226/326 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+++KSK +     QIE  FGKGSIM+ G+G     +  I T              PRGR
Sbjct: 14  MDKDKSKAIDAALAQIERAFGKGSIMRLGKGDKVQEVETISTXXXXXXXXXXXXXXPRGR 73

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTLAL  IAEAQ  GG+ AF+DAEHALDPVYA +LGV++D++LISQPD
Sbjct: 74  VIEIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPD 133

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              PRAEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 134 TGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDQQPGLQARLMSQALRKLTG 193

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S+S+SN   IFINQ+R KIGVM+G+PETTTGG ALKF+                 E +G 
Sbjct: 194 SISRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRVSTLKDRDEPIGN 253

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q EFD+M+GEG+S+ G ++D+ V+AG+ +KSGAW++Y  +RLGQ
Sbjct: 254 SXXXXXXXXXXAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQ 313

Query: 301 GREAAKQTLKENPDLREELETKVRES 326
           GRE AK  L++NPD+   +E  +R++
Sbjct: 314 GRENAKGFLRDNPDIAGRIEAAIRQN 339


>RECA_ENTMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  332 bits (851), Expect = 3e-93
 Identities = 194/330 (58%), Positives = 232/330 (70%), Gaps = 1/330 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE  +GKGSIMK GE   D  I  IP+G+L LD ALGIGG PRGRI+EVYGPESSGKTT+
Sbjct: 16  IEKNYGKGSIMKLGEK-IDQQISTIPSGSLALDVALGIGGYPRGRIIEVYGPESSGKTTV 74

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
           AL  IAE Q  GG  AFIDAEHALDP YA +LGV+IDE+L+SQPDTGEQ LEI D L   
Sbjct: 75  ALHAIAEVQKNGGTAAFIDAEHALDPQYAQKLGVNIDELLLSQPDTGEQGLEIADALXXX 134

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
                          PRAEI+GE+GD+ VGLQARLMSQALRKL+GS++K+ T  IFINQ+
Sbjct: 135 XXXXXXXXXXXXXXXPRAEIDGEMGDSHVGLQARLMSQALRKLSGSINKTKTIAIFINQI 194

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           REK+GVMFGNPE T GGRALKF+                 +IVG               F
Sbjct: 195 REKVGVMFGNPEITPGGRALKFYATIRLEVRRAEQLKQGTDIVGNRTKIKVVKNKVAPPF 254

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AE D+MYG GIS+EG ++DMAVE  +  KSGAWY+Y E+R+GQGRE AK  +  +P++
Sbjct: 255 KIAEVDVMYGLGISQEGELLDMAVEKDIVDKSGAWYSYKEDRIGQGRENAKIYMSNHPEM 314

Query: 316 REELETKVRESFEIPIITRSTEEADAMSPV 345
             E+ T VR ++ I       +EA    P+
Sbjct: 315 MAEVSTLVRAAYGIGEPVDVPQEAQEELPL 344


>RECA_AERS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  332 bits (851), Expect = 3e-93
 Identities = 184/312 (58%), Positives = 225/312 (72%), Gaps = 1/312 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L     QIE +FGKGSIM+ G+    ++I  I TG+L LD ALGIGG+P GR
Sbjct: 1   MDQNKQKALAAALGQIEKQFGKGSIMRLGDS-KTMDIEAISTGSLSLDVALGIGGLPCGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAEAQ  G + AFIDAEHALDP+YAA+LGV++D++LISQPD
Sbjct: 60  IVEIYGPESSGKTTLTLQVIAEAQKKGKVCAFIDAEHALDPIYAAKLGVNVDDLLISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICDMLVRS               P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEICDMLVRSNXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N  CIFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLCIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF + YG GIS+EG +VD+ V+  +  K+GAWY+Y  E++GQ
Sbjct: 240 ETRVKVVKNKVAPPFKQAEFQIFYGVGISKEGELVDLGVKHKLIDKAGAWYSYNGEKIGQ 299

Query: 301 GREAAKQTLKEN 312
           G+    +   EN
Sbjct: 300 GKANVMKLFTEN 311


>RECA_ROSS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  332 bits (850), Expect = 4e-93
 Identities = 195/343 (56%), Positives = 234/343 (68%), Gaps = 1/343 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QI+ K+GKGSIM+ GE    L I VIPTG++ LD AL         
Sbjct: 3   LSPEKEKALAAAMSQIDRKYGKGSIMRMGEVSSKLAIEVIPTGSIALDIALXXXXXXXXX 62

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTLA  IIAEAQ MGGI AFIDAEHA DPVYAAR GVD++ +L+SQPD
Sbjct: 63  XXEIYGPESSGKTTLAQHIIAEAQKMGGIAAFIDAEHAFDPVYAARCGVDVNNLLVSQPD 122

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEIC+                    PRAEIEG++GD+  GLQARLMSQALRKL+G
Sbjct: 123 YGEQALEICEXXXXXXXXXXXXXXXXXXXXPRAEIEGDMGDSLPGLQARLMSQALRKLSG 182

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKS    IF+NQLR KIGVMFG+PETTTGG+ALKF+                 E +G 
Sbjct: 183 AISKSRAVVIFLNQLRLKIGVMFGSPETTTGGQALKFYASVRMDIRRIETLKNGQETIGS 242

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEFD+M+ EGISR G I+D+ VE  + +KSGAW+  G++RLGQ
Sbjct: 243 RTRVKVVKNKVAPPFRQAEFDIMHNEGISRAGNILDVGVELDIIRKSGAWFYLGDDRLGQ 302

Query: 301 GREAAKQTLKENPDLREELETKVR-ESFEIPIITRSTEEADAM 342
           GRE AKQ L ENP L +E+E  +R  +   PI   S +E DA+
Sbjct: 303 GRENAKQFLNENPALADEIERLIRAHAMAAPISIVSPKEDDAV 345


>RECA_RHORT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 366

 Score =  332 bits (850), Expect = 4e-93
 Identities = 172/321 (53%), Positives = 214/321 (66%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L+    QIE  FGKGSIMK G+ G  ++I  I T              PRGRIVE
Sbjct: 15  DKQKALEAAVGQIERAFGKGSIMKLGQRGSVVDIESISTXXXXXXXXXXXXXXPRGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL ++AEAQ  GG  AF+DAEHA DP+YA +LGV +D++L+SQPDTGE
Sbjct: 75  IYGPESSGKTTLALHVVAEAQKKGGQCAFVDAEHAFDPLYARKLGVSLDDLLVSQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AE+EG++GD+ VGLQARLMSQALRKL G++S
Sbjct: 135 QALEIADTLVRSGAIDVLVIDSVAALVPKAELEGDMGDSHVGLQARLMSQALRKLTGTVS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG    
Sbjct: 195 RSNTLIIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDKEEVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+  EFD+MYGEGIS+ G ++D+ V+A + +KSGAW++Y   R+GQGRE
Sbjct: 255 VKVVKNKVAPPFKVVEFDIMYGEGISKLGEMLDLGVKANIIEKSGAWFSYNSTRIGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVR 324
            AKQ L++NP + EE+E  VR
Sbjct: 315 NAKQFLRDNPAMAEEIENAVR 335


>RECA_SODGM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  331 bits (849), Expect = 5e-93
 Identities = 186/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ      AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREVKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSVKEGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQIMYGEGINIRGELVDLGVKHKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK++P++  EL+ K+R+
Sbjct: 302 GKANACSFLKDHPEVAAELDKKLRD 326


>RECA_SODGL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  331 bits (849), Expect = 5e-93
 Identities = 186/325 (57%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ      AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREVKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSVKEGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF +MYGEGI+  G +VD+ V+  + +K+GAWY+Y  E++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQIMYGEGINIRGELVDLGVKHKLIEKAGAWYSYNGEKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK++P++  EL+ K+R+
Sbjct: 302 GKANACSFLKDHPEVAAELDKKLRD 326


>RECA_RICPR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  331 bits (849), Expect = 5e-93
 Identities = 177/324 (54%), Positives = 230/324 (70%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  + ++I  I TG+L LD ALGIGGVP+GRI
Sbjct: 3   NIDKERAIAAALAQIEKSYGKGSVMKLGQRPN-VDIEAISTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAE+Q  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAESQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y + R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLEIIEKSGSWFSYNKIRIGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  KQ LKE+P +  E+E  +RE
Sbjct: 302 RENVKQYLKEHPQISNEIEKIIRE 325


>RECA_DESDG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  331 bits (849), Expect = 5e-93
 Identities = 195/339 (57%), Positives = 246/339 (72%), Gaps = 2/339 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E + + L      IE K+G GS+MK  +  H  N+ VIP+G++ LD ALG+GG+PRGR+ 
Sbjct: 11  EMRREALNTALSTIERKYGSGSVMKLSDDAHT-NVAVIPSGSIGLDLALGVGGIPRGRVT 69

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTLAL +IAE Q  GG  AFIDAEHALD  YA RLGV  DE+LISQPD G
Sbjct: 70  EIYGPESSGKTTLALHMIAECQKQGGTAAFIDAEHALDINYARRLGVKTDEMLISQPDYG 129

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQAL+I DMLVRS               P++E+EG +G+T VG QARLMS A+RKL G++
Sbjct: 130 EQALDIADMLVRSNXXXXXXXXXXXXLIPQSELEGNMGETQVGSQARLMSHAMRKLTGTI 189

Query: 183 SKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
            KS T+ IFINQ+R KIG M +G+PETTTGG ALKF+                 E+ G  
Sbjct: 190 HKSRTSVIFINQIRMKIGTMGYGSPETTTGGNALKFYCSVRIDVRKIQTLKDKEEVYGXX 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A+FD++YG+G+SR G ++D+ VE G+ +KSGAWY +G ERLGQG
Sbjct: 250 XXXXXXXXXXAPPFREAQFDILYGQGVSRTGELIDLGVETGIVEKSGAWYAFGSERLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           +E  +Q L+EN  LRE +E K+ E   +    +S +EA+
Sbjct: 310 KENVRQMLQENTTLREAIEQKLLEHLGMREPVQSADEAE 348


>RECA_SULNB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  331 bits (848), Expect = 7e-93
 Identities = 188/327 (57%), Positives = 231/327 (70%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ +K K L +   QI+  FGKG++M+ G+   +  I  I TG+L LD ALGIGG+P+GR
Sbjct: 3   MDAQKQKALDMAIKQIDKTFGKGTLMRLGDKEFE-PIAAISTGSLGLDMALGIGGIPQGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVEVYGPESSGKTTLALQ IA AQ  G + AFIDAEHALD VYA  LGVD D +L+SQPD
Sbjct: 62  IVEVYGPESSGKTTLALQTIASAQKEGMVCAFIDAEHALDVVYAKNLGVDTDNLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQAL++ + L RSG              P++EIEG++GDT VGLQARLMSQALRKL  
Sbjct: 122 FGEQALDVLETLTRSGAVDLIIVDSVAALTPKSEIEGDMGDTHVGLQARLMSQALRKLTA 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K+NTT IFINQ+R KIG M +G+PETTTGG ALKF+                   +G
Sbjct: 182 ILHKTNTTVIFINQIRMKIGTMGYGSPETTTGGNALKFYCSVRIDVRRIATLKQGESQIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEGIS  G ++D  ++  +  KSGAW++YG E+LG
Sbjct: 242 NRXXXXXXXXXXXPPFRQAEFDIMFGEGISYIGELIDYGIKMDIVDKSGAWFSYGAEKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QG+E AK TLKENP LREE+E +V+E+
Sbjct: 302 QGKENAKLTLKENPKLREEIEMQVKEA 328


>RECA_XENNE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 358

 Score =  330 bits (847), Expect = 9e-93
 Identities = 186/324 (57%), Positives = 228/324 (70%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           +E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GRI
Sbjct: 4   DENKQKALAAALGQIEKQFGKGSIMRLGEN-RSMDVETISTGSLSLDIALGAGGLPMGRI 62

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDPVYA +LGVDID +L SQPDT
Sbjct: 63  VEIYGPESSGKTTLTLQVIAAAQREGRTCAFIDAEHALDPVYAKKLGVDIDNLLCSQPDT 122

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG+
Sbjct: 123 GEQALEICDALSRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGN 182

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           L  SNT  IFINQ+R KIGVMFGNPET  GG ALKF+                 E+VG  
Sbjct: 183 LKNSNTLLIFINQIRMKIGVMFGNPETPPGGNALKFYASVRLDIRRTGSVKNGDEVVGSE 242

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+QAEF ++YGEGI+  G ++D++V+  + +K+GAWY+Y  +++GQG
Sbjct: 243 TRVKVVKNKVAAPFKQAEFQILYGEGINTLGELIDLSVKHKMVEKAGAWYSYNGDKIGQG 302

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           +  A   LKE+P+   EL  K+R+
Sbjct: 303 KANATIYLKEHPETAAELNKKLRD 326


>RECA_THISH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  330 bits (847), Expect = 9e-93
 Identities = 178/325 (54%), Positives = 227/325 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E + K L     QIE +FGKG++M+ G+     ++  I T              P+GR
Sbjct: 1   MDENRKKALSAALGQIERQFGKGAVMRMGDSTAVRDVEAISTXXXXXXXXXXXXXXPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL LQ+IAE Q  GG  AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 61  VVEIYGPESSGKTTLTLQVIAECQKQGGTAAFVDAEHALDPGYAEKLGVNVDDLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD  VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDAHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKKGDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF+++YGEGISR G ++D+ V+ G+  KSGAWY+Y  ER+GQ
Sbjct: 241 ETRVKVVKNKVAPPFKQAEFEILYGEGISRLGEVIDIGVQDGIVDKSGAWYSYNGERIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G++ A+  LKE+P++  E+E ++RE
Sbjct: 301 GKDNARTFLKEHPEMAGEIERQIRE 325


>RECA_STRVL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  330 bits (847), Expect = 9e-93
 Identities = 181/328 (55%), Positives = 225/328 (68%), Gaps = 1/328 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE +FGKG++M+ G+   +  I VI TG+  LD A            E
Sbjct: 5   DREKALDAALAQIERQFGKGAVMRMGDRTQE-PIEVISTGSTALDIAXXXXXXXXXXXXE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  +A AQ  GG VAF+DAEHALDP YA +LGVDID +++SQPD GE
Sbjct: 64  IYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPDNGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S TT IFINQLREKIGVMFG+PETTTGGRALKF+                 + VG    
Sbjct: 184 QSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDIRRIETLKDGTDAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +K+GAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFKQAEFDILYGQGISREGGLIDMGVEHGFVRKAGAWYTYEGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPI 331
            A+  LK+NPDL +E+E K++E   + +
Sbjct: 304 NARNFLKDNPDLADEIERKIKEKLGVGV 331


>RECA_LACF3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  330 bits (847), Expect = 9e-93
 Identities = 190/350 (54%), Positives = 238/350 (68%), Gaps = 2/350 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M +++   L     +IE  FGKGSIM+ G+   D  I  I +G+L +D ALG+GG PRGR
Sbjct: 1   MADQRKAALDNALRKIEKNFGKGSIMRMGDAA-DTKIATISSGSLAIDEALGVGGYPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+AL  +AE Q  GG  A+IDAE+ALDP YA  LGV I+++L+SQPD
Sbjct: 60  IIEMYGPESSGKTTVALHAVAEVQRRGGTAAYIDAENALDPQYATALGVQINDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ LEI D L                  PRAEIEGE+GDT VGLQARLMSQALRKL+G
Sbjct: 120 TGEQGLEIADALXXXXXXXXXXXXXXXXXXPRAEIEGEMGDTHVGLQARLMSQALRKLSG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            ++K+ T  IFINQ+REK+GVMFGNPETT GGRALKF+                 +++G 
Sbjct: 180 EINKTKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTIRMEIRRGEQLKNGTDVIGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+AE D+MYGEGIS+ G ++DMAVE  +  KSGAWY+YG ER+GQ
Sbjct: 240 RAKIKVVKNKVAPPFRKAEVDIMYGEGISKTGELLDMAVEKDLVNKSGAWYSYGNERIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI-PIITRSTEEADAMSPVAKPA 349
           GRE AKQ   ++ D   EL  KVR ++ + P    +T+E +      + A
Sbjct: 300 GRENAKQWFADHEDAMNELMNKVRVAYGMEPDEAPATKEGEPQQETIEEA 349


>RECA_ALISL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  330 bits (846), Expect = 1e-92
 Identities = 166/316 (52%), Positives = 217/316 (68%), Gaps = 1/316 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIMK G+    +++  + TG+L LD ALG GG+P GRIVE+YGPESSGKTT
Sbjct: 15  QIEKQFGKGSIMKLGDN-RTMDVETVSTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTT 73

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L++IA+AQ  G   AFIDAEHALDP+YA +LGVDID++L SQPDTGEQALEI D L R
Sbjct: 74  LTLEVIAQAQKAGKTCAFIDAEHALDPIYAQKLGVDIDQLLCSQPDTGEQALEIVDALAR 133

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G+L +SN  CIFINQ
Sbjct: 134 SGAVDLIVVDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTGNLKQSNCMCIFINQ 193

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 194 IRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKDGDEVVGNETRIKVVKNKIAAP 253

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAE  ++YG+G +REG ++D+ V+  +  K+GAWY+Y  +++GQG+  A + ++ENP+
Sbjct: 254 FKQAETQILYGKGFNREGELIDLGVKHKLVDKAGAWYSYNGDKIGQGKANASKFMRENPE 313

Query: 315 LREELETKVRESFEIP 330
           +  EL+ K+RE    P
Sbjct: 314 IGAELDKKLREMLLTP 329


>RECA_VIBNA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  330 bits (845), Expect = 1e-92
 Identities = 170/332 (51%), Positives = 221/332 (66%), Gaps = 1/332 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGSIM+ G+    +++  I TG+L LD ALG GG+P GR
Sbjct: 1   MDENKQKALAAALGQIEKQFGKGSIMRLGDN-RAMDVETISTGSLSLDIALGAGGLPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVEVYGPESSGKTTL L++IA AQ  G   AFIDAEHALDPVYA +LGVDID +L+SQPD
Sbjct: 60  IVEVYGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVDIDALLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEICDALARSGAIDVMVVDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SN  CIFI Q+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKQSNCMCIFIKQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A   +MYG+G +REG +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELVDLGVKHKLVEKAGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPII 332
           G+  A   L+E+ ++ + ++ K+RE    P +
Sbjct: 300 GKANACNYLREHTEVAQTIDKKLREMLLSPAV 331


>RECA_ROSCS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  330 bits (845), Expect = 1e-92
 Identities = 189/324 (58%), Positives = 224/324 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QI+ K+GKGSIM+ GE    L I VIPTG++ LD AL         
Sbjct: 3   LSPEKEKALAAAMSQIDRKYGKGSIMRMGEASSKLAIEVIPTGSIALDIALXXXXXXXXX 62

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTLA  IIAEAQ MGG+ AFIDAEHA DPVYA R GVD+D +L+SQPD
Sbjct: 63  XXEIYGPESSGKTTLAQHIIAEAQKMGGVAAFIDAEHAFDPVYAKRCGVDVDNLLVSQPD 122

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEIC+                    PRAEIEG++GD+  GLQARLMSQALRKL+G
Sbjct: 123 YGEQALEICETXXXXXXXXXXXXXXXXXXXPRAEIEGDMGDSLPGLQARLMSQALRKLSG 182

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SKS    IF+NQLR KIGVMFG+PETTTGG+ALKF+                 E +G 
Sbjct: 183 AISKSRVVVIFLNQLRLKIGVMFGSPETTTGGQALKFYASVRMDIRRIETLKNGQETIGS 242

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEFD+M+ EGISR G I+D+ VE  + +KSGAW+  GE+RLGQ
Sbjct: 243 RTRVKVVKNKVAPPFRQAEFDIMHNEGISRAGNILDVGVELDIIRKSGAWFYLGEDRLGQ 302

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GRE AKQ L ENP L +E+E  +R
Sbjct: 303 GRENAKQFLNENPALADEIERLIR 326


>RECA_SHESH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  329 bits (844), Expect = 2e-92
 Identities = 182/320 (56%), Positives = 228/320 (71%), Gaps = 1/320 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDANKEKALNAVLGQIEKQFGKGSIMKLGEN-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G + AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQREGKVCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 182 NLKQTNTMLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDRDEVIGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+  G +VD+ V   + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGQGINSTGELVDLGVAHKLVEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELE 320
           GR  A + L ENP + +E++
Sbjct: 302 GRANAGKYLIENPAVAQEID 321


>RECA_METCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  329 bits (844), Expect = 2e-92
 Identities = 177/310 (57%), Positives = 226/310 (72%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L     QIE +FGKGS+M+ G+     +I VIPTG+L LD ALG GG+PRGR
Sbjct: 1   MDENKRKALGAALSQIEKQFGKGSVMRMGDVAAVRDIDVIPTGSLALDIALGCGGLPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA+AQ  GG+ AF+DAEHALDPVYA ++GV++D++L+SQPD
Sbjct: 61  IVEIYGPESSGKTTLTLEVIAQAQKTGGVAAFVDAEHALDPVYAEKIGVNLDDLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D                    P+AE+EGE+GD+ +GLQARLMSQALRKL  
Sbjct: 121 TGEQALEIADXXXXXXXXXXXXXXXXXXXTPKAELEGEMGDSHMGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRSGAIKNGDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR A+F+++YGEGISREG ++D+ V   + +KSG+WY+YG +R+GQ
Sbjct: 241 ETRVKVVKNKVAPPFRTADFEILYGEGISREGELIDLGVNHDIVQKSGSWYSYGGDRIGQ 300

Query: 301 GREAAKQTLK 310
           G++  +  LK
Sbjct: 301 GKDNVRIYLK 310


>RECA_RALEJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  329 bits (843), Expect = 3e-92
 Identities = 176/329 (53%), Positives = 230/329 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QIE +FGKGSIM+ G+G  + +I V+ TG+L LD A          
Sbjct: 10  LSAEKQKALAAALSQIEKQFGKGSIMRMGDGEVEKDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ++AE Q +GG  AFIDAEHALD  YA++LGVD+ E+LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVNYASKLGVDVGELLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 130 TGEQALEITDALVRSGSIDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 +++G 
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDDVIGN 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YG+GISR+G I+D+ V+A + +KSGAWY+Y  +++GQ
Sbjct: 250 ETXXXXXXXXXSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKSGAWYSYNGDKIGQ 309

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G++ A++ L+ENPD+ +E+E KVR +  +
Sbjct: 310 GKDNAREYLRENPDIAQEIENKVRAALGV 338


>RECA_RHOCA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  328 bits (842), Expect = 3e-92
 Identities = 184/323 (56%), Positives = 223/323 (69%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L+    QIE +FGKGSIMK G       I    T              P+GRIVE
Sbjct: 16  DKQKALECALAQIERQFGKGSIMKLGGDTPPPEIEATSTXXXXXXXXXXXXXXPKGRIVE 75

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDP YA +LGV ++++LISQPDTGE
Sbjct: 76  IYGPESSGKTTLTLHCIAEEQKKGGVCAFVDAEHALDPYYAKKLGVSLEDLLISQPDTGE 135

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AEIEG++GD TVG QARLMSQA+RKL  S+ 
Sbjct: 136 QALEIVDTLVRSGXXXXXXXXXXXXXTPKAEIEGDMGDATVGAQARLMSQAMRKLTASIG 195

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETT+GG ALKF+                 E++G    
Sbjct: 196 RSNCMVIFINQIRMKIGVMFGSPETTSGGNALKFYASVRLDIRRTGAIKDRDEVIGNQTR 255

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD++YGEGIS+ G +VD+ V+AGV  KSGAWY+YG+ER+GQGRE
Sbjct: 256 VKVVKNKVAPPFREVEFDILYGEGISKVGELVDLGVKAGVVAKSGAWYSYGDERIGQGRE 315

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ L++NPD+  E+E K+R S
Sbjct: 316 NAKQFLRDNPDIAYEIEDKIRAS 338


>RECA_JANMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 367

 Score =  328 bits (841), Expect = 4e-92
 Identities = 170/329 (51%), Positives = 214/329 (65%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           + +KSK       QIE +FGKGS+M+  +G     + V+ TG+L LD A           
Sbjct: 9   SSDKSKXXXXXXXQIEKQFGKGSVMRMEDGAVVEEVQVVSTGSLGLDIAXXXXXXXXXXX 68

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
            E+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALD  YA +LG+++ ++LISQPDT
Sbjct: 69  XEIYGPESSGKTTLTLQTIAEMQKLGGTCAFIDAEHALDVTYAQKLGINLSDLLISQPDT 128

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICD LVRSG              PRAEIEG++GD+  GLQARLMSQALRKL GS
Sbjct: 129 GEQALEICDALVRSGGVDLIVIDSVAALTPRAEIEGDMGDSLPGLQARLMSQALRKLTGS 188

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G  
Sbjct: 189 INRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIKSGDEVIGNE 248

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F++A FD++YGEG SREG I+D+  +A + +KSGAWY+Y  ER+GQG
Sbjct: 249 TKVKVVKNKIAPPFKEAHFDILYGEGTSREGEILDLGSDAKIVEKSGAWYSYNGERIGQG 308

Query: 302 REAAKQTLKENPDLREELETKVRESFEIP 330
           ++ A+  LKE PDL  E+E KVR S  +P
Sbjct: 309 KDNARNYLKERPDLAREIENKVRVSLGVP 337


>RECA_HAES2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  328 bits (841), Expect = 4e-92
 Identities = 183/310 (59%), Positives = 223/310 (71%), Gaps = 1/310 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKG+IMK GE    L+I  I TG+L LD ALGIGG+P GRIVE++GPESSGKTT
Sbjct: 17  QIEKQFGKGAIMKLGET-QKLDIEAISTGSLSLDVALGIGGLPMGRIVEIFGPESSGKTT 75

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L +IA+AQ  G   AFIDAEHALDP+YAA+LGVD+ E+LISQPD GEQALEICD LVR
Sbjct: 76  LTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELLISQPDNGEQALEICDALVR 135

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GDT VGLQARLMSQALRKL G +  SN   +FINQ
Sbjct: 136 SGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLTGQIKNSNCLVVFINQ 195

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGV+FGNPETTTGG ALKF+                 E++G               
Sbjct: 196 IRMKIGVVFGNPETTTGGNALKFYASVRLDIRRVGSIKNGDEVIGNETRVKVVKNKVAPP 255

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQ +F ++YGEGISR G ++++ V+  +  KSGAW++Y  E++GQG+  A + L E+P+
Sbjct: 256 FRQVDFQILYGEGISRNGELIELGVKHKLVNKSGAWFSYEGEKIGQGKTNAMKWLAEHPE 315

Query: 315 LREELETKVR 324
               LE K+R
Sbjct: 316 QAAILEQKLR 325


>RECA_HAES1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  328 bits (841), Expect = 4e-92
 Identities = 183/310 (59%), Positives = 223/310 (71%), Gaps = 1/310 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKG+IMK GE    L+I  I TG+L LD ALGIGG+P GRIVE++GPESSGKTT
Sbjct: 17  QIEKQFGKGAIMKLGET-QKLDIEAISTGSLSLDVALGIGGLPMGRIVEIFGPESSGKTT 75

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L +IA+AQ  G   AFIDAEHALDP+YAA+LGVD+ E+LISQPD GEQALEICD LVR
Sbjct: 76  LTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELLISQPDNGEQALEICDALVR 135

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GDT VGLQARLMSQALRKL G +  SN   +FINQ
Sbjct: 136 SGXXXXXXXXXXXXLTPKAEIEGEMGDTHVGLQARLMSQALRKLTGQIKNSNCLVVFINQ 195

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGV+FGNPETTTGG ALKF+                 E++G               
Sbjct: 196 IRMKIGVIFGNPETTTGGNALKFYASVRLDIRRVGSIKNGDEVIGNETRVKVVKNKVAPP 255

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQ +F ++YGEGISR G ++++ V+  +  KSGAW++Y  E++GQG+  A + L E+P+
Sbjct: 256 FRQVDFQILYGEGISRNGELIELGVKHKLVNKSGAWFSYEGEKIGQGKTNAMKWLAEHPE 315

Query: 315 LREELETKVR 324
               LE K+R
Sbjct: 316 QAAILEQKLR 325


>RECA_NAUPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  328 bits (840), Expect = 6e-92
 Identities = 180/332 (54%), Positives = 233/332 (70%), Gaps = 2/332 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+  K K L+L   QI+ +FGKGS++K  +   +  I  IPTG+  LD ALGIGG+P+GR
Sbjct: 1   MDANKQKALELAMKQIDKQFGKGSLVKLSDKDIE-PIAAIPTGSFGLDLALGIGGIPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I E+YGPESSGKTTLAL IIA+AQ  GG+ AFIDAEHALD +YA  +GVD+D +L+SQPD
Sbjct: 60  ITEIYGPESSGKTTLALSIIAQAQKDGGVAAFIDAEHALDVIYAKHIGVDVDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + L RSG              P+AEIEG +GD  VG+QARLMSQALRKL  
Sbjct: 120 YGEQALEIVETLARSGAVDIIVIDSVAALTPKAEIEGNMGDAQVGVQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
           ++ K NTT +FINQ+R KIG+M +G+PETTTGG ALKF+                 + VG
Sbjct: 180 AIHKMNTTVVFINQIRMKIGMMGYGSPETTTGGNALKFYSSVRLDVRRIATLKQADKEVG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR AEFD+M+G+GISREG ++D  V+  +  KSGAW++YG  RLG
Sbjct: 240 NRXXXXXXXXXXAPPFRIAEFDIMFGKGISREGELLDYGVKLDIIDKSGAWFSYGATRLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPI 331
           QG+E AK+ LK +P+L +E+E K++++  + +
Sbjct: 300 QGKENAKEYLKSHPELAQEIEQKIKDALGVEL 331


>RECA_RICFE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  327 bits (839), Expect = 7e-92
 Identities = 174/312 (55%), Positives = 222/312 (71%), Gaps = 1/312 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  + ++I  + TG+L LD ALGIGGVP+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPN-IDIEAVSTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFGNPETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGNPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYNNVRIGQG 301

Query: 302 REAAKQTLKENP 313
           RE  KQ LKE+P
Sbjct: 302 RENVKQYLKEHP 313


>RECA_RICCK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  327 bits (839), Expect = 7e-92
 Identities = 174/314 (55%), Positives = 223/314 (71%), Gaps = 1/314 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  + ++I  + TG+L LD ALGIGGVP+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPN-IDIEAVSTGSLGLDMALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEITDTLIRSGGIDMVIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +S++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 ISRTNCIAVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYNNVRIGQG 301

Query: 302 REAAKQTLKENPDL 315
           RE  KQ LKE+P +
Sbjct: 302 RENVKQYLKEHPQI 315


>RECA_PROVU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 325

 Score =  327 bits (839), Expect = 7e-92
 Identities = 184/317 (58%), Positives = 226/317 (71%), Gaps = 1/317 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L     QIE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALGQIEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 182 NLKQANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGEEVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQAEFQILYGEGINIHGELVDLGVKHKLIEKAGAWYSYNGDKIGQ 301

Query: 301 GREAAKQTLKENPDLRE 317
           G+  A   LKEN  ++E
Sbjct: 302 GKANACNFLKENSLVKE 318


>RECA_HAEIN RecName: Full=Protein recA;AltName: Full=Recombinase
           A;AltName: Full=Recombinase 1;
          Length = 354

 Score =  327 bits (839), Expect = 7e-92
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L     QIE +FGKGSIMK G+    L++  I TG+L LD ALGIGG+P GRIV
Sbjct: 5   EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIV 63

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L +IA+AQ  G   AFIDAEHALDP+YAA+LGVD+ E+ +SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELFVSQPDNG 123

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL G +
Sbjct: 124 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGQI 183

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             +N   +FINQ+R KIGVMFGNPETTTGG ALKF+                  I+G   
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGENIIGNET 243

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ +F ++YGEGIS+ G ++++ V+  + +KSGAWY+Y  E++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVKHKLVEKSGAWYSYNGEKIGQGK 303

Query: 303 EAAKQTLKENPDLREELETKVR 324
             + + L EN +  +ELE ++R
Sbjct: 304 ANSMKWLNENIEKSDELEARLR 325


>RECA_HAEIG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  327 bits (839), Expect = 7e-92
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L     QIE +FGKGSIMK G+    L++  I TG+L LD ALGIGG+P GRIV
Sbjct: 5   EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIV 63

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L +IA+AQ  G   AFIDAEHALDP+YAA+LGVD+ E+ +SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELFVSQPDNG 123

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL G +
Sbjct: 124 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGQI 183

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             +N   +FINQ+R KIGVMFGNPETTTGG ALKF+                  I+G   
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGENIIGNET 243

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ +F ++YGEGIS+ G ++++ V+  + +KSGAWY+Y  E++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVKHKLVEKSGAWYSYNGEKIGQGK 303

Query: 303 EAAKQTLKENPDLREELETKVR 324
             + + L EN +  +ELE ++R
Sbjct: 304 ANSMKWLNENIEKSDELEARLR 325


>RECA_HAEIE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  327 bits (839), Expect = 7e-92
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L     QIE +FGKGSIMK G+    L++  I TG+L LD ALGIGG+P GRIV
Sbjct: 5   EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIV 63

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L +IA+AQ  G   AFIDAEHALDP+YAA+LGVD+ E+ +SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELFVSQPDNG 123

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL G +
Sbjct: 124 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGQI 183

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             +N   +FINQ+R KIGVMFGNPETTTGG ALKF+                  I+G   
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGENIIGNET 243

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ +F ++YGEGIS+ G ++++ V+  + +KSGAWY+Y  E++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVKHKLVEKSGAWYSYNGEKIGQGK 303

Query: 303 EAAKQTLKENPDLREELETKVR 324
             + + L EN +  +ELE ++R
Sbjct: 304 ANSMKWLNENIEKSDELEARLR 325


>RECA_HAEI8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  327 bits (839), Expect = 7e-92
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L     QIE +FGKGSIMK G+    L++  I TG+L LD ALGIGG+P GRIV
Sbjct: 5   EEKQKALAAALGQIEKQFGKGSIMKLGDT-KTLDVESISTGSLGLDVALGIGGLPMGRIV 63

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L +IA+AQ  G   AFIDAEHALDP+YAA+LGVD+ E+ +SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELFVSQPDNG 123

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL G +
Sbjct: 124 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGQI 183

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             +N   +FINQ+R KIGVMFGNPETTTGG ALKF+                  I+G   
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGENIIGNET 243

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ +F ++YGEGIS+ G ++++ V+  + +KSGAWY+Y  E++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVKHKLVEKSGAWYSYNGEKIGQGK 303

Query: 303 EAAKQTLKENPDLREELETKVR 324
             + + L EN +  +ELE ++R
Sbjct: 304 ANSMKWLNENIEKSDELEARLR 325


>RECA_CORGL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 376

 Score =  327 bits (839), Expect = 7e-92
 Identities = 186/335 (55%), Positives = 229/335 (68%), Gaps = 1/335 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L      IE  FGKG++M+ G+      I  I +G   +D ALGIGG PRGRIVE
Sbjct: 17  DRQKALDAALALIEKDFGKGAVMRLGDENRP-PIQTISSGNTAIDIALGIGGFPRGRIVE 75

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL              FIDAEHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 76  VYGPESSGKTTVALHXXXXXXXXXXXXXFIDAEHALDPDYARKLGVDTDALLVSQPDTGE 135

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L 
Sbjct: 136 QALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKMTGALY 195

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + +G    
Sbjct: 196 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDIRRIQTLKDGQDAIGNRTR 255

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AEFD+MYGEGISRE  ++D+AV+ G+ KKSG+W+TY  E+LGQG+E
Sbjct: 256 LKVVKNKVSPPFKIAEFDIMYGEGISRESSVIDLAVDNGIVKKSGSWFTYEGEQLGQGKE 315

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
             + +LKENP+L +ELE K+ +   +     +++E
Sbjct: 316 KVRLSLKENPELTDELEDKIFKKLGVGKYAAASDE 350


>RECA_CORGB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 376

 Score =  327 bits (839), Expect = 7e-92
 Identities = 186/335 (55%), Positives = 229/335 (68%), Gaps = 1/335 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L      IE  FGKG++M+ G+      I  I +G   +D ALGIGG PRGRIVE
Sbjct: 17  DRQKALDAALALIEKDFGKGAVMRLGDENRP-PIQTISSGNTAIDIALGIGGFPRGRIVE 75

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTT+AL              FIDAEHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 76  VYGPESSGKTTVALHXXXXXXXXXXXXXFIDAEHALDPDYARKLGVDTDALLVSQPDTGE 135

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L 
Sbjct: 136 QALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKMTGALY 195

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + +G    
Sbjct: 196 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDIRRIQTLKDGQDAIGNRTR 255

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+ AEFD+MYGEGISRE  ++D+AV+ G+ KKSG+W+TY  E+LGQG+E
Sbjct: 256 LKVVKNKVSPPFKIAEFDIMYGEGISRESSVIDLAVDNGIVKKSGSWFTYEGEQLGQGKE 315

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
             + +LKENP+L +ELE K+ +   +     +++E
Sbjct: 316 KVRLSLKENPELTDELEDKIFKKLGVGKYAAASDE 350


>RECA_FRATW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRATT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRATO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRATN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRATM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRATH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRATF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRAT1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/323 (55%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFG--EGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           K K L+    QIE +FGKG+IM+ G  E  HD++  VIP+G + LD ALGIGG P+GRI+
Sbjct: 3   KEKALESALSQIEKQFGKGAIMRLGDQEAAHDID--VIPSGIIALDVALGIGGYPKGRII 60

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTL L  IA+ Q  GG  AF+DAEHALDP YA  LGVD+D +++SQPDTG
Sbjct: 61  EIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEHALDPKYAKLLGVDVDNLIVSQPDTG 120

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++
Sbjct: 121 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 180

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G   
Sbjct: 181 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLEVKKGGSIKDGIDVSGNEI 240

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+QA+F+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+
Sbjct: 241 XXXXXXXXXAPPFKQADFELIYGEGISLEAELIDLGAKYNIIEKSGAWYSYKGKKIGQGK 300

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E +K+ LKEN   R+E+E  + E
Sbjct: 301 EKSKEYLKENTAERDEIERAILE 323


>RECA_FRAP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 360

 Score =  327 bits (838), Expect = 1e-91
 Identities = 178/316 (56%), Positives = 225/316 (71%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L+    QIE +FGKGSIM+ G+     +I VIP+G + LD ALGIGG P+GRI+E+
Sbjct: 3   KEKALESALSQIEKQFGKGSIMRLGDQETAHDIDVIPSGIIALDVALGIGGYPKGRIIEI 62

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YG ESSGKTTL L  IA+ Q  GG+ AFIDAEHALDP YA  LGVD+D +++SQPDTGEQ
Sbjct: 63  YGHESSGKTTLTLLAIAQCQKQGGVAAFIDAEHALDPKYAKLLGVDVDNLIVSQPDTGEQ 122

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI DMLVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL  ++ +
Sbjct: 123 ALEIADMLVRSGGIDIVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANIKR 182

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           SNT  +FINQ+R KIGVMFGNPETTTGG ALKF+                 ++ G     
Sbjct: 183 SNTLVMFINQIRMKIGVMFGNPETTTGGNALKFYASVRLEVRKGGSIKDGVDVSGNEXXX 242

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+QAEF+L+YGEGIS E  ++D+  +  + +KSGAWY+Y  +++GQG+E 
Sbjct: 243 XXXXXXXAPPFKQAEFELIYGEGISLEAELIDLGAKYEIIEKSGAWYSYKGKKIGQGKEK 302

Query: 305 AKQTLKENPDLREELE 320
           +K+ LKEN   R+E+E
Sbjct: 303 SKEYLKENTLERDEIE 318


>RECA_ENTFC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  327 bits (838), Expect = 1e-91
 Identities = 188/314 (59%), Positives = 225/314 (71%), Gaps = 1/314 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE  +GKGSIMK GE   D  I  IP+G+L LD ALG+GG PRGRI+EVYGPESSGKTT+
Sbjct: 16  IEKSYGKGSIMKLGEK-IDQQISTIPSGSLALDVALGVGGYPRGRIIEVYGPESSGKTTV 74

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
           AL  IAE Q  GG  AFIDAEHALDP YA +LGV+IDE+L+SQPDTGEQ LEI D     
Sbjct: 75  ALHAIAEVQKNGGTAAFIDAEHALDPQYAQKLGVNIDELLLSQPDTGEQGLEIADAXXXX 134

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
                          PRAEI+GE+GD+ VGLQARLMSQALRKL+GS++K+ T  IFINQ+
Sbjct: 135 XXXXXXXXXXXXXXXPRAEIDGEMGDSHVGLQARLMSQALRKLSGSINKTKTIAIFINQI 194

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           REK+GVMFGNPE T GGRALKF+                 +IVG               F
Sbjct: 195 REKVGVMFGNPEITPGGRALKFYATIRLEVRRAEQLKQGTDIVGNRTKIKVVKNKVAPPF 254

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AE D+MYG GIS+EG ++DMAVE  +  KSGAWY+Y E+R+GQGRE AK  +  +P++
Sbjct: 255 KIAEVDVMYGLGISQEGELLDMAVEKDIVDKSGAWYSYKEDRIGQGRENAKIYMANHPEM 314

Query: 316 REELETKVRESFEI 329
             E+   VR ++ I
Sbjct: 315 MAEVSALVRAAYGI 328


>RECA_AQUPY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  327 bits (838), Expect = 1e-91
 Identities = 197/322 (61%), Positives = 240/322 (74%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L++    IE +FGKG++M   +    + +  IPTG++ LD A G+GG+P+GRI E
Sbjct: 10  EKMKALEVALSSIEKRFGKGAVMPL-KAVETVEVETIPTGSISLDIATGVGGIPKGRITE 68

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++G ESSGKTTLAL +IAEAQ  GG+  FIDAEHALDP YA +LGVD+D + ISQPD GE
Sbjct: 69  IFGVESSGKTTLALHVIAEAQKRGGVAVFIDAEHALDPKYAKKLGVDVDNLYISQPDYGE 128

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + L+ SG              P+ E+EGE+G+  VG QARLMSQALRKL G++ 
Sbjct: 129 QALEIAESLINSGXXXXXXXXXXXXXXPKDELEGEMGEAQVGKQARLMSQALRKLKGAVH 188

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SNT  IFINQ+REKIGVMFGNPETT GGRALKFF                         
Sbjct: 189 RSNTALIFINQIREKIGVMFGNPETTPGGRALKFFSDMRLEVRRLGDXXXXXXXXXXXXX 248

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F++AEFD++YGEGI R   I+D A   GV  KSG+WY+YGE+RLGQGRE
Sbjct: 249 XXXXXNKLAPPFQEAEFDVIYGEGICRICDIIDTAANLGVITKSGSWYSYGEKRLGQGRE 308

Query: 304 AAKQTLKENPDLREELETKVRE 325
            AK+ L E+P++ EE+E KVRE
Sbjct: 309 QAKKYLLEHPEMLEEIERKVRE 330


>RECA_ACTAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  327 bits (838), Expect = 1e-91
 Identities = 180/323 (55%), Positives = 227/323 (70%), Gaps = 1/323 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L     QIE +FGKG+IMK G+    L+I  I TG+  LD ALGIGG+P GRIV
Sbjct: 5   EEKQKALDAALGQIEKQFGKGAIMKLGDS-QKLDIEAISTGSFGLDLALGIGGLPMGRIV 63

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L +IAEAQ  G   AFIDAEHALDP+YA++LGVD+ E L+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAEAQKTGKTCAFIDAEHALDPIYASKLGVDVKEPLVSQPDNG 123

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEG++GD+ +GLQARLMSQALRKL   +
Sbjct: 124 EQALEICDALVRSGXXXXXXXXXXXXLTPKAEIEGDMGDSHMGLQARLMSQALRKLTSQI 183

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G   
Sbjct: 184 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRVGSIKEGDEVIGNET 243

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ +F ++YGEGIS+E  ++++ V+  +  K+GAWY Y  E++GQG+
Sbjct: 244 RVKVVKNKVAPPFRQVDFQILYGEGISKESELIELGVKHKLISKAGAWYAYQNEKIGQGK 303

Query: 303 EAAKQTLKENPDLREELETKVRE 325
             A + LK+NP+  + +E+ +R+
Sbjct: 304 TNAMKWLKDNPEQAKFIESTLRD 326


>RECA_ACIAD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  327 bits (838), Expect = 1e-91
 Identities = 168/341 (49%), Positives = 227/341 (66%), Gaps = 5/341 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDDNKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IVEIYGPESSGKTTMTLQAIAQCQKAGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 HGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI+G 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIIGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A F ++YG+G+++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFREAIFQILYGKGVNQLGELVDLAVQQNIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADA 341
           G+    + L+ENP +  E+E  +RE     ++T+++++  A
Sbjct: 300 GKNNVIRYLEENPQISTEIEAVIREQ----LLTKASDQTAA 336


>RECA_VIBFM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  327 bits (837), Expect = 1e-91
 Identities = 166/316 (52%), Positives = 216/316 (68%), Gaps = 1/316 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIMK G+    +++  + TG+L LD ALG GG+P GRIVE++GPESSGKTT
Sbjct: 15  QIEKQFGKGSIMKLGDN-RTMDVETVSTGSLSLDIALGAGGLPMGRIVEIFGPESSGKTT 73

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L++IA AQ  G   AFIDAEHALDPVYA +LGV+IDE+L+SQPDTGEQALEICD L R
Sbjct: 74  LTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDELLVSQPDTGEQALEICDALAR 133

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G+L +SN   IFINQ
Sbjct: 134 SGAVDVMVIDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTGNLKQSNCMAIFINQ 193

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 194 IRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKDGDEVVGNETRIKVVKNKIAAP 253

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAE  +MYG+G +REG ++D+ V+  +  K+GAWY+Y  +++GQG+  A + ++EN +
Sbjct: 254 FKQAETQIMYGQGFNREGELIDLGVKHKLVDKAGAWYSYNGDKIGQGKANASKFMRENTE 313

Query: 315 LREELETKVRESFEIP 330
           +  EL+ K+RE    P
Sbjct: 314 VAAELDKKLREMLLTP 329


>RECA_VIBF1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  327 bits (837), Expect = 1e-91
 Identities = 166/316 (52%), Positives = 216/316 (68%), Gaps = 1/316 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIMK G+    +++  + TG+L LD ALG GG+P GRIVE++GPESSGKTT
Sbjct: 15  QIEKQFGKGSIMKLGDN-RTMDVETVSTGSLSLDIALGAGGLPMGRIVEIFGPESSGKTT 73

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L++IA AQ  G   AFIDAEHALDPVYA +LGV+IDE+L+SQPDTGEQALEICD L R
Sbjct: 74  LTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDELLVSQPDTGEQALEICDALAR 133

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G+L +SN   IFINQ
Sbjct: 134 SGAVDVMVIDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTGNLKQSNCMAIFINQ 193

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 194 IRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKDGDEVVGNETRIKVVKNKIAAP 253

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAE  +MYG+G +REG ++D+ V+  +  K+GAWY+Y  +++GQG+  A + ++EN +
Sbjct: 254 FKQAETQIMYGQGFNREGELIDLGVKHKLVDKAGAWYSYNGDKIGQGKANASKFMRENTE 313

Query: 315 LREELETKVRESFEIP 330
           +  EL+ K+RE    P
Sbjct: 314 VAAELDKKLREMLLTP 329


>RECA_NITEC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  327 bits (837), Expect = 1e-91
 Identities = 181/329 (55%), Positives = 229/329 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K+K L     QIE ++GKGSIM+ G+     +I V+ TG+L LD ALG+GG+PRGR
Sbjct: 1   MDENKNKALTAALAQIEKQYGKGSIMRLGDSDVAKDIQVVSTGSLSLDIALGVGGLPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALDP YA ++GV++ E+LISQPD
Sbjct: 61  IIEIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDPQYAQKIGVNVQELLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              PRAEIEGE+G+  +GLQARLMSQALRKL  
Sbjct: 121 NGEQALEITDMLVRSGXXXXXXXXXXXXLTPRAEIEGEMGEPQMGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NTT IFINQ+R KIGVMFGNPETTTGG ALKF+                 EIVG 
Sbjct: 181 NIKRTNTTVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIKRGEEIVGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QA+F ++Y            + V   + +K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKQADFAILYXXXXXXXXXXXXLGVLHKLIEKAGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           GR+  +  LKE+ DL  E+E K+R + ++
Sbjct: 301 GRDNVRDYLKEHKDLAHEIEQKIRAAVDL 329


>RECA_RHOOB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  326 bits (835), Expect = 2e-91
 Identities = 178/314 (56%), Positives = 217/314 (69%), Gaps = 1/314 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L L   QI+  FGKGS+M+ GEG     I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 7   DRDKALDLALAQIDKNFGKGSVMRLGEGVRQ-PIAVIPTGSISLDVALGIGGLPRGRVVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAQKLGVDTDALLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+LS
Sbjct: 126 QALEIADMLIRSGALDILVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+WYTY  ++LGQG+E
Sbjct: 246 XXXXXXXXAPPFKQAEFDILYGQGISKEGSLIDMGVEHGFIRKSGSWYTYEGDQLGQGKE 305

Query: 304 AAKQTLKENPDLRE 317
            A++ L EN D+R+
Sbjct: 306 NARKFLLENTDIRD 319


>RECA_NITSB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  326 bits (835), Expect = 2e-91
 Identities = 201/327 (61%), Positives = 248/327 (75%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+  K K L L   QI+  FGKG+++K G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 1   MDTNKQKALDLAIKQIDKAFGKGALVKLGDKQIE-PIESISTGSLGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTLALQIIAEAQ  GG+ AFIDAEHALD +YA  LGVDID +L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLALQIIAEAQKKGGVAAFIDAEHALDVLYAKNLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQAL+I + + RSG              P+AEIEGE+GD+ +GLQARLMSQALRKL G
Sbjct: 120 FGEQALDIVETIARSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K +TT IFINQ+R KIG M +G PETTTGG ALKF+                   +G
Sbjct: 180 VVHKMDTTVIFINQIRMKIGAMGYGTPETTTGGNALKFYASVRVDVRRIATLKQGESQIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEGIS+EG ++D  V+  +  KSG+W++Y + +LG
Sbjct: 240 XXXXXXXXXXXXXXXFRQAEFDIMFGEGISKEGELIDYGVKMDIIDKSGSWFSYKDIKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGRE AK  LKE+P++ +E+E ++R +
Sbjct: 300 QGRENAKAYLKEHPEVAQEIENEIRRA 326


>RECA_COREF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 386

 Score =  326 bits (835), Expect = 2e-91
 Identities = 174/336 (51%), Positives = 217/336 (64%), Gaps = 1/336 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +++ K L      IE  FGKG++M+ G+      I VI +G   LD ALGIGG PRGRIV
Sbjct: 14  DDRQKALDAALALIEKDFGKGAVMRLGDENRP-PIQVISSGNTALDIALGIGGFPRGRIV 72

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           EVYGPESSGKTT+AL              FIDAEHALDP YA +LGVD D +L+SQPDTG
Sbjct: 73  EVYGPESSGKTTVALHXXXXXXXXXXXXXFIDAEHALDPDYARKLGVDTDALLVSQPDTG 132

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L
Sbjct: 133 EQALEIADMLVRSGAIDILVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKMTGAL 192

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + +G   
Sbjct: 193 YNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRIDVRRIQTLKDGQDAIGNRT 252

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD++YGEGISRE  I+D+AV+ G+ KKSG+W+TY  ++LGQG+
Sbjct: 253 RAKIVKNKVSPPFKIAEFDIIYGEGISRESSIIDLAVDNGIVKKSGSWFTYEGDQLGQGK 312

Query: 303 EAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           E A+  LKE P+L +E+E K+     +    ++ +E
Sbjct: 313 EKARLFLKETPELADEIEEKIFRKLGVGKFAQTADE 348


>RECA_CUPTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  325 bits (834), Expect = 3e-91
 Identities = 175/329 (53%), Positives = 229/329 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QIE +FGKGSIM+ G+G  + +I V+ TG+L LD A          
Sbjct: 10  VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEVEKDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ++AE Q +GG  AFIDAEHALD  YA++LGV++ ++LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVNYASKLGVNVGDLLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 130 TGEQALEITDALVRSGSIDLIIIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 +++G 
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDDVIGN 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YG+GISR+G I+D+ V+A + +KSGAWY+Y  E++GQ
Sbjct: 250 ETXXXXXXXXXSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKSGAWYSYNGEKIGQ 309

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           G++ A++ L+ENPD+  E+E KVR +  +
Sbjct: 310 GKDNAREYLRENPDIAAEIENKVRAALGV 338


>RECA_BARBK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  325 bits (834), Expect = 3e-91
 Identities = 179/307 (58%), Positives = 222/307 (72%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE  FGKGSIM+ G+    + I  I TG+L LD ALG+GG+P+GRI+E
Sbjct: 2   DKKKALDAALSQIERSFGKGSIMRLGQKEGVVEIETISTGSLSLDIALGVGGLPKGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GG+ AF+DAEHALDP+YA +LGVD++ + +SQPDTGE
Sbjct: 62  IYGPESSGKTTLALHAIAEAQKNGGVCAFVDAEHALDPIYARKLGVDLENLFVSQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + LVRSG              PRAEI+GE+ D+  GLQARLMS+ALRKL  S+ 
Sbjct: 122 QALEITETLVRSGXXXXXXXXXXXXXTPRAEIDGEMSDSLPGLQARLMSKALRKLTASIF 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  +VG    
Sbjct: 182 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDKELVVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD++YGEGIS+ G ++D+ V+ G+ +KSGAW++Y  +RLGQGRE
Sbjct: 242 VKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGAWFSYNSQRLGQGRE 301

Query: 304 AAKQTLK 310
            AKQ L+
Sbjct: 302 NAKQFLR 308


>RECA_RICAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  325 bits (833), Expect = 4e-91
 Identities = 173/312 (55%), Positives = 221/312 (70%), Gaps = 1/312 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  H ++I  + TG+L LD ALGIGGVP+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RS               P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSSGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCIAVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYKNVRIGQG 301

Query: 302 REAAKQTLKENP 313
           RE  KQ LKE+P
Sbjct: 302 RENVKQYLKEHP 313


>RECA_RALEH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  325 bits (833), Expect = 4e-91
 Identities = 178/346 (51%), Positives = 236/346 (68%), Gaps = 4/346 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QIE +FGKGSIM+ G+G  + +I V+ TG+L LD A          
Sbjct: 10  VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEVEKDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ++AE Q +GG  AFIDAEHALD  YA +LGV++ ++LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVSYANKLGVNVGDLLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 130 TGEQALEITDALVRSGSIDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 +++G 
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDDVIGN 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YG+GISR+G I+D+ V+A + +KSGAWY+Y  +++GQ
Sbjct: 250 ETXXXXXXXXXSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKSGAWYSYNGDKIGQ 309

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVA 346
           G++ A++ L+ENPD+ +E+E KVR +  +  +  +     A +PVA
Sbjct: 310 GKDNAREYLRENPDIADEIENKVRAALGVVAMNPTA----AATPVA 351


>RECA_CHLTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  325 bits (833), Expect = 4e-91
 Identities = 197/326 (60%), Positives = 244/326 (74%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YAA +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPNYAALIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EGEIGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGEIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           ++NT  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RTNTCAIFINQIREKIGVSFGNPETTTGGRALKFYXXXXXXXXXXXXXXXXENFDIGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  +  K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCIIDLAVEKNIIDKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRESFE 328
           EA ++ LK N +L  ELE ++ ES +
Sbjct: 305 EAVREELKRNKELFHELERRIYESVQ 330


>RECA_CHLTB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  325 bits (833), Expect = 4e-91
 Identities = 197/326 (60%), Positives = 244/326 (74%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YAA +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPNYAALIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EGEIGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGEIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           ++NT  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RTNTCAIFINQIREKIGVSFGNPETTTGGRALKFYXXXXXXXXXXXXXXXXENFDIGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  +  K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCIIDLAVEKNIIDKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRESFE 328
           EA ++ LK N +L  ELE ++ ES +
Sbjct: 305 EAVREELKRNKELFHELERRIYESVQ 330


>RECA_CHLT2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  325 bits (833), Expect = 4e-91
 Identities = 197/326 (60%), Positives = 244/326 (74%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YAA +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPNYAALIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EGEIGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGEIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           ++NT  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RTNTCAIFINQIREKIGVSFGNPETTTGGRALKFYXXXXXXXXXXXXXXXXENFDIGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  +  K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCIIDLAVEKNIIDKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRESFE 328
           EA ++ LK N +L  ELE ++ ES +
Sbjct: 305 EAVREELKRNKELFHELERRIYESVQ 330


>RECA_CHLMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  325 bits (833), Expect = 4e-91
 Identities = 180/324 (55%), Positives = 228/324 (70%), Gaps = 1/324 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRI+E
Sbjct: 5   DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YAA +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPNYAALIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EGEIGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGEIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           ++NT  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RTNTCAIFINQIREKIGVSFGNPETTTGGRALKFYSSIRMDIRRIGAIKGGENFDIGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  +  K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCIIDLAVEKNIIDKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRES 326
           EA ++ LK N +L +ELE ++ ES
Sbjct: 305 EAVREELKRNKELFQELERRIYES 328


>RECA_RICCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  325 bits (832), Expect = 5e-91
 Identities = 173/312 (55%), Positives = 221/312 (70%), Gaps = 1/312 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  H ++I  + TG+L LD ALGIGGVP+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RS               P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSSGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYKNVRIGQG 301

Query: 302 REAAKQTLKENP 313
           RE  KQ LKE+P
Sbjct: 302 RENVKQYLKEHP 313


>RECA_RHOS4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  324 bits (831), Expect = 6e-91
 Identities = 179/337 (53%), Positives = 226/337 (67%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L+    QIE +FGKGSIMK G     + I    T              P+GRI+E
Sbjct: 2   DKAKALESALAQIERQFGKGSIMKLGANSPVMEIEATSTXXXXXXXXXXXXXXPKGRIIE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L ++AE Q  GG+ AF+DAEHALDP YA +LGV++DE+LISQPDTGE
Sbjct: 62  IYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P++EIEG++GD  +G QARLMSQA+RKL  S+ 
Sbjct: 122 QALEIVDTLVRSGAVNLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMSQAMRKLTASIG 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFGNPETTTGG ALKF+                  ++G    
Sbjct: 182 RSNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDRDNVIGXXXX 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+MYGEGIS+ G +VD+ V+AGV +KSG+WY+YG+ER+GQGRE
Sbjct: 242 XXXXXXXXAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYSYGDERIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
            AK  L+ NP +  ++E ++R S  +   T    + D
Sbjct: 302 NAKAFLRANPTVAGDIEDRIRASHGLDFSTGEDGKGD 338


>RECA_RHOS1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  324 bits (831), Expect = 6e-91
 Identities = 179/337 (53%), Positives = 226/337 (67%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L+    QIE +FGKGSIMK G     + I    T              P+GRI+E
Sbjct: 16  DKAKALESALAQIERQFGKGSIMKLGANSPVMEIEATSTXXXXXXXXXXXXXXPKGRIIE 75

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L ++AE Q  GG+ AF+DAEHALDP YA +LGV++DE+LISQPDTGE
Sbjct: 76  IYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTGE 135

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P++EIEG++GD  +G QARLMSQA+RKL  S+ 
Sbjct: 136 QALEIVDTLVRSGAVNLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMSQAMRKLTASIG 195

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFGNPETTTGG ALKF+                  ++G    
Sbjct: 196 RSNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDRDNVIGXXXX 255

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+MYGEGIS+ G +VD+ V+AGV +KSG+WY+YG+ER+GQGRE
Sbjct: 256 XXXXXXXXAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYSYGDERIGQGRE 315

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
            AK  L+ NP +  ++E ++R S  +   T    + D
Sbjct: 316 NAKAFLRANPTVAGDIEDRIRASHGLDFSTGEDGKGD 352


>RECA_RHOSR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  324 bits (830), Expect = 8e-91
 Identities = 178/314 (56%), Positives = 216/314 (68%), Gaps = 1/314 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L L   QI+  FGKGS+M+ GEG     I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 7   DRDKALDLALAQIDKNFGKGSVMRLGEGVRQ-PIAVIPTGSIALDVALGIGGLPRGRVVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAQKLGVDTDALLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+LS
Sbjct: 126 QALEIADMLIRSGALDILVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GIS+EG ++DM VE G  +KSG+WYTY  ++LGQG+E
Sbjct: 246 XXXXXXXXAPPFKQAEFDILYGLGISKEGSLIDMGVEHGFIRKSGSWYTYEGDQLGQGKE 305

Query: 304 AAKQTLKENPDLRE 317
            A++ L EN D+R+
Sbjct: 306 NARKFLLENTDIRD 319


>RECA_RHOS5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  324 bits (830), Expect = 8e-91
 Identities = 178/330 (53%), Positives = 224/330 (67%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L+    QIE +FGKGSIMK G     + I    T              P+GRI+E
Sbjct: 16  DKAKALESALAQIERQFGKGSIMKLGANSPVMEIEATSTXXXXXXXXXXXXXXPKGRIIE 75

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L ++AE Q  GG+ AF+DAEHALDP YA +LGV++DE+LISQPDTGE
Sbjct: 76  IYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPAYAKKLGVNLDELLISQPDTGE 135

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P++EIEG++GD  +G QARLMSQA+RKL  S+ 
Sbjct: 136 QALEIVDTLVRSGAVSLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMSQAMRKLTASIG 195

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  ++G    
Sbjct: 196 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGGIKDRDNVIGXXXX 255

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+MYGEGIS+ G +VD+ V+AGV +KSG+WY+YG+ER+GQGRE
Sbjct: 256 XXXXXXXXAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYSYGDERIGQGRE 315

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIIT 333
            AK  L+ NP +  ++E K+R S  +   T
Sbjct: 316 NAKAFLRANPSVAGDIEDKIRASHGLDFST 345


>RECA_HAMD5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  324 bits (830), Expect = 8e-91
 Identities = 180/330 (54%), Positives = 229/330 (69%), Gaps = 1/330 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE +FGKGSIM+ GE    +++  I TG+L LD ALG GG+P GRIVE+YGPESSGKTTL
Sbjct: 18  IEKQFGKGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTL 76

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
            LQ+IA AQ  G + AFIDAEHALDPVYA +LGVDID +L SQPDTGEQALEICD L RS
Sbjct: 77  TLQVIAAAQREGKVCAFIDAEHALDPVYAKKLGVDIDNLLCSQPDTGEQALEICDSLTRS 136

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
           G              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG+L  +NT  IFINQ+
Sbjct: 137 GXXXXXXXXXXXXXXPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKNANTLLIFINQI 196

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           R KIGVMFGNPETTTGG ALKF+                  ++G               F
Sbjct: 197 RMKIGVMFGNPETTTGGNALKFYASVRLDIRRVGAIKEGEMVIGNDTRVKVVKNKIAAPF 256

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           +QA+F ++YGEGI+  G ++D+ V+  + +K+G+WY+Y   ++GQG+    + LK NP +
Sbjct: 257 KQADFQILYGEGINTHGELIDLGVKHQLVEKAGSWYSYNGTKIGQGKSNVTEYLKTNPSI 316

Query: 316 REELETKVRESFEIPIITRSTEEADAMSPV 345
             EL+  +R     P+  +   + D +  +
Sbjct: 317 AAELDKILRNRLLNPVCEKDKTDLDPLDKI 346


>RECA_CHLFF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  324 bits (830), Expect = 8e-91
 Identities = 182/345 (52%), Positives = 236/345 (68%), Gaps = 3/345 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKKALEAAIAYIEKQFGSGSIMSLGKHSATHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YA+ +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPGYASLIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EG+IGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGDIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           +S T  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RSQTCAIFINQIREKIGVSFGNPETTTGGRALKFYSSIRIDIRRIGAIKGNESFDLGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  + +K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCILDLAVEHNIVEKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRESFEIP--IITRSTEEADAMSPV 345
           EA ++ LK+N  L +ELE ++ +   +P   +    +E  ++ PV
Sbjct: 305 EAVREELKKNKKLFDELEKRILDVTSVPKATVVEEKKEEQSIQPV 349


>RECA_AZOLI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 369

 Score =  324 bits (830), Expect = 8e-91
 Identities = 190/348 (54%), Positives = 225/348 (64%), Gaps = 8/348 (2%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE  FGKGSIMK G   + +   VI T              P+GRIVE
Sbjct: 15  DKQKALDAALSQIERAFGKGSIMKLGARENLVETEVISTXXXXXXXXXXXXXXPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IA+AQ  GG  AF+DAEHALDP YA +LGV+IDE+LISQPD GE
Sbjct: 75  IYGPESSGKTTLALHAIAQAQKAGGTCAFVDAEHALDPSYARKLGVNIDELLISQPDAGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD   GL ARLMSQALRKL GS+S
Sbjct: 135 QALEIADTLVRSGAIXXXXXXXXXXXXPRAELEGEMGDAMSGLHARLMSQALRKLTGSIS 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSN   IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG    
Sbjct: 195 KSNCLVIFINQIRLKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKDRDTVVGNQTR 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR  EFD+MYGEG+S+ G ++D+ ++AGV  KSGAW++Y   R+GQGRE
Sbjct: 255 VKVVKNKMAPPFRVVEFDIMYGEGVSKVGELLDLGIQAGVVDKSGAWFSYDGTRIGQGRE 314

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKK 351
            AK  L+ NP++ + +E K+R +  +         ADAM    KP  K
Sbjct: 315 NAKTYLRNNPEMADAIEAKIRGNAGL--------VADAMMGTRKPTAK 354


>RECA_SYNP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  323 bits (829), Expect = 1e-90
 Identities = 180/329 (54%), Positives = 228/329 (69%), Gaps = 3/329 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L L  +QIE  FGKG+IM+ G+    + +  IP+GAL LD A+G GG PRGRI
Sbjct: 7   NPDKEKALNLVLNQIERNFGKGAIMRLGDAAQ-MKVATIPSGALTLDQAMG-GGFPRGRI 64

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE+YGPESSGKTT+AL  IAE Q  GG+ AFIDAEHALDP Y+A LGVDI+ +L++QPD 
Sbjct: 65  VEIYGPESSGKTTVALHAIAEVQKAGGVAAFIDAEHALDPTYSAALGVDIENLLVAQPDN 124

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GE ALEI D LVRS               PRAEIEGE+GD  VGLQARLMS+ALRK+AG+
Sbjct: 125 GESALEIADQLVRSAAVDLIVIDSVAALVPRAEIEGEMGDVQVGLQARLMSKALRKIAGN 184

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE-IVGX 240
           + +S  T IF+NQLR+KIG+ +GNPE TTGG ALKF+                 E   G 
Sbjct: 185 MGRSGCTVIFLNQLRQKIGISYGNPEVTTGGTALKFYASVRLDIRRIQTLKKGSEGEFGI 244

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AEFD+++G+GISR GC++D+A + GV  + GAWY+Y  + + Q
Sbjct: 245 RXXXXXXXXXXXPPFRIAEFDIIFGKGISRVGCMLDLAEQTGVITRKGAWYSYEGDNIAQ 304

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           GR+ A + L+ENPD+   +  KVRE+ ++
Sbjct: 305 GRDNAVKYLEENPDVAAIVTQKVRENLDM 333


>RECA_LEGPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  323 bits (829), Expect = 1e-90
 Identities = 182/341 (53%), Positives = 228/341 (66%), Gaps = 3/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M E K K L     QIE +FGKGS+M+ G+     +I  I T              P+GR
Sbjct: 1   MEENKQKALSAAVSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAE Q MGG  AFIDAEHALDP YA +LGV +DE+L+SQPD
Sbjct: 61  IVEIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEITDMLVRXXXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI+G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+  EFD++Y EGISRE  I+++ V+  + +KSGAWY+Y +E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESF---EIPIITRSTEE 338
           G+E  +  LKENP +  ELE ++R      ++ ++  S+E+
Sbjct: 301 GKENVRLYLKENPQVAAELEQQIRTELLEKKLSVLASSSED 341


>RECA_IDILO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 372

 Score =  323 bits (829), Expect = 1e-90
 Identities = 176/325 (54%), Positives = 228/325 (70%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+ ++ K L     QIE +FGKGSIM+ G+    L+I  + T              P GR
Sbjct: 1   MSNDRQKALDAALGQIERQFGKGSIMRLGDN-QTLDIDSVSTXXXXXXXXXXXXXXPFGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTT+ L++IAEAQ MG   AF+DAEHALDP+YA  LGV++D++LISQPD
Sbjct: 60  VVEIYGPESSGKTTMTLEVIAEAQKMGKTCAFVDAEHALDPIYAEALGVNVDDLLISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICDMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEICDMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTS 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ KSNT CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKKSNTMCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGALKEGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+GIS+EG ++D+ V+  +  K+GAWY+Y  +++GQ
Sbjct: 240 ETRVKVVKNKVAPPFKEAHFQILYGKGISKEGELIDLGVKHKMVDKAGAWYSYNGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  + + L++NP + +ELE ++RE
Sbjct: 300 GKANSMKFLQDNPKIADELEGRIRE 324


>RECA_HELHP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  323 bits (829), Expect = 1e-90
 Identities = 180/326 (55%), Positives = 229/326 (70%), Gaps = 2/326 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E++ K ++L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 2   VDEKRQKAIELALKQIDKAFGKGALVRLGDKQVE-KIDSISTGSLGLDMALGIGGVPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+LQI+AE Q  GGI AFIDAEHALD  YA RLGVD + +L+SQPD
Sbjct: 61  IIEIYGPESSGKTTLSLQIVAECQRNGGICAFIDAEHALDVYYAKRLGVDTENLLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + L RSG              P+AEIEG++GD  VGLQARLMS ALRK+ G
Sbjct: 121 TGEQALEILETLTRSGAVDLIVIDSVAALTPKAEIEGDMGDQHVGLQARLMSHALRKITG 180

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K N T IFINQ+R KIG M +G+PETTTGG ALKF+                 + +G
Sbjct: 181 VLHKMNATLIFINQIRMKIGTMGYGSPETTTGGNALKFYASVRIDVRRVATLKQNDQQIG 240

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  ++  +  KSGAW +Y +++LG
Sbjct: 241 NRTXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGIKLDIIDKSGAWLSYNDKKLG 300

Query: 300 QGREAAKQTLKENPDLREELETKVRE 325
           QGRE AK  LKEN  L +E+  K++E
Sbjct: 301 QGRENAKIVLKENKSLADEITAKIKE 326


>RECA_CHRVO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  323 bits (829), Expect = 1e-90
 Identities = 180/330 (54%), Positives = 231/330 (70%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           +E+KSK L     QIE +FGKGSIM+  +     N+ VI TG+L LD A           
Sbjct: 3   SEDKSKALAAALAQIEKQFGKGSIMRMSDNQITENLQVISTGSLTLDLAXXXXXXXXXXX 62

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
            E+YGPESSGKTTL LQ +AEAQ +GG  A+IDAE+ALDPVYA +LGV+++++LISQPDT
Sbjct: 63  XEIYGPESSGKTTLCLQAVAEAQKLGGTCAYIDAENALDPVYAQKLGVNVEDLLISQPDT 122

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICDM                   P+AEIEGE+GD+ VGLQARLMSQALRKL G+
Sbjct: 123 GEQALEICDMXXXXXXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTGN 182

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           + ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G  
Sbjct: 183 IKRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGGIKKGDEVIGND 242

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FRQA+F+++YGEGISR+G I+++ V+ G   KSGAWY Y  +++GQG
Sbjct: 243 TRVKVVKNKVSPPFRQADFEILYGEGISRQGEIIELGVKHGFIDKSGAWYAYNGQKIGQG 302

Query: 302 REAAKQTLKENPDLREELETKVRESFEIPI 331
           ++  ++ LK NP + +E+E K+RE+  + I
Sbjct: 303 KDNTREWLKANPAIADEIERKIREAVGVKI 332


>RECA_LEGPH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  323 bits (828), Expect = 1e-90
 Identities = 182/341 (53%), Positives = 228/341 (66%), Gaps = 3/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M E K K L     QIE +FGKGS+M+ G+     +I  I T              P+GR
Sbjct: 1   MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAE Q MGG  AFIDAEHALDP YA +LGV +DE+L+SQPD
Sbjct: 61  IVEIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEITDMLVRXXXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI+G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+  EFD++Y EGISRE  I+++ V+  + +KSGAWY+Y +E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESF---EIPIITRSTEE 338
           G+E  +  LKENP +  ELE ++R      ++ ++  S+E+
Sbjct: 301 GKENVRLYLKENPQVAAELEQQIRTELLEKKLSVLASSSED 341


>RECA_LEGPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  323 bits (828), Expect = 1e-90
 Identities = 182/341 (53%), Positives = 228/341 (66%), Gaps = 3/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M E K K L     QIE +FGKGS+M+ G+     +I  I T              P+GR
Sbjct: 1   MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAE Q MGG  AFIDAEHALDP YA +LGV +DE+L+SQPD
Sbjct: 61  IVEIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEITDMLVRXXXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI+G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+  EFD++Y EGISRE  I+++ V+  + +KSGAWY+Y +E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESF---EIPIITRSTEE 338
           G+E  +  LKENP +  ELE ++R      ++ ++  S+E+
Sbjct: 301 GKENVRLYLKENPQVAAELEQQIRTELLEKKLSVLASSSED 341


>RECA_LEGPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  323 bits (828), Expect = 1e-90
 Identities = 182/341 (53%), Positives = 228/341 (66%), Gaps = 3/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M E K K L     QIE +FGKGS+M+ G+     +I  I T              P+GR
Sbjct: 1   MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAE Q MGG  AFIDAEHALDP YA +LGV +DE+L+SQPD
Sbjct: 61  IVEIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEITDMLVRXXXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI+G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+  EFD++Y EGISRE  I+++ V+  + +KSGAWY+Y +E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESF---EIPIITRSTEE 338
           G+E  +  LKENP +  ELE ++R      ++ ++  S+E+
Sbjct: 301 GKENVRLYLKENPQVAAELEQQIRTELLEKKLSVLASSSED 341


>RECA_CHLTA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  323 bits (828), Expect = 1e-90
 Identities = 197/326 (60%), Positives = 243/326 (74%), Gaps = 1/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ + L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKRALEAAIAYIEKQFGAGSIMSLGKHSSAHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YAA +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPNYAALIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EGEIGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGEIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           ++NT  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RTNTCAIFINQIREKIGVSFGNPETTTGGRALKFYXXXXXXXXXXXXXXXXENFDIGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  +  K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCIIDLAVEKNIIDKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKVRESFE 328
           EA ++ LK N +L  ELE  + ES +
Sbjct: 305 EAVREELKRNKELFHELERCIYESVQ 330


>RECA_CORDI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 372

 Score =  323 bits (827), Expect = 2e-90
 Identities = 183/327 (55%), Positives = 222/327 (67%), Gaps = 1/327 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           + + K L      IE  FGKG++M+ G+      I  I +G   +D ALGIGG PRGRIV
Sbjct: 15  DNRKKALDAALAMIEKDFGKGAVMRLGDENRP-PISAISSGNTAIDVALGIGGFPRGRIV 73

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           EVYGPESSGKTT+AL              FIDAEHALDP YA +LGVD D +L+SQPDTG
Sbjct: 74  EVYGPESSGKTTVALHXXXXXXXXXXXXXFIDAEHALDPDYARKLGVDTDALLVSQPDTG 133

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L
Sbjct: 134 EQALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKMTGAL 193

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + +G   
Sbjct: 194 YNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDVRRIQTLKDGQDAIGNRT 253

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD+MYGEGISRE  I+D+ V+ G+ KKSG+W+TY  ++LGQG+
Sbjct: 254 RLKVVKNKVSPPFKIAEFDIMYGEGISRESSIIDLGVDNGIIKKSGSWFTYEGDQLGQGK 313

Query: 303 EAAKQTLKENPDLREELETKVRESFEI 329
           E  +  LKE P+L +E+E K+  +  I
Sbjct: 314 EKVRLYLKETPELADEIEDKIFRALHI 340


>RECA_DECAR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  322 bits (826), Expect = 2e-90
 Identities = 191/328 (58%), Positives = 236/328 (71%), Gaps = 2/328 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE +FGKGSIMK G+   D  I V+ TG+L LD A            E+YGPESSGKTTL
Sbjct: 16  IEKQFGKGSIMKMGDAEIDEGIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESSGKTTL 75

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
            LQ++AE Q +GG+ AFIDAEHALDP YA +LGV++ ++LISQPDTGEQALEI DMLVRS
Sbjct: 76  CLQVVAEMQKLGGVAAFIDAEHALDPQYAQKLGVNVGDLLISQPDTGEQALEIADMLVRS 135

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
           G              PRAEIEGE+GD  VGL ARLMSQALRKL  ++ K+NT  IFINQ+
Sbjct: 136 GXXXXXXXXXXXXLTPRAEIEGEMGDQMVGLHARLMSQALRKLTANIKKTNTLVIFINQI 195

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           R KIGVMFG+PETTTGG ALKF+                 E++G               F
Sbjct: 196 RMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKKGDEVIGSETXXXXXXXXXAPPF 255

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           R+A FD++YGEGISR+G IV+M V   +  KSGAWY Y  E++GQG++ A++ LK NP++
Sbjct: 256 REAIFDILYGEGISRQGEIVEMGVAHKLVDKSGAWYAYKGEKIGQGKDNAREFLKANPEI 315

Query: 316 REELETKVRESFEIPII--TRSTEEADA 341
            +E+E  +RE+    +I   ++ + ADA
Sbjct: 316 AQEIEAGIREAASTNVIKPVKAAKAADA 343


>RECA_ACIBY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (826), Expect = 2e-90
 Identities = 165/325 (50%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IIEIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 NGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+G ++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +  +EN  + EE+E  +RE
Sbjct: 300 GKNNVIRYFEENTQIAEEIERNIRE 324


>RECA_ACIBT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (826), Expect = 2e-90
 Identities = 165/325 (50%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IIEIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 NGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+G ++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +  +EN  + EE+E  +RE
Sbjct: 300 GKNNVIRYFEENTQIAEEIERNIRE 324


>RECA_ACIBS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (826), Expect = 2e-90
 Identities = 165/325 (50%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IIEIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 NGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+G ++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +  +EN  + EE+E  +RE
Sbjct: 300 GKNNVIRYFEENTQIAEEIERNIRE 324


>RECA_ACIBC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (826), Expect = 2e-90
 Identities = 165/325 (50%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IIEIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 NGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+G ++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +  +EN  + EE+E  +RE
Sbjct: 300 GKNNVIRYFEENTQIAEEIERNIRE 324


>RECA_ACIB5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (826), Expect = 2e-90
 Identities = 165/325 (50%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IIEIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 NGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+G ++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +  +EN  + EE+E  +RE
Sbjct: 300 GKNNVIRYFEENTQIAEEIERNIRE 324


>RECA_ACIB3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (826), Expect = 2e-90
 Identities = 165/325 (50%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E KSK L+    QIE +FGK ++M+ G+      +  + TG+L LD ALGIGG+P+GR
Sbjct: 1   MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQA-VEAVSTGSLTLDIALGIGGLPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTT+ LQ IA+ Q  GG  AFIDAEHALDP YA +LGVDID +L+SQPD
Sbjct: 60  IIEIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRK+ G
Sbjct: 120 NGEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +  +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++A F ++YG+G ++ G +VD+AV+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETKVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+    +  +EN  + EE+E  +RE
Sbjct: 300 GKNNVIRYFEENTQIAEEIERNIRE 324


>RECA_RHOCS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 358

 Score =  322 bits (825), Expect = 3e-90
 Identities = 189/344 (54%), Positives = 223/344 (64%), Gaps = 3/344 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE  FGKGSIMK G          I T              PRGRIVE
Sbjct: 14  DKQKALDAALGQIERAFGKGSIMKLGAREAMAETEAISTXXXXXXXXXXXXXXPRGRIVE 73

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GG  AF+DAEHALDP YA +LGVD+DE+LISQPD GE
Sbjct: 74  IYGPESSGKTTLALHAIAEAQKAGGTCAFVDAEHALDPAYARKLGVDVDELLISQPDAGE 133

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD+ VGL ARLMSQALRKL GS+S
Sbjct: 134 QALEIADTLVRSGAIXXXXXXXXXXXXPRAELEGEMGDSHVGLHARLMSQALRKLTGSIS 193

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS    IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG    
Sbjct: 194 KSRCLVIFINQIRLKIGVMFGNPETTTGGNALKFYASIRLDIRRIGAIKDRDNVVGNQTR 253

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR  EFD+MYGEG+S+ G ++D+ ++AGV +KSGAW++Y  +R+GQGRE
Sbjct: 254 VKVVKNKMAPPFRVVEFDIMYGEGVSKVGELLDLGIQAGVVEKSGAWFSYDGQRIGQGRE 313

Query: 304 AAKQTLKENPDLREELETKVRESFEI---PIITRSTEEADAMSP 344
            AK  L+ N  + E +E KVR +  +    ++     + DA SP
Sbjct: 314 NAKTFLRNNAAVAEAIEAKVRANAGLVASAMMGAPESDGDAASP 357


>RECA_LEGPL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  322 bits (825), Expect = 3e-90
 Identities = 180/324 (55%), Positives = 220/324 (67%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M E K K L     QIE +FGKGS+M+ G+     +I  I T              P+GR
Sbjct: 1   MEENKQKALSAALSQIERQFGKGSVMRMGDSTVSRDIEAISTXXXXXXXXXXXXXXPKGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAE Q MGG  AFIDAEHALDP YA +LGV +DE+L+SQPD
Sbjct: 61  IVEIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVR                P+AEIEGE+GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEITDMLVRXXXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EI+G 
Sbjct: 181 NIKRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+  EFD++Y EGISRE  I+++ V+  + +KSGAWY+Y +E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G+E  +  LKENP +  ELE ++R
Sbjct: 301 GKENVRLYLKENPQVAAELEQQIR 324


>RECA_CORPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 369

 Score =  322 bits (825), Expect = 3e-90
 Identities = 181/327 (55%), Positives = 223/327 (68%), Gaps = 1/327 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           + + K L      IE  FGKG++M+ G+      I  I +G   +D ALGIGG P+GRIV
Sbjct: 15  DNRQKALDAALAMIEKDFGKGAVMRLGDDNRP-PISAISSGNTAIDVALGIGGFPKGRIV 73

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           EVYGPESSGKTT+AL              FIDAEHALDP YA +LGVD D +L+SQPDTG
Sbjct: 74  EVYGPESSGKTTVALHXXXXXXXXXXXXXFIDAEHALDPDYARKLGVDTDALLVSQPDTG 133

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRK+ G+L
Sbjct: 134 EQALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHVGLQARLMSQALRKMTGAL 193

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + +G   
Sbjct: 194 YNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRCDVRRIQTLKDGQDAIGNRT 253

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD+MYGEGISRE  I+D+ V+ G+ KKSG+W+TY  ++LGQG+
Sbjct: 254 RLKVVKNKVSPPFKIAEFDIMYGEGISRESSIIDLGVDNGIIKKSGSWFTYDGDQLGQGK 313

Query: 303 EAAKQTLKENPDLREELETKVRESFEI 329
           E  +  LK+ P+L +E+E K+  + +I
Sbjct: 314 EKVRLYLKQTPELADEIEEKIFRALQI 340


>RECA_RICPU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  322 bits (824), Expect = 4e-90
 Identities = 172/312 (55%), Positives = 220/312 (70%), Gaps = 1/312 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  H ++I  + TG+L LD ALGIGGVP+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTGSLGLDIALGIGGVPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+I E++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIAELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RS               P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSSGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYKNVRIGQG 301

Query: 302 REAAKQTLKENP 313
           RE  KQ LKE+P
Sbjct: 302 RENVKQYLKEHP 313


>RECA_RHOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  322 bits (824), Expect = 4e-90
 Identities = 177/323 (54%), Positives = 223/323 (69%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K+K L     QIE  FGKGSIM+ G+ G  L +  I T              PRGR+VE
Sbjct: 2   DKTKALDAALTQIERAFGKGSIMRLGKSGAALEVETISTXXXXXXXXXXXXXXPRGRVVE 61

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLAL  +AEAQ  GG+ AFIDAEHALDP+YA +LGV++D++LISQPD GE
Sbjct: 62  IFGPESSGKTTLALHTVAEAQKKGGVCAFIDAEHALDPLYARKLGVNLDDLLISQPDAGE 121

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EGE+GD+  G+QARLMSQALRKL  S+S
Sbjct: 122 QALEIADTLVRSGAIXXXXXXXXXXXXPRAELEGEMGDSQPGMQARLMSQALRKLTASIS 181

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG    
Sbjct: 182 RSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQTR 241

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEGIS+ G ++D+ V+AGV  KSG+W+++  +R+GQGRE
Sbjct: 242 VKVVKNKLAPPFKQVEFDIMYGEGISKAGELIDLGVKAGVVDKSGSWFSHDSQRIGQGRE 301

Query: 304 AAKQTLKENPDLREELETKVRES 326
             K  LK +PD+   +E  +R++
Sbjct: 302 NVKGFLKGHPDVAGRIEAAIRQN 324


>RECA_NOCFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  322 bits (824), Expect = 4e-90
 Identities = 188/314 (59%), Positives = 227/314 (72%), Gaps = 1/314 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   Q+E  FGKG++M+ GE      I VIPTG++ LD ALGIGG+PRGRIVE
Sbjct: 7   DRDKALELALAQVEKSFGKGAVMRLGEEARQ-PISVIPTGSIALDVALGIGGLPRGRIVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYARKLGVDTDALLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 126 QALEIADMLVRSGXXXXXXXXXXXXLVPRAEIEGEMGDSHVGLQARLMSQALRKMTSALN 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGSDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+WYTY  ++LGQG+E
Sbjct: 246 XXXXXXXXSPPFKQAEFDILYGQGISKEGSLIDMGVEQGFIRKSGSWYTYEGDQLGQGKE 305

Query: 304 AAKQTLKENPDLRE 317
            A++ L EN D+R+
Sbjct: 306 NARKFLLENTDVRD 319


>RECA_MYCS2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  322 bits (824), Expect = 4e-90
 Identities = 182/341 (53%), Positives = 223/341 (65%), Gaps = 3/341 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QI+  FGKGS+M+ GE      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 7   DREKALELAMAQIDKNFGKGSVMRLGEEVRQ-PISVIPTGSISLDVALGIGGLPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 126 QALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALN 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 246 XXXXXXXXSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKE 305

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSP 344
            A++ L EN D+             I  +   T EAD + P
Sbjct: 306 NARKFLLENTDVANXXXXXXXXXLGIGAVV--TAEADDVLP 344


>RECA_MYCGI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  322 bits (824), Expect = 4e-90
 Identities = 175/312 (56%), Positives = 215/312 (68%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QI+  FGKGS+M+ GE      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 7   DREKALELALAQIDKNFGKGSVMRLGEDVRP-PIAVIPTGSIALDVALGIGGLPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDALLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 126 QALEIADMLIRSGALDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALN 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 246 XXXXXXXXSPPFKQAEFDILYGKGISREGSLIDMGVEQGFIRKSGSWFTYDGEQLGQGKE 305

Query: 304 AAKQTLKENPDL 315
            A+  L +NPD+
Sbjct: 306 NARNFLLQNPDV 317


>RECA_POLNA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 384

 Score =  320 bits (821), Expect = 9e-90
 Identities = 169/332 (50%), Positives = 216/332 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +N EK++ L +   QIE +FGKG+IMK G G    +I V+ TG+L LD A          
Sbjct: 11  LNTEKARALAVALAQIEKQFGKGTIMKLGAGEVIEDIQVVSTGSLGLDIAXXXXXXXXXX 70

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AF+DAEHALD  YA +LGV++ E+LISQPD
Sbjct: 71  XXEIYGPESSGKTTLTLQVIAEMQKIGGTCAFVDAEHALDIQYAQKLGVNLQELLISQPD 130

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D L RSG              P+AE+EGE+GD+  GLQARLMSQALRKL  
Sbjct: 131 TGEQALEIVDSLTRSGAVDLIVIDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTA 190

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ K+N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G 
Sbjct: 191 TIKKANCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDEVIGN 250

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD++YGEGISR G ++D+ V   V +K+GAWY Y  E++GQ
Sbjct: 251 ETRVKVVKNKVASPFKMAEFDILYGEGISRLGEVLDLGVANHVVEKAGAWYAYRGEKIGQ 310

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPII 332
           GR+ +++ LKENP L  E+E KVRE+  IP++
Sbjct: 311 GRDNSREFLKENPALAIEIENKVREALGIPLV 342


>RECA_BAUCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  320 bits (821), Expect = 9e-90
 Identities = 180/325 (55%), Positives = 223/325 (68%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K L      IE +FG GSIM+ GE    +++  I TG+L LD ALG GG+P GR
Sbjct: 3   IDENKQKALAAALSLIEKQFGTGSIMRLGED-RSMDVETISTGSLSLDIALGAGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IA AQ  G I AFIDAEHALDP+YA  LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLQVIATAQKEGKICAFIDAEHALDPIYAKNLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD+L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKL  
Sbjct: 122 TGEQALEICDVLTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHIGLAARMMSQAMRKLTS 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                  +VG 
Sbjct: 182 NLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSVKEGDVVVGS 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QA+F + YG+GI+  G +VD+ V+  + +K+G+WY+Y   ++GQ
Sbjct: 242 ETRVKVVKNKVAAPFKQADFQITYGKGINIHGELVDLGVKNNLIEKAGSWYSYNGNKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+      LK +P L  EL+ K+RE
Sbjct: 302 GKNNVCNFLKYHPQLAAELDKKLRE 326


>RECA_AQUAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  320 bits (821), Expect = 9e-90
 Identities = 190/323 (58%), Positives = 242/323 (74%), Gaps = 1/323 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L++    IE +FGKG++M   +    + +  IPTG+L LD A G+GG+P+GRI E
Sbjct: 7   EKKKALEVALSNIEKRFGKGAVMPL-KSVEKVQVETIPTGSLALDIATGVGGIPKGRITE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++G ESSGKTTLAL +IAEAQ  GG+  FIDAEHALDP YA +LGVD++ + ISQPD GE
Sbjct: 66  IFGVESSGKTTLALHVIAEAQKRGGVAVFIDAEHALDPKYAKKLGVDVENLYISQPDYGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + L+ SG              P+ E+EGE+G+  VG QARLMSQALRKL G++ 
Sbjct: 126 QALEIAESLINSGXXXXXXXXXXXXXXPKDELEGEMGEAQVGKQARLMSQALRKLKGAVH 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KSNT  IFINQ+REKIGVMFGNPETT GGRALKFF                         
Sbjct: 186 KSNTALIFINQIREKIGVMFGNPETTPGGRALKFFSDMRLEVRRLGDXXXXXXXXXXXXX 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F++AEFD++YGEGI +   ++++A   G+  KSG+WY+YG++RLGQG+E
Sbjct: 246 XXXXXNKLAPPFQEAEFDIIYGEGICKLCDLIEVATNLGIFTKSGSWYSYGDKRLGQGKE 305

Query: 304 AAKQTLKENPDLREELETKVRES 326
             K+ L+E+P+L +E++ KVRE+
Sbjct: 306 QVKKYLQEHPELIDEIDQKVREA 328


>RECA_DEIGD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 358

 Score =  320 bits (820), Expect = 1e-89
 Identities = 190/323 (58%), Positives = 237/323 (73%), Gaps = 2/323 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           ++E+ K ++    QIE  FGKGSIM+ G     L++  + TG+L LD ALG+GG+PRGRI
Sbjct: 15  SKERLKAIETAMTQIEKAFGKGSIMRLGAESK-LDVQAVSTGSLSLDLALGVGGIPRGRI 73

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
            E+YGPES GKTTLAL +IA+AQ  GG  AFIDAEHALDPVYA  LGV+ DE+L+SQPD 
Sbjct: 74  TEIYGPESGGKTTLALSVIAQAQRAGGTCAFIDAEHALDPVYARSLGVNTDELLVSQPDN 133

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI ++LVRSG              PRAEIEGE+GD+  GLQARLMSQALRKL   
Sbjct: 134 GEQALEIMELLVRSGAIXXXXXXXXXXLTPRAEIEGEMGDSLPGLQARLMSQALRKLTAI 193

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVGX 240
           LSK+ T  IFINQ+REKIGVM+GNPETTTGGRALKF+                G + VG 
Sbjct: 194 LSKTGTAAIFINQVREKIGVMYGNPETTTGGRALKFYASVRLDVRKIGQPVKLGNDAVGX 253

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F++ E  L+YG+G  +   +V +A +  + KK+G++Y+YGEER+GQ
Sbjct: 254 XXXXXXXXXXXAPPFKEVELTLLYGKGFDQLSDLVTLAADMDIIKKAGSFYSYGEERIGQ 313

Query: 301 GREAAKQTLKENPDLREELETKV 323
           G+E A   + E P+L +E+  +V
Sbjct: 314 GKEKAIAYIAERPELEQEIRDRV 336


>RECA_RALME RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  319 bits (818), Expect = 2e-89
 Identities = 177/324 (54%), Positives = 225/324 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QIE +FGKGSIM+ G+G  + +I V+ TG+L LD A          
Sbjct: 10  VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEIEQDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ++AE Q +GG  AFIDAEHALD  YA +LGVD+  +LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVQYAGKLGVDVGNLLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 130 TGEQALEITDALVRSGSIDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFG+PETTTGG ALKF+                      
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDXXXXX 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YG+GISR+G I+D+ V+A + +K+GAWY+Y  E++GQ
Sbjct: 250 XXXXXXXXXXXSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKAGAWYSYNGEKIGQ 309

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++ A++ L+ENPD+ +E+E KVR
Sbjct: 310 GKDNAREYLRENPDIADEIENKVR 333


>RECA_FRAAA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  319 bits (818), Expect = 2e-89
 Identities = 181/342 (52%), Positives = 222/342 (64%), Gaps = 5/342 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QI+  FGKGS+M+ G+      I  IPTG++ LD ALGIGG+P+GR++E
Sbjct: 6   DRDKALDNALAQIDKAFGKGSVMRLGDDTRP-PIQAIPTGSIALDVALGIGGLPKGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVDID +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAGKLGVDIDNLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 125 QALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTAALA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 E VG    
Sbjct: 185 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTEAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD++YG GISREG ++DM VE G+ +KSGAWYTY  ++LGQG+E
Sbjct: 245 XXXXXXXXAPPFRTAEFDIVYGGGISREGSLIDMGVEHGIIRKSGAWYTYDGDQLGQGKE 304

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPV 345
            A+  L++NPDL             I      + E+DA++PV
Sbjct: 305 NARSFLRDNPDLANXXXXXXXXXLGI----LPSVESDAVAPV 342


>RECA_DESVV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  319 bits (818), Expect = 2e-89
 Identities = 170/324 (52%), Positives = 212/324 (65%), Gaps = 2/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E + + L+     IE K+G G++MK  +  H + I VIPTG++ LD ALG+GGVPRGR+ 
Sbjct: 11  EMRREALETALSTIERKYGLGAVMKLSDEAH-VAIPVIPTGSIGLDLALGVGGVPRGRVT 69

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTL L IIAEAQ  GG  AFIDAEHALD  YA RLGV+ +E+LISQPD G
Sbjct: 70  EIYGPESSGKTTLTLHIIAEAQKRGGTAAFIDAEHALDVAYARRLGVNTEELLISQPDFG 129

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQAL+I DMLVRS               P+AE+EG +GDT VG QARLMS ALRKL G++
Sbjct: 130 EQALDIADMLVRSAAVDLVVIDSVAALIPQAELEGSMGDTQVGGQARLMSHALRKLTGTI 189

Query: 183 SKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
            KS T  IFINQ+R KIG M +G+PETTTGG ALKF+                 E+ G  
Sbjct: 190 HKSRTAVIFINQIRMKIGTMGYGSPETTTGGNALKFYSSVRMDIRKIQTLKDKEEVYGSR 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A FD++YG GISR G I+D+  +AG+  KSG+W+ +G ERLGQG
Sbjct: 250 TRVKIVKNKVAPPFREALFDILYGTGISRTGEIIDLGSDAGIIDKSGSWFAFGSERLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           +E  +  L+EN  LRE +E K+ E
Sbjct: 310 KENVRALLEENAPLREAIEAKLIE 333


>RECA_DESVH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  319 bits (818), Expect = 2e-89
 Identities = 170/324 (52%), Positives = 212/324 (65%), Gaps = 2/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E + + L+     IE K+G G++MK  +  H + I VIPTG++ LD ALG+GGVPRGR+ 
Sbjct: 11  EMRREALETALSTIERKYGLGAVMKLSDEAH-VAIPVIPTGSIGLDLALGVGGVPRGRVT 69

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTL L IIAEAQ  GG  AFIDAEHALD  YA RLGV+ +E+LISQPD G
Sbjct: 70  EIYGPESSGKTTLTLHIIAEAQKRGGTAAFIDAEHALDVAYARRLGVNTEELLISQPDFG 129

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQAL+I DMLVRS               P+AE+EG +GDT VG QARLMS ALRKL G++
Sbjct: 130 EQALDIADMLVRSAAVDLVVIDSVAALIPQAELEGSMGDTQVGGQARLMSHALRKLTGTI 189

Query: 183 SKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
            KS T  IFINQ+R KIG M +G+PETTTGG ALKF+                 E+ G  
Sbjct: 190 HKSRTAVIFINQIRMKIGTMGYGSPETTTGGNALKFYSSVRMDIRKIQTLKDKEEVYGSR 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A FD++YG GISR G I+D+  +AG+  KSG+W+ +G ERLGQG
Sbjct: 250 TRVKIVKNKVAPPFREALFDILYGTGISRTGEIIDLGSDAGIIDKSGSWFAFGSERLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           +E  +  L+EN  LRE +E K+ E
Sbjct: 310 KENVRALLEENAPLREAIEAKLIE 333


>RECA_CYAP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  319 bits (818), Expect = 2e-89
 Identities = 191/340 (56%), Positives = 243/340 (71%), Gaps = 3/340 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L L  +QIE  FGKGSIM+ G+    + +  I +G+L LD ALG GG+P+GRI
Sbjct: 7   NPDKEKALGLVLNQIERNFGKGSIMRLGDAAR-MRVETISSGSLTLDLALG-GGLPQGRI 64

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLAL  IAE Q  GG+ AF+DAEHALDP Y+  LGVDID +L++QPDT
Sbjct: 65  IEIYGPESSGKTTLALHAIAEVQKAGGVAAFVDAEHALDPNYSNALGVDIDNLLVAQPDT 124

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GE ALEI D LVR                PRAEIEGE+GDT VGLQARLMS+ALRK+AG+
Sbjct: 125 GESALEIVDQLVRXXXXXXXXXXXXXXLVPRAEIEGEMGDTQVGLQARLMSKALRKIAGN 184

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE-IVGX 240
           + KS    IF+NQLR+KIGV +G+PE TTGG ALKF+                 E   G 
Sbjct: 185 IGKSGCVVIFLNQLRQKIGVTYGSPEVTTGGNALKFYASVRLDIRRIQTLKKGSEGEYGI 244

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AEFD+++G+GISR GC++D+A +  V  + GAWY+Y  E + Q
Sbjct: 245 RXXXXXXXXXXXPPFRIAEFDIIFGKGISRMGCMLDLAEQTDVVNRKGAWYSYNGENISQ 304

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           GR+ A + L++NP++ + +E +VRE  E+  +  +  + D
Sbjct: 305 GRDNAVKYLEDNPEVADTIERQVREKLELGSLNFAISQTD 344


>RECA_CHLCV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  319 bits (817), Expect = 3e-89
 Identities = 178/321 (55%), Positives = 226/321 (70%), Gaps = 1/321 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKKALEAAIAYIEKQFGAGSIMSLGKHSATHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YA+ +G +I++++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPGYASLIGANINDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EG+IGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGDIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           +S T  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RSQTCAIFINQIREKIGVSFGNPETTTGGRALKFYSSIRMDIRRIGAIKGNESFDLGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  + +K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFRTAEFDILFNEGISSAGCILDLAVEHNIVEKKGSWFNYQDRKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKV 323
           EA ++ LK+N  L +ELE ++
Sbjct: 305 EAVREELKKNKKLFDELEKRI 325


>RECA_CHRSD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  318 bits (816), Expect = 3e-89
 Identities = 170/323 (52%), Positives = 223/323 (69%), Gaps = 1/323 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           ++ +SK L     QIE +FGKG++M+ G+    +    I TG+L LD ALG+GG+P GR+
Sbjct: 4   DDNRSKALNAALSQIERQFGKGAVMRLGDTPR-VATPAISTGSLGLDIALGVGGLPMGRV 62

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE++GPESSGKTT+ L +IA+ Q  G   AFIDAEHALDP YA +LGV++D++L+SQPDT
Sbjct: 63  VEIFGPESSGKTTMTLSVIAQGQKQGKTCAFIDAEHALDPTYAEKLGVNLDDLLVSQPDT 122

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICDML                  PRAEIEGE+GD+ VGLQARLMSQALRK+ G+
Sbjct: 123 GEQALEICDMLXXXXXXXXXXXXXXAALTPRAEIEGEMGDSHVGLQARLMSQALRKVTGN 182

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +  +N   +F+NQ+R KIGVMFGNPETTTGG ALKF+                 E +G  
Sbjct: 183 IKNANCMVMFVNQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKQGDEAIGNE 242

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FRQAEF ++YG+GI   G +VD+ V+ G+  K+GAWY+Y   ++GQG
Sbjct: 243 TRVKVVKNKVAPPFRQAEFQILYGKGIYHAGEVVDIGVQQGLVDKAGAWYSYQGNKIGQG 302

Query: 302 REAAKQTLKENPDLREELETKVR 324
           +  A Q L++NP + EE+E ++R
Sbjct: 303 KANAAQFLEDNPAIMEEIENEIR 325


>RECA_STRGC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 383

 Score =  318 bits (815), Expect = 5e-89
 Identities = 165/329 (50%), Positives = 220/329 (66%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG+IM+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERQKALDNALKNIEKDFGKGAIMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPSYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+ SG              PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIDSGAVDLVVIDSVAALVPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI----V 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     V
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDAKDTNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIMYGEGISKTGELIKIATDLNIIKKAGAWYSYNDEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P++ +E++ +VR  F
Sbjct: 316 GQGSENAKKYLADHPEVFDEIDRQVRVRF 344


>RECA_MYCVP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  318 bits (815), Expect = 5e-89
 Identities = 175/312 (56%), Positives = 214/312 (68%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QI+  FGKGS+M+ GE      I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 7   DREKALELALAQIDKNFGKGSVMRLGEEVRQ-PIAVIPTGSIALDVALGIGGLPRGRVVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAQKLGVDTDALLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 126 QALEIADMLIRSGALDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALN 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GISREG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 246 XXXXXXXXSPPFKQAEFDILYGKGISREGSLIDMGVEHGFIRKSGSWFTYDGEQLGQGKE 305

Query: 304 AAKQTLKENPDL 315
            A+  L +N D+
Sbjct: 306 NARNFLLQNVDV 317


>RECA_CAMLR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  318 bits (815), Expect = 5e-89
 Identities = 182/341 (53%), Positives = 228/341 (66%), Gaps = 2/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  IPTG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-KIDSIPTGSVGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGVD + + ISQPD
Sbjct: 60  IIEIYGPESSGKTTLTLHIIAECQKKGGVCAFIDAEHALDVKYAKNLGVDTENLYISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALEIVETIARSGAIDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KIG+M +G PETTTGG ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRMKIGMMGYGTPETTTGGNALKFYSSVRLDVRKTATLKQNDEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+QAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y   +LG
Sbjct: 240 NRXXXXXXXXXXXPPFKQAEFDVMFGEGVSREGELIDYGVKLDIIDKSGAWFSYKASKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           QGRE AK  LKENP + +E+   ++ S  I  +    +E D
Sbjct: 300 QGRENAKAFLKENPAIADEITQAIQNSIGIDSMILGAKEDD 340


>RECA_ANAMF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  318 bits (815), Expect = 5e-89
 Identities = 181/324 (55%), Positives = 226/324 (69%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +  EK K L     QIE  FG+G+IMK  +   +  +  + TG++ LDAALGIGG+P+GR
Sbjct: 10  VESEKQKALDAAISQIERAFGRGAIMKLKQHPAE-KMDSVSTGSIALDAALGIGGLPKGR 68

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTLAL +IAEAQ  GG  AFIDAEHALD VYA +LGV++ ++++SQPD
Sbjct: 69  IVEIFGPESSGKTTLALHVIAEAQKQGGNCAFIDAEHALDTVYARKLGVNVGDLIVSQPD 128

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQAL I + LV SG              PRAEIEG++GD  +GLQARL+S ALRKL  
Sbjct: 129 TGEQALHIVEYLVCSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHALRKLTS 188

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SK+N   +FINQ+R KIGV++GNPE TTGG ALKF+                  ++G 
Sbjct: 189 VVSKANCILVFINQIRIKIGVIYGNPEVTTGGSALKFYTSIRLDIRKVSAIKDKDNVIGN 248

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD++Y EGIS+ G IVDM V+ G  +KSGA Y+YG  +LGQ
Sbjct: 249 QTRVKVVKNKVAPPFKQAEFDIVYNEGISKLGEIVDMGVKFGFVEKSGAHYSYGAVKLGQ 308

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GRE AK  LK NPD+  ELE K+R
Sbjct: 309 GRENAKGYLKSNPDIANELEQKIR 332


>RECA_RALEU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  318 bits (814), Expect = 6e-89
 Identities = 176/324 (54%), Positives = 224/324 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L     QIE +FGKGSIM+ G+G  + +I V+ TG+L LD A          
Sbjct: 10  VSAEKQKALAAALSQIEKQFGKGSIMRLGDGEIEQDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ++AE Q +GG  AFIDAEHALD  YA +LGVD+  +LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVQYAGKLGVDVGNLLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQ LRKL G
Sbjct: 130 TGEQALEITDALVRSGSIDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQGLRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFG+PETTTGG ALKF+                      
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDXXXXX 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YG+GISR+G I+D+ V+A + +K+GAWY+Y  E++GQ
Sbjct: 250 XXXXXXXXXXXSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKAGAWYSYNGEKIGQ 309

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++ A++ L+ENPD+ +E+E KVR
Sbjct: 310 GKDNAREYLRENPDIADEIENKVR 333


>RECA_NITEU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  318 bits (814), Expect = 6e-89
 Identities = 176/324 (54%), Positives = 224/324 (69%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K+K L     QIE ++GKGSIM+ G+     +I V+ TG+L LD ALG+GG+PRGR
Sbjct: 1   MDENKNKALSAALAQIEKQYGKGSIMRLGDSDVAKDIQVVSTGSLGLDIALGVGGLPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALDP YA ++GV++ E+LISQPD
Sbjct: 61  IIEIYGPESSGKTTLTLQAIAEMQKLGGTAAFIDAEHALDPQYAQKIGVNVQELLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DMLVRSG              PRAEIEGE+G+  +GLQARLMSQALRKL  
Sbjct: 121 NGEQALEITDMLVRSGXXXXXXXXXXXXLTPRAEIEGEMGEPQMGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NT  IFINQ+R KIGV+FGNPETTTGG ALKF+                 E+VG 
Sbjct: 181 NIKRTNTMVIFINQIRMKIGVIFGNPETTTGGNALKFYASVRLDIRRTGSIKRGEEMVGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QA+FD++Y            + V   + +K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKIVKNKVAPPFKQADFDILYXXXXXXXXXXXXLGVLHKLIEKAGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++  +  LKE+  +  E+E K+R
Sbjct: 301 GKDNVRDYLKEHKSIAHEIEQKIR 324


>RECA_CHLPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  318 bits (814), Expect = 6e-89
 Identities = 177/321 (55%), Positives = 224/321 (69%), Gaps = 1/321 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+     IE +FG GSIM  G       I  I TGAL LD ALGI GVP+GR++E
Sbjct: 5   DRKKALEAAVAYIEKQFGAGSIMSLGRHSATHEISTIKTGALSLDLALGIHGVPKGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YA+ +GV+ID+++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPSYASLIGVNIDDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EG+IGD  VGLQAR+MSQALRKL  +LS
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGDIGDVHVGLQARMMSQALRKLTATLS 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFF-XXXXXXXXXXXXXXXXGEIVGXXX 242
           +S T  +FINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RSQTCAVFINQIREKIGVSFGNPETTTGGRALKFYSSIRLDIRRIGSIKGSDNSDIGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++ EGIS  GCI+D+AVE  + +K G+W+ Y E++LGQGR
Sbjct: 245 KVKVAKNKLAPPFRIAEFDILFNEGISSAGCILDLAVEYNIIEKKGSWFNYQEKKLGQGR 304

Query: 303 EAAKQTLKENPDLREELETKV 323
           E  ++ LK N  L EE+E ++
Sbjct: 305 EFVREELKRNRKLFEEIEKRI 325


>RECA_ANAMM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  318 bits (814), Expect = 6e-89
 Identities = 181/324 (55%), Positives = 226/324 (69%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +  EK K L     QIE  FG+G+IMK  +   +  +  + TG++ LDAALGIGG+P+GR
Sbjct: 10  VESEKQKALDAAISQIERAFGRGAIMKLKQHPAE-KMDSVSTGSIALDAALGIGGLPKGR 68

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTLAL +IAEAQ  GG  AFIDAEHALD VYA +LGV++ ++++SQPD
Sbjct: 69  IVEIFGPESSGKTTLALHVIAEAQKQGGNCAFIDAEHALDTVYARKLGVNVGDLIVSQPD 128

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQAL I + LV SG              PRAEIEG++GD  +GLQARL+S ALRKL  
Sbjct: 129 TGEQALHIVEYLVCSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHALRKLTS 188

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SK+N   +FINQ+R KIGV++GNPE TTGG ALKF+                  ++G 
Sbjct: 189 VVSKANCILVFINQIRIKIGVIYGNPEVTTGGSALKFYTSIRLDIRKVSAIKDKDNVIGN 248

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD++Y EGIS+ G IVDM V+ G  +KSGA Y+YG  +LGQ
Sbjct: 249 QTRVKVVKNKVAPPFKQAEFDIVYNEGISKLGEIVDMGVKFGFVEKSGAHYSYGAVKLGQ 308

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GRE AK  LK NPD+  ELE K+R
Sbjct: 309 GRENAKGYLKSNPDVANELEQKIR 332


>RECA_NEIMF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  317 bits (813), Expect = 8e-89
 Identities = 163/332 (49%), Positives = 212/332 (63%), Gaps = 2/332 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKG+IMK      + N+ VI T              PRGRIVE++GPESSGKTT
Sbjct: 15  QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ +A+ Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVR
Sbjct: 75  LCLEAVAQCQKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ
Sbjct: 135 SGGIDMVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E++G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y   ++GQG++  +  LKENP+
Sbjct: 255 FRQAEFDILYGEGISWEGELIDIGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPE 314

Query: 315 LREELETKVR--ESFEIPIITRSTEEADAMSP 344
           + +E++ K+R     E+ I   + +E D   P
Sbjct: 315 IADEIDAKIRALNGIEMHITEGTQDETDGERP 346


>RECA_NEIGO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  317 bits (812), Expect = 1e-88
 Identities = 163/332 (49%), Positives = 212/332 (63%), Gaps = 2/332 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKG+IMK      + N+ VI T              PRGRIVE++GPESSGKTT
Sbjct: 15  QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ +A+ Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVR
Sbjct: 75  LCLEAVAQCQKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ
Sbjct: 135 SGGIDMVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E++G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y   ++GQG++  +  LKENP+
Sbjct: 255 FRQAEFDILYGEGISWEGELIDIGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPE 314

Query: 315 LREELETKVR--ESFEIPIITRSTEEADAMSP 344
           + +E++ K+R     E+ I   + +E D   P
Sbjct: 315 ISDEIDAKIRALNGVEMHITEGTQDETDGERP 346


>RECA_NEIG2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  317 bits (812), Expect = 1e-88
 Identities = 163/332 (49%), Positives = 212/332 (63%), Gaps = 2/332 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKG+IMK      + N+ VI T              PRGRIVE++GPESSGKTT
Sbjct: 15  QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ +A+ Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVR
Sbjct: 75  LCLEAVAQCQKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ
Sbjct: 135 SGGIDMVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E++G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y   ++GQG++  +  LKENP+
Sbjct: 255 FRQAEFDILYGEGISWEGELIDIGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPE 314

Query: 315 LREELETKVR--ESFEIPIITRSTEEADAMSP 344
           + +E++ K+R     E+ I   + +E D   P
Sbjct: 315 ISDEIDAKIRALNGVEMHITEGTQDETDGERP 346


>RECA_NEIG1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  317 bits (812), Expect = 1e-88
 Identities = 163/332 (49%), Positives = 212/332 (63%), Gaps = 2/332 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKG+IMK      + N+ VI T              PRGRIVE++GPESSGKTT
Sbjct: 15  QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ +A+ Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVR
Sbjct: 75  LCLEAVAQCQKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ
Sbjct: 135 SGGIDMVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E++G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y   ++GQG++  +  LKENP+
Sbjct: 255 FRQAEFDILYGEGISWEGELIDIGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPE 314

Query: 315 LREELETKVR--ESFEIPIITRSTEEADAMSP 344
           + +E++ K+R     E+ I   + +E D   P
Sbjct: 315 ISDEIDAKIRALNGVEMHITEGTQDETDGERP 346


>RECA_WOLWR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  317 bits (811), Expect = 1e-88
 Identities = 179/324 (55%), Positives = 225/324 (69%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L     QIE  FGKG+IMK  +   +  I  I TG++ LD+ALG+GG+P+GRI
Sbjct: 9   NSDKQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRI 67

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTLAL +IAEAQ  GG  AFIDAEHALD +YA +LGV  D+++ISQPDT
Sbjct: 68  IEIFGPESSGKTTLALHVIAEAQKKGGSCAFIDAEHALDVLYARKLGVSTDDLVISQPDT 127

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQAL I + LV SG              PRAEIEG++GD  +GLQARL+S  LRKL  +
Sbjct: 128 GEQALHIVEYLVCSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHGLRKLTSA 187

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I G  
Sbjct: 188 VSKANCILIFINQIRMKIGVVYGNPETTTGGNALKFYTSVRLDIRKIGVIKDKENITGNE 247

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A+FD+MY EGIS+ G I+DM  + GV +K+GA+Y+Y   RLGQG
Sbjct: 248 TRVKVVKNKVAPPFREAKFDIMYNEGISKLGEIIDMGAKLGVLEKAGAYYSYNNTRLGQG 307

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  K  LK N ++  E+ETK+R+
Sbjct: 308 RENVKTYLKTNKEVANEIETKIRD 331


>RECA_WOLPM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  317 bits (811), Expect = 1e-88
 Identities = 179/324 (55%), Positives = 225/324 (69%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L     QIE  FGKG+IMK  +   +  I  I TG++ LD+ALG+GG+P+GRI
Sbjct: 9   NSDKQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRI 67

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTLAL +IAEAQ  GG  AFIDAEHALD +YA +LGV  D+++ISQPDT
Sbjct: 68  IEIFGPESSGKTTLALHVIAEAQKKGGSCAFIDAEHALDVLYARKLGVSTDDLVISQPDT 127

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQAL I + LV SG              PRAEIEG++GD  +GLQARL+S  LRKL  +
Sbjct: 128 GEQALHIVEYLVCSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHGLRKLTSA 187

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I G  
Sbjct: 188 VSKANCILIFINQIRMKIGVVYGNPETTTGGNALKFYTSVRLDIRKVGVIKDKENITGNE 247

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A+FD+MY EGIS+ G I+DM  + GV +K+GA+Y+Y   RLGQG
Sbjct: 248 TRVKVVKNKVAPPFREAKFDIMYNEGISKLGEIIDMGAKLGVLEKAGAYYSYNNTRLGQG 307

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  K  LK N ++  E+ETK+R+
Sbjct: 308 RENVKTYLKTNKEVANEIETKIRD 331


>RECA_PASMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  317 bits (811), Expect = 1e-88
 Identities = 176/322 (54%), Positives = 222/322 (68%), Gaps = 1/322 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK+K       QIE +FGKGSIMK G+    L++  + TG+L LD ALGIGG+P GRIV
Sbjct: 5   EEKNKXXXXXXGQIEKQFGKGSIMKLGDT-QALDVEAVSTGSLSLDVALGIGGLPMGRIV 63

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L +IA+AQ  G   AFIDAEHALDP+YAA+LGV+++E+L+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKEGKTCAFIDAEHALDPIYAAKLGVNVNELLVSQPDNG 123

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKL G +
Sbjct: 124 EQALEICDALVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARLMSQALRKLTGQI 183

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
             SN   +FINQ+R KIGVMFGNPETTTGG ALKF+                 E++G   
Sbjct: 184 KNSNCLVVFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGEEVIGNET 243

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FRQ +F ++YG+GIS+ G ++++ V+  +  K+GAWY Y  E++GQG+
Sbjct: 244 RVKVVKNKVAAPFRQVDFQILYGQGISKTGELIELGVKHKLVDKAGAWYAYNGEKIGQGK 303

Query: 303 EAAKQTLKENPDLREELETKVR 324
             A +             TK+R
Sbjct: 304 ANAMKWXXXXXXXXXXXXTKLR 325


>RECA_NEIMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  317 bits (811), Expect = 1e-88
 Identities = 163/332 (49%), Positives = 212/332 (63%), Gaps = 2/332 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKG+IMK      + N+ VI T              PRGRIVE++GPESSGKTT
Sbjct: 15  QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ +A+ Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVR
Sbjct: 75  LCLEAVAQCQKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ
Sbjct: 135 SGGIDMVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E++G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y   ++GQG++  +  LKENP+
Sbjct: 255 FRQAEFDILYGEGISWEGELIDIGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPE 314

Query: 315 LREELETKVR--ESFEIPIITRSTEEADAMSP 344
           + +E++ K+R     E+ I   + +E D   P
Sbjct: 315 VADEIDAKIRALNGVEMHITEGTQDETDGERP 346


>RECA_AZOSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  317 bits (811), Expect = 1e-88
 Identities = 164/310 (52%), Positives = 205/310 (66%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM+ G+G  + +I  + T              PRGR+VE+YGPESSGKTT
Sbjct: 15  QIEKQFGKGSIMRMGDGTIERDIQTVSTXXXXXXXXXXXXXXPRGRVVEIYGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAE Q +GG  AFIDAEHALD  YA +LGV+I ++LISQPDTGEQALEI DMLVR
Sbjct: 75  LTLQVIAEMQKLGGTAAFIDAEHALDVGYAEKLGVNIQDLLISQPDTGEQALEIADMLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD   GLQARLMSQALRKL  ++ ++NT  IFINQ
Sbjct: 135 SGGVEIVVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTANIKRTNTLVIFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E+VG               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAIKKGDEVVGSETRCKVVKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F++A FD++YGEGISREG I+D+ V+  +  KSGAWY Y  E++GQG++ +++ L+ NP 
Sbjct: 255 FKEAHFDILYGEGISREGEIIDLGVQHKIVDKSGAWYAYKGEKIGQGKDNSREFLRANPA 314

Query: 315 LREELETKVR 324
           L  E+E KVR
Sbjct: 315 LAREIENKVR 324


>RECA_WIGBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 331

 Score =  316 bits (810), Expect = 2e-88
 Identities = 175/325 (53%), Positives = 219/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +   K K L+   D+IE +FGKGSIM  GE    ++I  I TG+L LD ALG GG+P GR
Sbjct: 3   IENNKKKALEKALDKIEKQFGKGSIMTLGEN-RSMDIETISTGSLSLDIALGTGGLPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++I EAQ  G I AFIDAEHALDP+YA  LGVDI+ +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIYEAQKKGKICAFIDAEHALDPIYAKNLGVDINNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEICD L RSG              P+AEI+GEIGD  +GL AR+MSQA+RKLAG
Sbjct: 122 NGEQALEICDSLTRSGAVDLIIVDSVAALTPKAEIDGEIGDLHLGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +NT  IFINQ+R KIG +FG+PE TTGG ALKF+                      
Sbjct: 182 NLKNANTLLIFINQIRVKIGTIFGSPEVTTGGNALKFYASVRLXXXXXXXXXXXXXXXXN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG GI+ EG ++ + V   + +KSG+WY+Y + ++GQ
Sbjct: 242 ETRVKVVKNKISAPFRQAEFQILYGNGINTEGELITLGVNHNIIEKSGSWYSYNKNKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A   LK NP++ +E+  K+RE
Sbjct: 302 GKNNACNFLKNNPNISKEISRKIRE 326


>RECA_MYCSS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  316 bits (810), Expect = 2e-88
 Identities = 166/312 (53%), Positives = 206/312 (66%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE   GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 7   DREKALELALAQIEKSHGKGSVMRLGDEVR-APISVIPTGSIALDVALGIGGLPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+LS
Sbjct: 126 QALEIADMLIRSGALDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITGALS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 246 VKIVKNKVSPPFKQAEFDILYGKGISKEGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKE 305

Query: 304 AAKQTLKENPDL 315
            A++ L EN D+
Sbjct: 306 NARKFLLENGDV 317


>RECA_MYCSK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  316 bits (810), Expect = 2e-88
 Identities = 166/312 (53%), Positives = 206/312 (66%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE   GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 7   DREKALELALAQIEKSHGKGSVMRLGDEVR-APISVIPTGSIALDVALGIGGLPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+LS
Sbjct: 126 QALEIADMLIRSGALDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITGALS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 246 VKIVKNKVSPPFKQAEFDILYGKGISKEGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKE 305

Query: 304 AAKQTLKENPDL 315
            A++ L EN D+
Sbjct: 306 NARKFLLENGDV 317


>RECA_MYCSJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  316 bits (810), Expect = 2e-88
 Identities = 166/312 (53%), Positives = 206/312 (66%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE   GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 7   DREKALELALAQIEKSHGKGSVMRLGDEVR-APISVIPTGSIALDVALGIGGLPRGRVIE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 66  IYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAEIEGE+GD+ VGLQARLMSQALRK+ G+LS
Sbjct: 126 QALEIADMLIRSGALDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITGALS 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 + VG    
Sbjct: 186 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTDAVGNRTR 245

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG+GIS+EG ++DM VE G  +KSG+W+TY  E+LGQG+E
Sbjct: 246 VKIVKNKVSPPFKQAEFDILYGKGISKEGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKE 305

Query: 304 AAKQTLKENPDL 315
            A++ L EN D+
Sbjct: 306 NARKFLLENGDV 317


>RECA_CAUCR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  316 bits (810), Expect = 2e-88
 Identities = 187/323 (57%), Positives = 234/323 (72%), Gaps = 1/323 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K + L+    QI+  FGKGS+MK GE G  + I  + T              P+GRIVE
Sbjct: 16  DKQRALEAALAQIDRAFGKGSVMKLGEKGK-VEIESVSTXXXXXXXXXXXXXXPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTLAL ++AE Q  GG  AF+DAEHALDP YA +LGV++D +L+SQPD GE
Sbjct: 75  VYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEHALDPSYAYKLGVNLDNLLVSQPDNGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL  S++
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSLPGLQARLMSQALRKLTASIN 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+NT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 EI      
Sbjct: 195 KANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSVKARDEIXXXXXX 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+MYGEGIS+ G ++D+ V+AG+  K+G+W++YG +R+GQGR+
Sbjct: 255 XXXXXXXXAPPFREVEFDIMYGEGISKLGEVIDLGVKAGIIDKAGSWFSYGSQRIGQGRD 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
             ++ LK NPD+  ++E  VR+S
Sbjct: 315 NVREFLKNNPDVAADIEKAVRKS 337


>RECA_CAUCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  316 bits (810), Expect = 2e-88
 Identities = 187/323 (57%), Positives = 234/323 (72%), Gaps = 1/323 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K + L+    QI+  FGKGS+MK GE G  + I  + T              P+GRIVE
Sbjct: 16  DKQRALEAALAQIDRAFGKGSVMKLGEKGK-VEIESVSTXXXXXXXXXXXXXXPKGRIVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTLAL ++AE Q  GG  AF+DAEHALDP YA +LGV++D +L+SQPD GE
Sbjct: 75  VYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEHALDPSYAYKLGVNLDNLLVSQPDNGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL  S++
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSLPGLQARLMSQALRKLTASIN 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+NT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 EI      
Sbjct: 195 KANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSVKARDEIXXXXXX 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+MYGEGIS+ G ++D+ V+AG+  K+G+W++YG +R+GQGR+
Sbjct: 255 XXXXXXXXAPPFREVEFDIMYGEGISKLGEVIDLGVKAGIIDKAGSWFSYGSQRIGQGRD 314

Query: 304 AAKQTLKENPDLREELETKVRES 326
             ++ LK NPD+  ++E  VR+S
Sbjct: 315 NVREFLKNNPDVAADIEKAVRKS 337


>RECA_SILPO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  316 bits (809), Expect = 2e-88
 Identities = 166/321 (51%), Positives = 206/321 (64%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE +FGKGSIM+ G       I    T              P GRIVE
Sbjct: 8   DKQKALDSALAQIERQFGKGSIMRLGGENAIQEIEASSTXXXXXXXXXXXXXXPMGRIVE 67

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDP YA +LGVD+DE+LISQPDTGE
Sbjct: 68  IYGPESSGKTTLTLHCIAEQQKRGGVCAFVDAEHALDPQYARKLGVDLDELLISQPDTGE 127

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P++E+EG++GD++VG+ ARLMSQA+RKL GS+S
Sbjct: 128 QALEITDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSIS 187

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S    IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG    
Sbjct: 188 RSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNATR 247

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEGIS+ G ++D+ V+AGV  KSG+W++YG+ER+GQGRE
Sbjct: 248 VKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVDKSGSWFSYGDERIGQGRE 307

Query: 304 AAKQTLKENPDLREELETKVR 324
            AK  L+EN  +   +E K+R
Sbjct: 308 NAKTFLRENQSIALAIEDKIR 328


>RECA_NEIMB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  316 bits (809), Expect = 2e-88
 Identities = 163/332 (49%), Positives = 211/332 (63%), Gaps = 2/332 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKG+IMK      + N+ VI T              PRGRIVE++GPESSGKTT
Sbjct: 15  QIEKSFGKGAIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ +A+ Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVR
Sbjct: 75  LCLEAVAQCQKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ
Sbjct: 135 SGGIDMVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E++G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y   ++GQG++  +  LKENP+
Sbjct: 255 FRQAEFDILYGEGISWEGELIDIGVKNDIINKSGAWYSYNGAKIGQGKDNVRVWLKENPE 314

Query: 315 LREELETKVR--ESFEIPIITRSTEEADAMSP 344
           +  E++ K+R     E+ I   + +E D   P
Sbjct: 315 VANEIDAKIRALNGVEMHITEGTQDETDGERP 346


>RECA_LACAC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  316 bits (809), Expect = 2e-88
 Identities = 180/310 (58%), Positives = 232/310 (74%), Gaps = 1/310 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKG++M+ GE   D  I  +PTG+L LDAA+G+GG PRGRI+EVYGPESSGKTT+AL  
Sbjct: 21  FGKGAVMRMGEKA-DTQISTVPTGSLALDAAIGVGGYPRGRIIEVYGPESSGKTTVALHA 79

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           +AE Q  GG  A+IDAE+A+DP YA  LGVDID +++SQP+TGE+ L+I D L       
Sbjct: 80  VAEVQKRGGTAAYIDAENAMDPAYAEALGVDIDSLILSQPNTGEEGLQIADTLXXXXXXX 139

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      PRAEIEGE+GD  VGLQARLMSQALRKL+G++SK+ T  IFINQ+REK+
Sbjct: 140 XXXXXXXXXLVPRAEIEGEMGDAHVGLQARLMSQALRKLSGTISKTKTIAIFINQIREKV 199

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GVMFGNPETT GGRALKF+                G+++G               F+ AE
Sbjct: 200 GVMFGNPETTPGGRALKFYSTVRLEVRRAEQIKQSGDVLGNRXXXXXXXXXXAPPFKVAE 259

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
            D+MYG+GIS+ G ++DM          G+WY+Y  +R+GQGRE AK+ L+E+PD+ +++
Sbjct: 260 VDIMYGKGISQSGELLDMXXXXXXXXXXGSWYSYKSDRIGQGRENAKKYLEEHPDIYQKV 319

Query: 320 ETKVRESFEI 329
           + +VR+++ I
Sbjct: 320 QEQVRQAYGI 329


>RECA_HERSE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  316 bits (809), Expect = 2e-88
 Identities = 172/305 (56%), Positives = 212/305 (69%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGS+M+  +G     I  + T              PRGR++E+YGPESSGKTTL LQ 
Sbjct: 27  FGKGSVMRMEDGVIAEEIQAVSTXXXXXXXXXXXXXXPRGRVIEIYGPESSGKTTLTLQS 86

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           IAE Q +GG  AFIDAEHALD  YA +LGV+++++LISQPDTGEQALEICD LVRSG   
Sbjct: 87  IAEMQKLGGTCAFIDAEHALDVTYAQKLGVNLNDLLISQPDTGEQALEICDALVRSGAVD 146

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+AEIEG++GD+  GLQARLMSQALRKL GS++++NTT IFINQ+R KI
Sbjct: 147 LIVVDSVAALTPKAEIEGDMGDSLPGLQARLMSQALRKLTGSINRTNTTVIFINQIRMKI 206

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GVMFGNPETTTGG ALKF+                 E++G               FR+A 
Sbjct: 207 GVMFGNPETTTGGNALKFYASVRLDIRRTGSIKSGDEVIGSETXXXXXXXXXAPPFREAH 266

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
           FD++YGEG SREG I+D+  E  V +KSGAWY+Y  ER+GQG++ A+  LKE+P+L  E+
Sbjct: 267 FDILYGEGTSREGEILDLGSEHKVVEKSGAWYSYNGERIGQGKDNARNYLKEHPELAREI 326

Query: 320 ETKVR 324
           E KVR
Sbjct: 327 ENKVR 331


>RECA_CAMLA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  316 bits (809), Expect = 2e-88
 Identities = 181/341 (53%), Positives = 228/341 (66%), Gaps = 2/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  IPTG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-KIDSIPTGSVGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGVD + + ISQPD
Sbjct: 60  IIEIYGPESSGKTTLTLHIIAECQKKGGVCAFIDAEHALDVKYAKDLGVDTENLYISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALR+L G
Sbjct: 120 FGEQALEIVETIARSGAIDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRELTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KIG+M +G PETTTGG ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRMKIGMMGYGTPETTTGGNALKFYSSVRLDVRKTATLKQNDEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+QAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y   +LG
Sbjct: 240 NRXXXXXXXXXXXPPFKQAEFDVMFGEGVSREGELIDYGVKLDIIDKSGAWFSYKASKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           QGRE AK  LKENP + +E+   ++ S  I  +    +E D
Sbjct: 300 QGRENAKAFLKENPAIADEITQAIQNSIGIDSMILGAKEDD 340


>RECA_CAMJR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  316 bits (809), Expect = 2e-88
 Identities = 178/339 (52%), Positives = 229/339 (67%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  I TG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGV+ D++ +SQPD
Sbjct: 60  IIEIYGPESSGKTTLTLHIIAECQKAGGVCAFIDAEHALDVKYAKNLGVNTDDLYVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALEIVETIARSGAVDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KIG M +G PETTTGG ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRMKIGAMGYGTPETTTGGNALKFYASVRLDVRKVATLKQNEEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y +++LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDVMFGEGLSREGELIDYGVKLDIVDKSGAWFSYKDKKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           QGRE +K  LKENP++ +E+   ++ S  I  +   +E+
Sbjct: 300 QGRENSKAFLKENPEIADEITKAIQNSMGIEGMISGSED 338


>RECA_CAMJJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  316 bits (809), Expect = 2e-88
 Identities = 178/339 (52%), Positives = 229/339 (67%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  I TG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGV+ D++ +SQPD
Sbjct: 60  IIEIYGPESSGKTTLTLHIIAECQKAGGVCAFIDAEHALDVKYAKNLGVNTDDLYVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALEIVETIARSGAVDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KIG M +G PETTTGG ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRMKIGAMGYGTPETTTGGNALKFYASVRLDVRKVATLKQNEEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y +++LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDVMFGEGLSREGELIDYGVKLDIVDKSGAWFSYKDKKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           QGRE +K  LKENP++ +E+   ++ S  I  +   +E+
Sbjct: 300 QGRENSKAFLKENPEIADEITKAIQNSMGIEGMISGSED 338


>RECA_CAMJE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  316 bits (809), Expect = 2e-88
 Identities = 178/339 (52%), Positives = 229/339 (67%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  I TG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGV+ D++ +SQPD
Sbjct: 60  IIEIYGPESSGKTTLTLHIIAECQKAGGVCAFIDAEHALDVKYAKNLGVNTDDLYVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALEIVETIARSGAVDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KIG M +G PETTTGG ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRMKIGAMGYGTPETTTGGNALKFYASVRLDVRKVATLKQNEEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y +++LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDVMFGEGLSREGELIDYGVKLDIVDKSGAWFSYKDKKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           QGRE +K  LKENP++ +E+   ++ S  I  +   +E+
Sbjct: 300 QGRENSKAFLKENPEIADEITKAIQNSMGIEGMISGSED 338


>RECA_CAMJ8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  316 bits (809), Expect = 2e-88
 Identities = 178/339 (52%), Positives = 229/339 (67%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  I TG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGV+ D++ +SQPD
Sbjct: 60  IIEIYGPESSGKTTLTLHIIAECQKAGGVCAFIDAEHALDVKYAKNLGVNTDDLYVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALEIVETIARSGAVDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KIG M +G PETTTGG ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRMKIGAMGYGTPETTTGGNALKFYASVRLDVRKVATLKQNEEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y +++LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDVMFGEGLSREGELIDYGVKLDIVDKSGAWFSYKDKKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           QGRE +K  LKENP++ +E+   ++ S  I  +   +E+
Sbjct: 300 QGRENSKAFLKENPEIADEITKAIQNSMGIEGMISGSED 338


>RECA_RUBXD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  315 bits (808), Expect = 3e-88
 Identities = 168/320 (52%), Positives = 203/320 (63%), Gaps = 1/320 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L     QIE +FGKGSIM+ G+      +  I T              PRGRIVE
Sbjct: 4   DKSKALDTAVSQIERQFGKGSIMRMGDRASQ-KVASISTXXXXXXXXXXXXXXPRGRIVE 62

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLAL IIAEAQ  GG+ AFIDAEHALDP YA  +GVD++ +  SQPD+GE
Sbjct: 63  IFGPESSGKTTLALHIIAEAQRAGGLAAFIDAEHALDPTYAEAIGVDLENLYFSQPDSGE 122

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAEIEGE+GD+ VGLQARLMSQA         
Sbjct: 123 QALEIADTLVRSGALDAVVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQAXXXXXXXXX 182

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
              TT IFINQLREKIGVMFG+PETT GGRALKF+                 E VG    
Sbjct: 183 XXXTTAIFINQLREKIGVMFGSPETTPGGRALKFYASVRMDIRRIGALKAGNETVGNQTR 242

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F++  FD+MYGEGISREG ++D+ +E GV +KSGAW+ YGEER+GQGRE
Sbjct: 243 VKIVKNKVAPPFKEVTFDIMYGEGISREGSLLDVGIEQGVIQKSGAWFAYGEERIGQGRE 302

Query: 304 AAKQTLKENPDLREELETKV 323
            A++ LKE+P++R+ +  +V
Sbjct: 303 NARKFLKEHPEIRDRITREV 322


>RECA_TREDE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 414

 Score =  315 bits (807), Expect = 4e-88
 Identities = 189/324 (58%), Positives = 241/324 (74%), Gaps = 1/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           ++K K L+    QIE +FG+GS+MK G      NI +IP+G++ LD ALGIGG PRGRI+
Sbjct: 15  DDKLKALEAARLQIEKQFGQGSLMKLGNNSAIGNIEIIPSGSILLDEALGIGGYPRGRII 74

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTT+AL  +AEAQ  GGI AFIDAEHALDP YA  LGV+IDE+ +SQPDTG
Sbjct: 75  EIFGPESSGKTTIALHAVAEAQKQGGIAAFIDAEHALDPQYAKALGVNIDELWVSQPDTG 134

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI + LVRSG              P+AEI GE+GD+ +GLQARLMSQALRKL   +
Sbjct: 135 EQALEIAESLVRSGXXXXXXXXXXXXLTPQAEIAGEMGDSHMGLQARLMSQALRKLTAII 194

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFF-XXXXXXXXXXXXXXXXGEIVGXX 241
            KSN   IFINQ+R KIGVMFG+PETTTGG ALKF+                  E  G  
Sbjct: 195 GKSNCMIIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDVRKIETLGKDDDEAWGXX 254

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+ E ++++G+G+   G ++D AV+  +  KSG+WY+YG++++GQG
Sbjct: 255 XXXXXXXXXXAPPFRKVEMEILFGKGVCPYGSLLDSAVKQEIIGKSGSWYSYGDDKIGQG 314

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           R  A + L+EN D+ +++E ++RE
Sbjct: 315 RPNAVKFLEENIDIAQKIEKELRE 338


>RECA_STRZT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRZP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRZJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRR6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRPN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRPJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRPI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRP4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_STRP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 388

 Score =  315 bits (807), Expect = 4e-88
 Identities = 184/353 (52%), Positives = 240/353 (67%), Gaps = 6/353 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+E
Sbjct: 18  EREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGSGGYPKGRIIE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+GE
Sbjct: 77  IYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S++
Sbjct: 137 QGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASIN 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IVG 239
           K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     VG
Sbjct: 197 KTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVG 256

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++G
Sbjct: 257 KETKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWYSYKDEKIG 316

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG E AK+ L E+P++ +E++ +VR  F + I      E D  +   +P K++
Sbjct: 317 QGSENAKKYLAEHPEIFDEIDKQVRSKFGL-IDGEEVSEQDTENKKDEPKKEE 368


>RECA_HERAR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 367

 Score =  315 bits (807), Expect = 4e-88
 Identities = 164/329 (49%), Positives = 208/329 (63%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           + +KSK       QIE +FGKGS+M+  +G     + V+ T                   
Sbjct: 9   SSDKSKXXXXXXXQIEKQFGKGSVMRMEDGAVVEEVQVVSTXXXXXXXXXXXXXXXXXXX 68

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
            E+YGPESSGKTTL LQ IAE Q +GG  AFIDAEHALD  YA +LG+++ E+LISQPDT
Sbjct: 69  XEIYGPESSGKTTLTLQTIAEMQKLGGTCAFIDAEHALDVTYAQKLGINLSELLISQPDT 128

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEICD LVRSG              PRAEIEG++GD+  GLQARLMSQALRKL GS
Sbjct: 129 GEQALEICDALVRSGGVDLIVIDSVAALTPRAEIEGDMGDSLPGLQARLMSQALRKLTGS 188

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G  
Sbjct: 189 INRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIKSGDEVIGNE 248

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F++A F+++YGEG SREG I+D+  +A + +KSGAWY+Y  ER+GQG
Sbjct: 249 TKVKVVKNKIAPPFKEAHFEILYGEGTSREGEILDLGSDAKIVEKSGAWYSYNGERIGQG 308

Query: 302 REAAKQTLKENPDLREELETKVRESFEIP 330
           ++ A+  LKE P+L  E+E KVR S  +P
Sbjct: 309 KDNARNYLKERPELAREIENKVRASLGVP 337


>RECA_GLOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 369

 Score =  315 bits (807), Expect = 4e-88
 Identities = 172/299 (57%), Positives = 215/299 (71%), Gaps = 2/299 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K LK+   QI+  FG+G+IM+ GE    + +  +P+GA+ LD ALG GG+PRGR++E
Sbjct: 22  QKQKALKMVLTQIKRNFGEGAIMRLGENTR-IRVETVPSGAITLDLALG-GGLPRGRVIE 79

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAE Q  GG+ AF+DAEHALDP YA  LGV++D+++ISQPDTGE
Sbjct: 80  IYGPESSGKTTLALHAIAEIQKTGGVAAFVDAEHALDPAYAKVLGVNVDDLIISQPDTGE 139

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            A+EI D LVRS               PRAEIEGE+GD  VGLQARLMSQALRK+ G++ 
Sbjct: 140 MAMEIVDQLVRSAAIDVIVIDSVAALVPRAEIEGEMGDAHVGLQARLMSQALRKITGNIG 199

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+    IF+NQLR KIGVM+GNPETTTGG ALKF+                 +  G    
Sbjct: 200 KTGCMVIFLNQLRSKIGVMYGNPETTTGGNALKFYASVRLDIRKAETLKKGQDEYGXXXX 259

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                      FR+AEFD+++G+GIS  GCI+D+AVE  + ++ GAWY+YG ERLGQGR
Sbjct: 260 XXXXXXXXAPPFRKAEFDIIFGKGISSLGCILDLAVEMEIVERKGAWYSYGSERLGQGR 318


>RECA_STRU0 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  315 bits (806), Expect = 5e-88
 Identities = 164/326 (50%), Positives = 218/326 (66%), Gaps = 5/326 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E++ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  EDRRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+ SG              PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIDSGAVDLVVIDSVAALVPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G ++ +A +  V +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELIKIASDLDVIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVR 324
           GQG E AK+ L ++P++ +E++ KVR
Sbjct: 316 GQGSENAKKFLADHPEIFDEIDHKVR 341


>RECA_NITMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 339

 Score =  315 bits (806), Expect = 5e-88
 Identities = 175/324 (54%), Positives = 218/324 (67%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E +SK L     QIE +FGKGSIM+ G      ++ VI TG+L LD ALG+GG+PRGR
Sbjct: 1   MDENRSKALAAALSQIEKQFGKGSIMRLGASDVGKDVQVISTGSLGLDIALGVGGLPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAE Q MGG  AFIDAEHALD  YA +LGV++ ++LISQPD
Sbjct: 61  IVEIYGPESSGKTTLTLQVIAEMQRMGGTAAFIDAEHALDSQYAQKLGVNVQDLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI DML                  PRAEIEGE+G+  +GL ARLMSQALRKL G
Sbjct: 121 NGEQALEIADMLXXXXXXXXXXXXXXAALTPRAEIEGEMGEPQMGLHARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ +SNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 E++G 
Sbjct: 181 NIKRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGSIKKGEEVIGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEFD++Y              V+  +  KSGAWY Y  +++GQ
Sbjct: 241 ETRVKVVKNKVAPPFRQAEFDILYXXXXXXXXXXXXXXVQHKLIDKSGAWYAYKGDKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++  ++ LKE+ D+  E+E+K+R
Sbjct: 301 GKDNVREYLKEHRDIAMEIESKIR 324


>RECA_HALHL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  315 bits (806), Expect = 5e-88
 Identities = 180/353 (50%), Positives = 234/353 (66%), Gaps = 5/353 (1%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDL-NIGVIPTGALPLDAALGIGGVPRG 59
           M++++ K L     QIE +FGKG++M+ G+      ++  I TG+L LD ALGIGG+PRG
Sbjct: 1   MDDDRKKALGAALGQIEKQFGKGAVMRMGDARAVRGDVKSISTGSLALDVALGIGGLPRG 60

Query: 60  RIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQP 119
           R+VE+YGPESSGKTTL L II                  LDP YA  +GVDI+++L+SQP
Sbjct: 61  RVVEIYGPESSGKTTLTLHIIXXXXXXXXXXXXXXXXXXLDPDYAEAVGVDINDLLVSQP 120

Query: 120 DTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLA 179
           DTGEQALEI DMLVR                P+AEIEGE+GD+ VGLQARLMSQALRKL 
Sbjct: 121 DTGEQALEIADMLVRXXXXXXXXXXXXXXXTPKAEIEGEMGDSHVGLQARLMSQALRKLT 180

Query: 180 GSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
           GS+ +SNT  +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G
Sbjct: 181 GSIQRSNTLVVFINQIRMKIGVMFGSPETTTGGNALKFYSSVRMDIRRLGAIKKGDEVLG 240

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+QAEF+++YGEGISREG I+DM V  G   KSGAWY+Y  +R+G
Sbjct: 241 NETRVKVVKNKMAPPFKQAEFEILYGEGISREGEIIDMGVAQGFVDKSGAWYSYNGDRIG 300

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
           QG++ A+Q L+ NP +  ++E ++RE     ++  +  EA+     A   ++K
Sbjct: 301 QGKDNARQFLRNNPQIAADIEARIREK----VLGTALPEAEPTEDAASDTEQK 349


>RECA_EHRRW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  315 bits (806), Expect = 5e-88
 Identities = 184/328 (56%), Positives = 236/328 (71%), Gaps = 1/328 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +N ++ K L     QIE  FG+G+IMK  +G  +  I  IPTG++ LD ALGIGG P+GR
Sbjct: 7   LNHDRQKALDNAISQIEKAFGRGAIMKLKQGAIE-KIDSIPTGSIALDTALGIGGFPKGR 65

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E++GPESSGKTTLAL +IAE+Q  GG  AFIDAEHALD +YA +LGV+  ++++SQPD
Sbjct: 66  IIEIFGPESSGKTTLALHVIAESQKKGGNCAFIDAEHALDIMYARKLGVNTGDLIVSQPD 125

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQAL I + L+ SG              PRAEIEG++GD  +GLQARL+S ALRKL  
Sbjct: 126 TGEQALHIVEYLICSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHALRKLTS 185

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I+G 
Sbjct: 186 IVSKANCILIFINQIRMKIGVVYGNPETTTGGNALKFYSSVRLDIRKVSAIKDKDVIIGN 245

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q +FD+MY EGIS+ G I+DM V+  + +K+G++Y+Y   RLGQ
Sbjct: 246 QTXXXXXXXXXAPPFKQVDFDIMYNEGISKVGEIIDMGVKLNIVEKAGSYYSYNSVRLGQ 305

Query: 301 GREAAKQTLKENPDLREELETKVRESFE 328
           G+E AK  LK NP   +E+E K+R S +
Sbjct: 306 GKENAKLYLKNNPSTADEIEQKIRASLQ 333


>RECA_EHRRG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  315 bits (806), Expect = 5e-88
 Identities = 184/328 (56%), Positives = 236/328 (71%), Gaps = 1/328 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +N ++ K L     QIE  FG+G+IMK  +G  +  I  IPTG++ LD ALGIGG P+GR
Sbjct: 7   LNHDRQKALDNAISQIEKAFGRGAIMKLKQGAIE-KIDSIPTGSIALDTALGIGGFPKGR 65

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E++GPESSGKTTLAL +IAE+Q  GG  AFIDAEHALD +YA +LGV+  ++++SQPD
Sbjct: 66  IIEIFGPESSGKTTLALHVIAESQKKGGNCAFIDAEHALDIMYARKLGVNTGDLIVSQPD 125

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQAL I + L+ SG              PRAEIEG++GD  +GLQARL+S ALRKL  
Sbjct: 126 TGEQALHIVEYLICSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHALRKLTS 185

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I+G 
Sbjct: 186 IVSKANCILIFINQIRMKIGVVYGNPETTTGGNALKFYSSVRLDIRKVSAIKDKDVIIGN 245

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q +FD+MY EGIS+ G I+DM V+  + +K+G++Y+Y   RLGQ
Sbjct: 246 QTXXXXXXXXXAPPFKQVDFDIMYNEGISKVGEIIDMGVKLNIVEKAGSYYSYNSVRLGQ 305

Query: 301 GREAAKQTLKENPDLREELETKVRESFE 328
           G+E AK  LK NP   +E+E K+R S +
Sbjct: 306 GKENAKLYLKNNPSTADEIEQKIRASLQ 333


>RECA_DESDA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  315 bits (806), Expect = 5e-88
 Identities = 179/324 (55%), Positives = 227/324 (70%), Gaps = 2/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E +++ L      IE K+GKG++MK  +  H +NI VIPTG++ LD ALG+GG+PRGRI 
Sbjct: 11  EARAEALGTALATIERKYGKGAVMKLSDDAH-VNIPVIPTGSIGLDLALGVGGIPRGRIS 69

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L IIAE Q +GG  AF+DAEHALD  YA RLGV+ DE+LISQPD G
Sbjct: 70  EIFGPESSGKTTLTLHIIAECQRLGGTCAFVDAEHALDVSYARRLGVNTDELLISQPDYG 129

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQAL+I DMLVRSG              P+AE+EG++G+T VG  ARLMS A+R+L G++
Sbjct: 130 EQALDIADMLVRSGXXXXXXXXXXXXXIPQAELEGDMGETQVGGHARLMSHAMRRLTGTI 189

Query: 183 SKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
            KS T+ IFINQ+R KIGV  +G+PETTTGG ALKF+                 E  G  
Sbjct: 190 HKSRTSVIFINQIRMKIGVTGYGSPETTTGGNALKFYSSVRLDIRRIQTLKDKEESFGSR 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR A FD++YG GISR G ++D+ +EA +  +SG+W+ +G E+LGQG
Sbjct: 250 TRVKVVKNKVAPPFRSAVFDILYGLGISRAGELLDLGIEAKIIDQSGSWFAFGAEKLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  +  L EN DLR ++E KV E
Sbjct: 310 REKVRALLDENIDLRNQIEAKVVE 333


>RECA_DEIRA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  315 bits (806), Expect = 5e-88
 Identities = 189/322 (58%), Positives = 237/322 (73%), Gaps = 2/322 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+SK ++    QIE  FGKGSIMK G     L++ V+ TG+L LD ALG+GG+PRGRI 
Sbjct: 16  KERSKAIETAMSQIEKAFGKGSIMKLGAESK-LDVQVVSTGSLSLDLALGVGGIPRGRIT 74

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPES GKTTLAL I+A+AQ  GG  AFIDAEHALDPVYA  LGV+ DE+L+SQPD G
Sbjct: 75  EIYGPESGGKTTLALAIVAQAQKAGGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNG 134

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI ++LVRSG              PRAEIEG++GD+  GLQARLMSQALRKL   L
Sbjct: 135 EQALEIMELLVRSGAIXXXXXXXXXXLTPRAEIEGDMGDSLPGLQARLMSQALRKLTAIL 194

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVGXX 241
           SK+ T  IFINQ+REKIGVM+GNPETTTGGRALKF+                G +     
Sbjct: 195 SKTGTAAIFINQVREKIGVMYGNPETTTGGRALKFYASVRLDVRKIGQPTKVGNDXXXXX 254

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F++ E  L+YG+G  +   +V +A +  + KK+G++Y+YG+ER+GQG
Sbjct: 255 XXXXXXXXXXXXPFKEVELALVYGKGFDQLSDLVGLAADMDIIKKAGSFYSYGDERIGQG 314

Query: 302 REAAKQTLKENPDLREELETKV 323
           +E     + E P++ +E+  +V
Sbjct: 315 KEKTIAYIAERPEMEQEIRDRV 336


>RECA_ZYMMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 339

 Score =  314 bits (805), Expect = 7e-88
 Identities = 164/323 (50%), Positives = 209/323 (64%), Gaps = 1/323 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L+    QI+  FGKGS+M+ G     + I                   PRGRIVE
Sbjct: 2   DKQKALEAALAQIDRAFGKGSVMRLGSR-EKIEIDTXXXXXXXXXXXXXXXXXPRGRIVE 60

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAEAQ  GG  AF+DAEHALDPVYA +LGV+ D++++SQPDTGE
Sbjct: 61  IYGPESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKKLGVNTDDLIVSQPDTGE 120

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D L+RS               PRAEIEGE+GD+ VGLQARLMSQALRK+ GS++
Sbjct: 121 QALEITDTLIRSNAVDILVVDSVAALTPRAEIEGEMGDSHVGLQARLMSQALRKITGSIN 180

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +S T  IFINQ+R KIGVM+GNPETTTGG ALKF+                 EIVG    
Sbjct: 181 RSQTLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRVGQIKDRDEIVGNATR 240

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+Q EFD+MYGEG+S+ G I+D+ V+AG+  KSG+W+++   R+GQGRE
Sbjct: 241 VKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIIDKSGSWFSHDSVRIGQGRE 300

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AK  L+E+P++ E++E  +R +
Sbjct: 301 NAKTFLREHPEMTEKIEKMIRHN 323


>RECA_STRPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  314 bits (805), Expect = 7e-88
 Identities = 179/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L E+P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLAEHPELFDEIDRKVRVKF 344


>RECA_STRPC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  314 bits (805), Expect = 7e-88
 Identities = 179/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L E+P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLAEHPELFDEIDRKVRVKF 344


>RECA_STRPB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  314 bits (805), Expect = 7e-88
 Identities = 179/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L E+P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLAEHPELFDEIDRKVRVKF 344


>RECA_STRP8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  314 bits (805), Expect = 7e-88
 Identities = 179/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L E+P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLAEHPELFDEIDRKVRVKF 344


>RECA_STRP6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  314 bits (805), Expect = 7e-88
 Identities = 179/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L E+P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLAEHPELFDEIDRKVRVKF 344


>RECA_STRA5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  314 bits (805), Expect = 7e-88
 Identities = 181/329 (55%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRIV
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIV 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                GE     V
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYSSVRLDVRGNTQIKGTGEHKDHNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               FR+A  ++MYGEGISR G ++ +A +  + +K+GAWY+Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFREAFVEIMYGEGISRTGELIKIASDLDIIQKAGAWYSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L +NP + +E++ KVR  F
Sbjct: 316 GQGSENAKKYLADNPAIFDEIDHKVRVHF 344


>RECA_STRA3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  314 bits (805), Expect = 7e-88
 Identities = 181/329 (55%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRIV
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIV 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                GE     V
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYSSVRLDVRGNTQIKGTGEHKDHNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               FR+A  ++MYGEGISR G ++ +A +  + +K+GAWY+Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFREAFVEIMYGEGISRTGELIKIASDLDIIQKAGAWYSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L +NP + +E++ KVR  F
Sbjct: 316 GQGSENAKKYLADNPAIFDEIDHKVRVHF 344


>RECA_RHOBA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 375

 Score =  314 bits (805), Expect = 7e-88
 Identities = 165/320 (51%), Positives = 211/320 (65%), Gaps = 1/320 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK   LK T  QIE  FG G+IM  G     L I  I TG+L LD ALG  G+PRGRI+E
Sbjct: 27  EKEPGLKTTLQQIEKSFGDGAIMPLG-ASQKLTIDCISTGSLSLDMALGGKGIPRGRIIE 85

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           V+GPESSGKTTLAL I AEAQ  GGI A IDAEHA DP +A +LGV++D +L+SQP +GE
Sbjct: 86  VFGPESSGKTTLALHIGAEAQKSGGIAAIIDAEHAFDPSWAKKLGVELDSLLVSQPSSGE 145

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           +A++IC+MLV+S               P+AE+EGEIGD+ VGLQARLMSQ++RKL G+++
Sbjct: 146 EAMQICEMLVKSNAVDVIIIDSVAALVPKAELEGEIGDSHVGLQARLMSQSMRKLTGAIA 205

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS +  +FINQ+REK+GVMFG+PETT GGRALKF+                 E VG    
Sbjct: 206 KSKSAVVFINQIREKVGVMFGSPETTPGGRALKFYCSCRIDVRRIGSLKDGEEQVGQRVK 265

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+M+  GIS EG ++D+  E  V  +SG+W+ YG+  LGQG+E
Sbjct: 266 AKIVKNKVAPPFRIAEFDMMHSNGISFEGDLLDLGTENKVVNRSGSWFKYGDTYLGQGKE 325

Query: 304 AAKQTLKENPDLREELETKV 323
            A+  L ENPD+ +E++ KV
Sbjct: 326 KARNFLIENPDVSDEIKQKV 345


>RECA_BORA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 353

 Score =  314 bits (805), Expect = 7e-88
 Identities = 168/325 (51%), Positives = 213/325 (65%), Gaps = 2/325 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM++G+   + +I V+ TG+L LD A            E+YGPESSGKTT
Sbjct: 22  QIEKQFGKGSIMRYGDNEVEHDIQVVSTGSLGLDIAXXXXXXXXXXXXEIYGPESSGKTT 81

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ+IAE Q +GG  AF+DAEHALD  YA++LGV++ ++LISQPDTGEQALEI D LVR
Sbjct: 82  LTLQVIAEMQKVGGTCAFVDAEHALDVQYASKLGVNLGDLLISQPDTGEQALEITDALVR 141

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD   GLQARLMSQALRKL  ++ ++N   IFINQ
Sbjct: 142 SGSVDLIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTATIKRTNCMVIFINQ 201

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 202 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKGDEVVGNETRVKVVKNKVAPP 261

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD+MYG GISREG I+D+ V A V +KSGAWY+Y   R+GQG++  ++ LKEN  
Sbjct: 262 FKQAEFDIMYGAGISREGEIIDLGVAANVIEKSGAWYSYSGNRIGQGKDNVREYLKENRA 321

Query: 315 LREELETKVRESFEIPIITRSTEEA 339
           +  E+E K+R++    I+ R+ E A
Sbjct: 322 MAIEIENKIRDN--QGIVARAAEFA 344


>RECA_WOLPP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  314 bits (804), Expect = 9e-88
 Identities = 177/327 (54%), Positives = 225/327 (68%), Gaps = 1/327 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L     QIE  FGKG+IMK  +   +  I  I TG++ LD+ALG+GG+P+GRI
Sbjct: 9   NNDKQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRI 67

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTLAL +IAEAQ  GG+ AFIDAEHALD +YA +LGV  D+++ISQPDT
Sbjct: 68  IEIFGPESSGKTTLALHVIAEAQKKGGLCAFIDAEHALDVIYARKLGVKTDDLVISQPDT 127

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQAL I + LV                 PRAEIEG++GD  +GLQARL+S  LRKL   
Sbjct: 128 GEQALHIVEYLVCXXXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHGLRKLTSV 187

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I G  
Sbjct: 188 VSKANCILIFINQIRMKIGVVYGNPETTTGGNALKFYTSIRLDIRKVGAIKDKENITGNE 247

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A+FD+MY EGIS+ G I+D+  + GV +K+GA+Y+Y   RLGQG
Sbjct: 248 TRVKVVKNKVAPPFREAKFDIMYNEGISKLGEIIDIGAKLGVLEKAGAYYSYNNTRLGQG 307

Query: 302 REAAKQTLKENPDLREELETKVRESFE 328
           RE  K  LK N ++  E+ETK+R+ F+
Sbjct: 308 RENVKSYLKANKEIASEIETKIRDLFK 334


>RECA_MYCPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  314 bits (804), Expect = 9e-88
 Identities = 164/312 (52%), Positives = 203/312 (65%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 6   DREKALELAMAQIEKSYGKGSVMRLGDEMRQ-PISVIPTGSIALDVALGIGGLPRGRVVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAE+EGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADMLIRSGALDILVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                   VG    
Sbjct: 185 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTNAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++DM V+ G  +KSG+W+TY  E+LGQG+E
Sbjct: 245 VKIVKNKVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIRKSGSWFTYEGEQLGQGKE 304

Query: 304 AAKQTLKENPDL 315
            A+  L EN ++
Sbjct: 305 NARTFLMENDEV 316


>RECA_MYCA1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  314 bits (804), Expect = 9e-88
 Identities = 164/312 (52%), Positives = 203/312 (65%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR+VE
Sbjct: 6   DREKALELAMAQIEKSYGKGSVMRLGDEMRQ-PISVIPTGSIALDVALGIGGLPRGRVVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAE+EGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADMLIRSGALDILVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                   VG    
Sbjct: 185 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTNAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++DM V+ G  +KSG+W+TY  E+LGQG+E
Sbjct: 245 VKIVKNKVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIRKSGSWFTYEGEQLGQGKE 304

Query: 304 AAKQTLKENPDL 315
            A+  L EN ++
Sbjct: 305 NARTFLMENDEV 316


>RECA_COLP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  314 bits (804), Expect = 9e-88
 Identities = 176/327 (53%), Positives = 227/327 (69%), Gaps = 1/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M ++K K L     QIE +FGKGSIMK G+    +++  I T              P GR
Sbjct: 1   MKDDKEKALSAALAQIERQFGKGSIMKLGDNT-TMDVETISTXXXXXXXXXXXXXXPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTL L++IAEAQ  G + AFIDAEHALDPVYA +LGV+IDE+LISQPD
Sbjct: 60  VVEIYGPESSGKTTLTLEVIAEAQRNGKVCAFIDAEHALDPVYAEKLGVNIDELLISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DML RSG              P+AEIEG++GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEIVDMLTRSGXXXXXXXXXXXXLTPKAEIEGDMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L KSNT  IFINQ+R KIGVMFG+PETTTGG ALKF+                 EIVG 
Sbjct: 180 NLKKSNTMLIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKNGDEIVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YGEGI+  G ++++ V+    +K+GAWY+   ER+GQ
Sbjct: 240 ETRVKVVKNKIAPPFKQAEFQILYGEGINNLGELIELGVKHEFVEKAGAWYSCNGERIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESF 327
           G+  A + L E+P++ ++++TK+R+ F
Sbjct: 300 GKANAAKYLDEHPEMAKDVDTKLRDMF 326


>RECA_STRMU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 383

 Score =  313 bits (803), Expect = 1e-87
 Identities = 177/329 (53%), Positives = 232/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRIV
Sbjct: 17  DERKKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIV 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKDGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+G+MFGNPETT GGRALKF+                GE     +
Sbjct: 196 NKTKTIAIFINQLREKVGIMFGNPETTPGGRALKFYSSVRLDVRGNTQIKGTGEQKDSNI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  +++YGEGISR G +V +A + G+ +K+GAWY+Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIIYGEGISRTGELVKIASDLGIIQKAGAWYSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L +NP++ ++++ KVR  +
Sbjct: 316 GQGSENAKKFLADNPEIFDDIDHKVRVQY 344


>RECA_STRPM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  313 bits (802), Expect = 1e-87
 Identities = 178/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPELFDEIDRKVRVKF 344


>RECA_STRPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 381

 Score =  313 bits (802), Expect = 1e-87
 Identities = 180/329 (54%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKGSIM+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DEREKALNDALKLIEKDFGKGSIMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPSYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL  S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLGASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     V
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKDTNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGISR G +V +A +  + +K+GAWY+Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAMVEIMYGEGISRTGELVKIATDLDIIQKAGAWYSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P++ +E++ KVR  F
Sbjct: 316 GQGSENAKKFLADHPEIFDEIDHKVRVHF 344


>RECA_STRP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  313 bits (802), Expect = 1e-87
 Identities = 178/329 (54%), Positives = 231/329 (70%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPELFDEIDLKVRVKF 344


>RECA_MYCMM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  313 bits (801), Expect = 2e-87
 Identities = 162/312 (51%), Positives = 203/312 (65%), Gaps = 1/312 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I +IPTG++ LD ALGIGG+PRGR++E
Sbjct: 6   DREKALELAMAQIEKSYGKGSVMRLGDEVRQ-PISIIPTGSIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAE+EGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLR+KIGVMFG+PETTTGG+ALKF+                   VG    
Sbjct: 185 NSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTNAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++DM V+ G  +KSGAW+TY  E+LGQG+E
Sbjct: 245 VKIVKNKVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIRKSGAWFTYEGEQLGQGKE 304

Query: 304 AAKQTLKENPDL 315
            A+  L EN ++
Sbjct: 305 NARNFLLENGEV 316


>RECA_STRPF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  312 bits (800), Expect = 2e-87
 Identities = 178/329 (54%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPQLFDEIDRKVRVKF 344


>RECA_STRPD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  312 bits (800), Expect = 2e-87
 Identities = 178/329 (54%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPQLFDEIDRKVRVKF 344


>RECA_STRP3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  312 bits (800), Expect = 2e-87
 Identities = 178/329 (54%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPQLFDEIDRKVRVKF 344


>RECA_STREM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  312 bits (800), Expect = 2e-87
 Identities = 180/341 (52%), Positives = 235/341 (68%), Gaps = 8/341 (2%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD  VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDNHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G ++ +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELIKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEA 339
           GQG E AK+ L ++P+L +E++ KVR  F    +   TEE+
Sbjct: 316 GQGSENAKRYLADHPELFDEIDHKVRVKFG---LLEDTEES 353


>RECA_SHEPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  312 bits (800), Expect = 2e-87
 Identities = 177/324 (54%), Positives = 220/324 (67%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++  K K L     QIE +FGKGSIMK GE    +++  I T              P GR
Sbjct: 3   IDPNKEKALNAVLGQIEKQFGKGSIMKLGED-RSMDVETISTXXXXXXXXXXXXXXPMGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID +L SQPD
Sbjct: 62  IVEIYGPESSGKTTLTLEVIAAAQKQGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEICD L RSG              P+AEIEGEIGD+ +GL AR+MSQA+RKLAG
Sbjct: 122 TGEQALEICDALTRSGXXXXXXXXXXXXLTPKAEIEGEIGDSHMGLAARMMSQAMRKLAG 181

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L +SNT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 182 NLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDREEVIGN 241

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEF ++YG+GI+  G +VD+ V+  + +K+GAWY+Y  +++GQ
Sbjct: 242 ETRVKVVKNKIAAPFKQAEFQILYGQGINSTGELVDLGVQHKLIEKAGAWYSYKGDKIGQ 301

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           GR  A + L ENP + +E+ET +R
Sbjct: 302 GRANAGKYLIENPAISDEIETTLR 325


>RECA_PARDE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  312 bits (800), Expect = 2e-87
 Identities = 173/323 (53%), Positives = 217/323 (67%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE +FGKGSIMK G       I    T              P+GRI+E
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGADNPVAEIEATSTXXXXXXXXXXXXXXPKGRIIE 75

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTL L ++AE Q  GG+ AF+DAEHALDP YA +LGV++DE+LISQPDTGE
Sbjct: 76  IFGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTGE 135

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D                    P++EIEG++GD  +G QARLMSQA+RKL  S+ 
Sbjct: 136 QALEIVDTXXXXXXXXXXXXXXXXXXTPKSEIEGDMGDMQMGSQARLMSQAMRKLTASIG 195

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SN   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+ G    
Sbjct: 196 RSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRAGSIKDRDEVTGNATR 255

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQ EFD+MYGEGIS+ G ++D+ ++AGV +KSG+WY+YG+ER+GQGRE
Sbjct: 256 VKVVKNKVAPPFRQVEFDIMYGEGISKVGELIDLGIKAGVVEKSGSWYSYGDERIGQGRE 315

Query: 304 AAKQTLKENPDLREELETKVRES 326
            AKQ L+++PD+   +E K+R S
Sbjct: 316 NAKQFLRDHPDMAHAIEDKIRAS 338


>RECA_STRS7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  312 bits (799), Expect = 3e-87
 Identities = 177/329 (53%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD  VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDNHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G ++ +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELIKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPELFDEIDHKVRVKF 344


>RECA_STRE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  312 bits (799), Expect = 3e-87
 Identities = 177/329 (53%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD  VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDNHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G ++ +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELIKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P+L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPELFDEIDHKVRVKF 344


>RECA_MYCUA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  312 bits (799), Expect = 3e-87
 Identities = 162/309 (52%), Positives = 201/309 (65%), Gaps = 1/309 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I +IPTG++ LD ALGIGG+PRGR++E
Sbjct: 6   DREKALELAMAQIEKSYGKGSVMRLGDEVRQ-PISIIPTGSIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPEYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAE+EGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIVDMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLR+KIGVMFG+PETTTGG+ALKF+                   VG    
Sbjct: 185 NSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTNAVGNRTR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++YG GISREG ++DM V+ G  +KSGAW+TY  E+LGQG+E
Sbjct: 245 VKIVKNKVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIRKSGAWFTYEGEQLGQGKE 304

Query: 304 AAKQTLKEN 312
            A+  L EN
Sbjct: 305 NARNFLLEN 313


>RECA_PASHA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 368

 Score =  311 bits (798), Expect = 4e-87
 Identities = 173/305 (56%), Positives = 218/305 (71%), Gaps = 1/305 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGSIMK G+    L+I  + TG+L LD+ALGIGG+P GRIVE+YGPESSGKTTL L +
Sbjct: 35  FGKGSIMKLGDT-QALDIEAVSTGSLGLDSALGIGGLPMGRIVEIYGPESSGKTTLTLSV 93

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           +A+AQ  G   AFIDAEHALDP+YA +LGVD D +LISQPD GEQALEICD LVRSG   
Sbjct: 94  VAQAQKNGKTCAFIDAEHALDPIYARKLGVDTDGLLISQPDNGEQALEICDALVRSGXXX 153

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+AEIEG++GD+ +GLQARLMSQALRKL  ++  +N   IFINQ+R KI
Sbjct: 154 XXXXXXXXXLTPKAEIEGDMGDSHMGLQARLMSQALRKLTANIKATNCLVIFINQIRMKI 213

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GVMFGNPETTTGG ALKF+                 E++G               FR+ +
Sbjct: 214 GVMFGNPETTTGGNALKFYASVRLDIRRSGVVKDGDEVIGSETKVKIVKNKVAPPFREVQ 273

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
           FD+MYGEGI+R   ++ +A   G   K+GAW++Y  E++GQG+  A + LKE+P++  ++
Sbjct: 274 FDIMYGEGIARMNELLILAESHGFINKAGAWFSYEGEKIGQGKNNAIKWLKEHPEVASKI 333

Query: 320 ETKVR 324
           E  +R
Sbjct: 334 EQDIR 338


>RECA_ACEPO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  311 bits (798), Expect = 4e-87
 Identities = 180/322 (55%), Positives = 222/322 (68%), Gaps = 1/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +KSK L+    QIE  FGKGSIM+ GE   +  + VI T                    E
Sbjct: 8   DKSKALEGALSQIERAFGKGSIMRMGERPTE-QVDVISTXXXXXXXXXXXXXXXXXXXXE 66

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  IAEAQ  GG  AFIDAEHALDP YA +LGVD+D +LISQPD GE
Sbjct: 67  IYGPESSGKTTMALHAIAEAQRKGGTCAFIDAEHALDPGYARKLGVDVDNLLISQPDAGE 126

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              PRAE+EG++GD+ VGL ARLMSQALRKL GS+S
Sbjct: 127 QALEIADTLVRSGXXXXXXXXXXXXXXPRAELEGDMGDSHVGLHARLMSQALRKLTGSVS 186

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           +SNT  IF+NQ+R KIGVMFG+PE+TTGG ALKF+                 E+ G    
Sbjct: 187 RSNTMLIFLNQIRLKIGVMFGSPESTTGGNALKFYASVRMDIRRIGSIKDKDEVTGNQTR 246

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FRQ EFD+MYGEGIS+ G ++D+ V+AG+ +KSGAW++   +R+GQGRE
Sbjct: 247 VKVVKNKMAPPFRQVEFDIMYGEGISKVGELIDLGVKAGIVEKSGAWFSCDSQRIGQGRE 306

Query: 304 AAKQTLKENPDLREELETKVRE 325
            AKQ L+++P++  ++E +VRE
Sbjct: 307 NAKQFLRDHPEMAADIERRVRE 328


>RECA_TREPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 407

 Score =  311 bits (797), Expect = 6e-87
 Identities = 186/349 (53%), Positives = 230/349 (65%), Gaps = 3/349 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L+    QIE +FG+GS+MK G+      + VIPTG + LD ALGIGG PRGRI+
Sbjct: 16  EEKMKALEAARLQIEKQFGQGSLMKLGKDDAVQGVEVIPTGNILLDEALGIGGYPRGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTLAL  +AEAQ  GGI AFIDAEHALDP YA  LGV + ++ ISQPDTG
Sbjct: 76  EIFGPESSGKTTLALHAVAEAQKRGGIAAFIDAEHALDPQYAKDLGVSVGDLWISQPDTG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI + LVRSG              P+AEI+G++GD  VGL ARLMSQALRKL   +
Sbjct: 136 EQALEIAESLVRSGXXXXXXXXXXXXLTPQAEIQGDMGDAHVGLIARLMSQALRKLTSII 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV-GXX 241
           +KS  T IFINQLR KIG+MFGNPETTTGG ALKF+                 E   G  
Sbjct: 196 NKSKCTLIFINQLRMKIGIMFGNPETTTGGIALKFYSSVRIEVRKVETLSRGDEEAWGNK 255

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+ E ++++G+G S   C++D AV+  + +K GAWY Y EE++GQG
Sbjct: 256 VRIRIVKNKMAPPFRKVETEILFGKGFSAFSCLLDAAVKQEIIEKKGAWYAYREEKIGQG 315

Query: 302 REAAKQTLKENPDLREELETKVRESF--EIPIITRSTEEADAMSPVAKP 348
           R+ A   L++N D+  E+E  VR     +   I+   E   A+S  A P
Sbjct: 316 RDNAVGFLQQNMDITLEIERAVRTKLFPKQAFISSFQEHRPALSLEASP 364


>RECA_TREPA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 407

 Score =  311 bits (797), Expect = 6e-87
 Identities = 186/349 (53%), Positives = 230/349 (65%), Gaps = 3/349 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           EEK K L+    QIE +FG+GS+MK G+      + VIPTG + LD ALGIGG PRGRI+
Sbjct: 16  EEKMKALEAARLQIEKQFGQGSLMKLGKDDAVQGVEVIPTGNILLDEALGIGGYPRGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTLAL  +AEAQ  GGI AFIDAEHALDP YA  LGV + ++ ISQPDTG
Sbjct: 76  EIFGPESSGKTTLALHAVAEAQKRGGIAAFIDAEHALDPQYAKDLGVSVGDLWISQPDTG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI + LVRSG              P+AEI+G++GD  VGL ARLMSQALRKL   +
Sbjct: 136 EQALEIAESLVRSGXXXXXXXXXXXXLTPQAEIQGDMGDAHVGLIARLMSQALRKLTSII 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV-GXX 241
           +KS  T IFINQLR KIG+MFGNPETTTGG ALKF+                 E   G  
Sbjct: 196 NKSKCTLIFINQLRMKIGIMFGNPETTTGGIALKFYSSVRIEVRKVETLSRGDEEAWGNK 255

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+ E ++++G+G S   C++D AV+  + +K GAWY Y EE++GQG
Sbjct: 256 VRIRIVKNKMAPPFRKVETEILFGKGFSAFSCLLDAAVKQEIIEKKGAWYAYREEKIGQG 315

Query: 302 REAAKQTLKENPDLREELETKVRESF--EIPIITRSTEEADAMSPVAKP 348
           R+ A   L++N D+  E+E  VR     +   I+   E   A+S  A P
Sbjct: 316 RDNAVGFLQQNMDITLEIERAVRTKLFPKQAFISSFQEHRPALSLEASP 364


>RECA_STRPZ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  311 bits (797), Expect = 6e-87
 Identities = 177/329 (53%), Positives = 230/329 (69%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L++QPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLAQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     +
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGTTQIKGTGDQKDSSI 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F+ AE ++MYGEGISR G +V +A +  + +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKVAEVEIMYGEGISRTGELVKIASDLDIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L ++P L +E++ KVR  F
Sbjct: 316 GQGSENAKRYLADHPQLFDEIDRKVRVKF 344


>RECA_PARL1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  311 bits (797), Expect = 6e-87
 Identities = 160/301 (53%), Positives = 199/301 (66%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE  FGKGSIM+ G+    + I  + T                    E+YGPESSGKTT
Sbjct: 25  QIERSFGKGSIMRLGKNEQIVEIESVSTXXXXXXXXXXXXXXXXXXXXEIYGPESSGKTT 84

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           LALQ +AEAQ  GG+ AF+DAEHALDP+YA +LGV +D++LISQPDTGEQALEI D LVR
Sbjct: 85  LALQTVAEAQKSGGVCAFVDAEHALDPIYARKLGVQLDDLLISQPDTGEQALEIADTLVR 144

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AE+EGE+GD+  GLQARLMSQALRKL GS+SKSNT  IFINQ
Sbjct: 145 SGAVDVLVIDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTGSISKSNTMVIFINQ 204

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E+VG               
Sbjct: 205 IRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEVVGNQTRVKVVKNKVAPP 264

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+Q EFD+MYGEGIS+ G +VD+  +AG+ +KSG+W++Y  +R+GQGRE AKQ L++NP+
Sbjct: 265 FKQVEFDIMYGEGISKMGELVDLGSKAGIVEKSGSWFSYNSQRIGQGRENAKQFLRDNPE 324

Query: 315 L 315
           +
Sbjct: 325 M 325


>RECA_CAUSK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  311 bits (797), Expect = 6e-87
 Identities = 188/340 (55%), Positives = 238/340 (70%), Gaps = 4/340 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K + L+    QI+  FGKGS+MK GE G  + +  I T              P+GR++E
Sbjct: 16  DKQRALEAALAQIDRAFGKGSVMKLGEKGK-VEMESISTXXXXXXXXXXXXXXPKGRVIE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL ++AE Q  GG  AF+DAEHALDP YA +LGV++D +L+SQPD GE
Sbjct: 75  IYGPESSGKTTLALHVVAECQKAGGTAAFVDAEHALDPGYAFKLGVNLDNLLVSQPDNGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL  S++
Sbjct: 135 QALEITDTLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSLPGLQARLMSQALRKLTASIN 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+NT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 EI      
Sbjct: 195 KANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSIKNRDEIXXXXXX 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR+ EFD+MYGEGIS+ G I+D+ V+AG+  K+G+W++Y  +R+GQGR+
Sbjct: 255 XXXXXXXXAPPFREVEFDIMYGEGISKLGEIIDLGVKAGIIDKAGSWFSYNSQRIGQGRD 314

Query: 304 AAKQTLKENPDLREELETKVRES---FEIPIITRSTEEAD 340
             ++ LK N DL  E+E  VR+S    E  ++    E+ D
Sbjct: 315 NVREFLKVNKDLAAEIEAAVRKSSQKIEEELLVGGPEDGD 354


>RECA_BURS3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  311 bits (797), Expect = 6e-87
 Identities = 164/309 (53%), Positives = 203/309 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M  EKSK       QIE +FGKGSIM+ G+G    NI V+ TG+L LD A          
Sbjct: 1   MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEATENIQVVSTGSLGLDIAXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALD  YAA+LGV++ E+LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 121 TGEQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 TIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YGEGISR+G I+D+ V+A +  K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTL 309
           G++ A++ L
Sbjct: 301 GKDNAREFL 309


>RECA_EHRCR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  311 bits (796), Expect = 7e-87
 Identities = 185/324 (57%), Positives = 233/324 (71%), Gaps = 1/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +N+E+ K L     QIE  FG+G+IMK  +G  +  I  I TG++ LD ALGIGG P+GR
Sbjct: 7   LNQERQKALDSAISQIEKAFGRGAIMKLKQGAIE-KIDSISTGSIALDTALGIGGFPKGR 65

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTLAL +IAE+Q  GG  AFIDAEHALD +YA +LGV+  ++++SQPD
Sbjct: 66  IVEIFGPESSGKTTLALHVIAESQKKGGNCAFIDAEHALDIMYARKLGVNTGDLIVSQPD 125

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQAL I + LV SG              PRAEIEG++GD  +GLQARL+S ALRKL  
Sbjct: 126 TGEQALHIVEYLVCSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHALRKLTS 185

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I+G 
Sbjct: 186 IVSKANCVLIFINQIRMKIGVVYGNPETTTGGNALKFYSSVRLDIRKVSAIKDKDVIIGN 245

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q +FD+MY EGIS+ G I+DM V+  + +K+G++Y+Y   RLGQ
Sbjct: 246 QTXXXXXXXXXAPPFKQVDFDIMYNEGISKVGEIIDMGVKLNIIEKAGSYYSYNSVRLGQ 305

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G+E AK  LK N D   E+E K+R
Sbjct: 306 GKENAKSYLKANCDTAHEIEQKIR 329


>RECA_LACDB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 369

 Score =  310 bits (795), Expect = 9e-87
 Identities = 187/337 (55%), Positives = 240/337 (71%), Gaps = 9/337 (2%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE  FGKG++M+ GE   D  I  +P+G+L LDAALG+GG PRGRIVE+YGPESSGKTT+
Sbjct: 17  IEKNFGKGAVMRMGEKV-DTQISTVPSGSLALDAALGVGGYPRGRIVEIYGPESSGKTTV 75

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
           AL  +AE Q  GG  A+IDAE+A+DP YA  LGVDID++++SQP+TGE+ L+I D L   
Sbjct: 76  ALHAVAEVQKRGGTAAYIDAENAMDPAYAEALGVDIDQLILSQPNTGEEGLQIADTLXXX 135

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
                          PRAEIEGE+GD+ VGLQARLMSQALRKL+G          FINQ+
Sbjct: 136 XXXXXXXXXXXXXLVPRAEIEGEMGDSHVGLQARLMSQALRKLSGXXXXXXXXXXFINQI 195

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           REK+GVMFGNPETT GGRALKF+                                    F
Sbjct: 196 REKVGVMFGNPETTPGGRALKFYSTIRLEVRRAEQIKQSTXXXXXXXXXXXXXXXXAPPF 255

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AE D+MYG+GIS+ G ++DMA +  +  K+GAWY+Y  E++GQGRE AK+ L+E+PD+
Sbjct: 256 KVAEVDIMYGQGISQSGELLDMAADQDIVDKAGAWYSYHGEKIGQGRENAKKYLEEHPDV 315

Query: 316 REELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
            E+++T+VR+++ I        +A+++     P K K
Sbjct: 316 SEDIQTQVRKAYGI--------DAESLEEKEDPEKVK 344


>RECA_STRSV RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 382

 Score =  310 bits (794), Expect = 1e-86
 Identities = 176/326 (53%), Positives = 230/326 (70%), Gaps = 5/326 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG+IM+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERQKALDNALKNIEKDFGKGAIMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPSYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                G+     V
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDEKDTNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGIS+ G ++ +A +  + KK+GAWY+Y +E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIMYGEGISKTGELIKIATDLDIIKKAGAWYSYNDEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVR 324
           GQG E AK+ L ++P++  E++ +VR
Sbjct: 316 GQGSENAKKYLADHPEVFGEIDRQVR 341


>RECA_AZOSB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  310 bits (794), Expect = 1e-86
 Identities = 178/310 (57%), Positives = 220/310 (70%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKGSIM+ G+G  + +I  + T              PRGR+VE+YGPESSGKTT
Sbjct: 15  QIEKQFGKGSIMRMGDGNVEKDIQTVSTXXXXXXXXXXXXXXPRGRVVEIYGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ++AE Q +GG  AFIDAEHALD  YA +LGV+I ++LISQPDTGEQALEI DML  
Sbjct: 75  LTLQVVAEMQKLGGTAAFIDAEHALDVGYAEKLGVNITDLLISQPDTGEQALEIADMLXX 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
                           P+AEIEGE+GD   GLQARLMSQALRKL  ++ ++NT  IFINQ
Sbjct: 135 XXXXXXXXXXXXAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTANIKRTNTLVIFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPETTTGG ALKF+                 E+VG               
Sbjct: 195 IRMKIGVMFGNPETTTGGNALKFYASVRMDIRRTGTIKRGDEVVGSETXXXXXXXXXSPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F++A FD++YGEG+SREG I+D+ V+  +  KSGAWY Y  +++GQG++ A++ L+ NP 
Sbjct: 255 FKEAHFDILYGEGVSREGEIIDLGVDHKIVDKSGAWYAYNGDKIGQGKDNAREFLRANPA 314

Query: 315 LREELETKVR 324
           L  E+E KVR
Sbjct: 315 LAREIENKVR 324


>RECA_LACLS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 387

 Score =  310 bits (793), Expect = 2e-86
 Identities = 177/325 (54%), Positives = 225/325 (69%), Gaps = 5/325 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGS+M+ GE  +   + V+ +G+L LD ALG GG P+GRIVE
Sbjct: 19  ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVE 77

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A  Q  GGI AFIDAE+ALDP YA  LGV+IDE+L+SQPD GE
Sbjct: 78  IYGPESSGKTTVALHAVAAVQKEGGIAAFIDAENALDPEYAKALGVNIDELLLSQPDYGE 137

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q L+I + L+ SG              P+AEI+GEIGD++VGLQAR+MSQA+RKLAG ++
Sbjct: 138 QGLQIAEKLITSGAVDLVVIDSVAALVPKAEIDGEIGDSSVGLQARMMSQAMRKLAGHIN 197

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIVG 239
           K+ TT IFINQLREK+GVMFG+PETT GGRALKF+                         
Sbjct: 198 KTKTTAIFINQLREKVGVMFGSPETTPGGRALKFYASVRLDVRGSTKIEEGSGDXXXXXX 257

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+ A  D+M+GEGIS  G ++++AVE G+ KKSGAW+ Y +E++G
Sbjct: 258 XXXXXXXXXXXXAPPFKVALVDIMFGEGISSTGELLNIAVEEGIIKKSGAWFAYNDEKIG 317

Query: 300 QGREAAKQTLKENPDLREELETKVR 324
           QG E AK  LKE+ D+ +E++ KVR
Sbjct: 318 QGAEKAKNYLKEHQDVFDEIDHKVR 342


>RECA_LACLM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 387

 Score =  310 bits (793), Expect = 2e-86
 Identities = 177/325 (54%), Positives = 225/325 (69%), Gaps = 5/325 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGS+M+ GE  +   + V+ +G+L LD ALG GG P+GRIVE
Sbjct: 19  ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVE 77

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A  Q  GGI AFIDAE+ALDP YA  LGV+IDE+L+SQPD GE
Sbjct: 78  IYGPESSGKTTVALHAVAAVQKEGGIAAFIDAENALDPEYAKALGVNIDELLLSQPDYGE 137

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q L+I + L+ SG              P+AEI+GEIGD++VGLQAR+MSQA+RKLAG ++
Sbjct: 138 QGLQIAEKLITSGAVDLVVIDSVAALVPKAEIDGEIGDSSVGLQARMMSQAMRKLAGHIN 197

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIVG 239
           K+ TT IFINQLREK+GVMFG+PETT GGRALKF+                         
Sbjct: 198 KTKTTAIFINQLREKVGVMFGSPETTPGGRALKFYASVRLDVRGSTKIEEGSGDXXXXXX 257

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+ A  D+M+GEGIS  G ++++AVE G+ KKSGAW+ Y +E++G
Sbjct: 258 XXXXXXXXXXXXAPPFKVALVDIMFGEGISSTGELLNIAVEEGIIKKSGAWFAYNDEKIG 317

Query: 300 QGREAAKQTLKENPDLREELETKVR 324
           QG E AK  LKE+ D+ +E++ KVR
Sbjct: 318 QGAEKAKNYLKEHQDVFDEIDHKVR 342


>RECA_LACLC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 387

 Score =  310 bits (793), Expect = 2e-86
 Identities = 177/325 (54%), Positives = 225/325 (69%), Gaps = 5/325 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGS+M+ GE  +   + V+ +G+L LD ALG GG P+GRIVE
Sbjct: 19  ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVE 77

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A  Q  GGI AFIDAE+ALDP YA  LGV+IDE+L+SQPD GE
Sbjct: 78  IYGPESSGKTTVALHAVAAVQKEGGIAAFIDAENALDPEYAKALGVNIDELLLSQPDYGE 137

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q L+I + L+ SG              P+AEI+GEIGD++VGLQAR+MSQA+RKLAG ++
Sbjct: 138 QGLQIAEKLITSGAVDLVVIDSVAALVPKAEIDGEIGDSSVGLQARMMSQAMRKLAGHIN 197

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIVG 239
           K+ TT IFINQLREK+GVMFG+PETT GGRALKF+                         
Sbjct: 198 KTKTTAIFINQLREKVGVMFGSPETTPGGRALKFYASVRLDVRGSTKIEEGSGDXXXXXX 257

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+ A  D+M+GEGIS  G ++++AVE G+ KKSGAW+ Y +E++G
Sbjct: 258 XXXXXXXXXXXXAPPFKVALVDIMFGEGISSTGELLNIAVEEGIIKKSGAWFAYNDEKIG 317

Query: 300 QGREAAKQTLKENPDLREELETKVR 324
           QG E AK  LKE+ D+ +E++ KVR
Sbjct: 318 QGAEKAKNYLKEHQDVFDEIDHKVR 342


>RECA1_LACLA RecName: Full=Protein recA, chromosomal;AltName:
           Full=Recombinase A;
          Length = 387

 Score =  310 bits (793), Expect = 2e-86
 Identities = 176/325 (54%), Positives = 226/325 (69%), Gaps = 5/325 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L      IE  FGKGS+M+ GE  +   + V+ +G+L LD ALG GG P+GRIVE
Sbjct: 19  ERDKALADALALIEKDFGKGSLMRLGEAANQ-KVSVVSSGSLALDIALGAGGYPKGRIVE 77

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL  +A  Q  GGI AFIDAE+ALDP YA  LGV+IDE+L+SQPD GE
Sbjct: 78  IYGPESSGKTTVALHAVAAVQKEGGIAAFIDAENALDPEYAKALGVNIDELLLSQPDYGE 137

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           Q L+I + L+ SG              P+AEI+GEIGD++VGLQAR+MSQA+RKLAG ++
Sbjct: 138 QGLQIAEKLITSGAVDLVVIDSVAALVPKAEIDGEIGDSSVGLQARMMSQAMRKLAGHIN 197

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIVG 239
           K+ TT IFINQLREK+GVMFG+PETT GGRALKF+                         
Sbjct: 198 KTKTTAIFINQLREKVGVMFGSPETTPGGRALKFYASVRLDVRGSTKIEEGSGDXXXXXX 257

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+ A  D+M+GEGISR G ++++AV+ G+ KKSGAW+ Y +E++G
Sbjct: 258 XXXXXXXXXXXXAPPFKVALVDIMFGEGISRTGELLNIAVDEGIIKKSGAWFAYNDEKIG 317

Query: 300 QGREAAKQTLKENPDLREELETKVR 324
           QG E AK  LKE+ ++ +E++ KVR
Sbjct: 318 QGAEKAKNYLKEHQEIFDEIDHKVR 342


>RECA_STRAG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  309 bits (792), Expect = 2e-86
 Identities = 179/329 (54%), Positives = 227/329 (68%), Gaps = 5/329 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRIV
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRIV 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+AQ  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQAQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+M QA+ KL  S+
Sbjct: 136 EQDLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMMQAMHKLTASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE----IV 238
           +K+ T  IFINQLREK+GVMFGNPETT GGRALKF+                GE     V
Sbjct: 196 NKTKTIAIFINQLREKVGVMFGNPETTPGGRALKFYSSVRLDVRGNTQIKGTGEHKDHNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               FR+A  ++MYGEGISR G ++ +A +  + +K+GAWY+Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFREAFVEIMYGEGISRTGELIKIASDLDIIQKAGAWYSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVRESF 327
           GQG E AK+ L +NP + +E++ KVR  F
Sbjct: 316 GQGSENAKKYLADNPAIFDEIDHKVRVHF 344


>RECA_BURCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  309 bits (792), Expect = 2e-86
 Identities = 163/309 (52%), Positives = 203/309 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M  EKSK       QIE +FGKGSIM+ G+G    +I V+ TG+L LD A          
Sbjct: 1   MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEAAEDIQVVSTGSLGLDIAXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALD  YAA+LGV++ E+LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 121 TGEQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 TIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YGEGISR+G I+D+ V+A +  K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTL 309
           G++ A++ L
Sbjct: 301 GKDNAREFL 309


>RECA_BURCE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  309 bits (792), Expect = 2e-86
 Identities = 163/309 (52%), Positives = 203/309 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M  EKSK       QIE +FGKGSIM+ G+G    +I V+ TG+L LD A          
Sbjct: 1   MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEAAEDIQVVSTGSLGLDIAXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALD  YAA+LGV++ E+LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 121 TGEQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 TIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YGEGISR+G I+D+ V+A +  K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTL 309
           G++ A++ L
Sbjct: 301 GKDNAREFL 309


>RECA_CYTH3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  309 bits (791), Expect = 3e-86
 Identities = 172/327 (52%), Positives = 224/327 (68%), Gaps = 2/327 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L+LT D++E  +GKG++MK  +    +++ VI T              P+GRIVE
Sbjct: 13  EKLKALQLTIDKLEKTYGKGTVMKLSDEVV-MDVPVISTXXXXXXXXXXXXXXPKGRIVE 71

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL++  IAEAQ  GGI AFIDAEHA D  YA +LG+D   +LISQPD GE
Sbjct: 72  IYGPESSGKTTLSMHCIAEAQKAGGIAAFIDAEHAFDKTYAEKLGIDTTNLLISQPDNGE 131

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + L+RSG              P+AEIEGE+GD+ +GLQARLMSQALRKL G+++
Sbjct: 132 QALEIAEHLIRSGXXXXXXXXXXXXLVPKAEIEGEMGDSKMGLQARLMSQALRKLTGAIN 191

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE-IVGXXX 242
           K+   CIFINQLREKIGVMFGNPETTTGG ALKF+                 + I G   
Sbjct: 192 KTGCCCIFINQLREKIGVMFGNPETTTGGNALKFYASVRLDIRRIGQIKESADNITGNRT 251

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+  EFD+MYGEGIS+ G I+D+ VE G+  K+G+W++Y   +LGQGR
Sbjct: 252 KVKVVKNKMAPPFKVIEFDIMYGEGISKIGEIIDLGVELGIINKAGSWFSYEGTKLGQGR 311

Query: 303 EAAKQTLKENPDLREELETKVRESFEI 329
           +A +    +NP++++E+E K+R+  ++
Sbjct: 312 DAVRTVFLDNPEMQDEIELKIRQKVQL 338


>RECA_PSEAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  308 bits (790), Expect = 4e-86
 Identities = 175/325 (53%), Positives = 220/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKQGATCAFVDAEHALDPDYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDAHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V+ G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKVVKNKVSPPFRQAEFQILYGKGIYRTGEIIDLGVQLGLVEKSGAWYSYQGSKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L++NP++   LE  +R+
Sbjct: 300 GKANAAKYLEDNPEIGSVLEKTIRD 324


>RECA_PSEAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  308 bits (790), Expect = 4e-86
 Identities = 175/325 (53%), Positives = 220/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKQGATCAFVDAEHALDPDYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDAHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V+ G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKVVKNKVSPPFRQAEFQILYGKGIYRTGEIIDLGVQLGLVEKSGAWYSYQGSKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L++NP++   LE  +R+
Sbjct: 300 GKANAAKYLEDNPEIGSVLEKTIRD 324


>RECA_PSEA8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  308 bits (790), Expect = 4e-86
 Identities = 175/325 (53%), Positives = 220/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKQGATCAFVDAEHALDPDYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDAHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V+ G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKVVKNKVSPPFRQAEFQILYGKGIYRTGEIIDLGVQLGLVEKSGAWYSYQGSKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L++NP++   LE  +R+
Sbjct: 300 GKANAAKYLEDNPEIGSVLEKTIRD 324


>RECA_PSEA7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  308 bits (790), Expect = 4e-86
 Identities = 175/325 (53%), Positives = 220/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDENKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKQGATCAFVDAEHALDPDYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDAHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V+ G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKVVKNKVSPPFRQAEFQILYGKGIYRTGEIIDLGVQLGLVEKSGAWYSYQGSKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L++NP++   LE  +R+
Sbjct: 300 GKANAAKYLEDNPEIGSVLEKTIRD 324


>RECA_EHRCJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  308 bits (790), Expect = 4e-86
 Identities = 189/347 (54%), Positives = 243/347 (70%), Gaps = 3/347 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +N+E+ K L     QIE  FG+G+IMK  +G  +  I  I TG++ LD ALGIGG P+GR
Sbjct: 7   LNQERQKALDNAISQIEKAFGRGAIMKLKQGAIE-KIDSISTGSIALDTALGIGGFPKGR 65

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE++GPESSGKTTLAL +IAE+Q  GG  AFIDAEHALD +YA +LGV+  ++++SQPD
Sbjct: 66  IVEIFGPESSGKTTLALHVIAESQKKGGNCAFIDAEHALDIMYARKLGVNTGDLIVSQPD 125

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQAL I + LV SG              PRAEIEG++GD  +GLQARL+S ALRKL  
Sbjct: 126 TGEQALHIVEYLVCSGXXXXXXXXXXXXLTPRAEIEGDMGDQHMGLQARLLSHALRKLTS 185

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
            +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I+G 
Sbjct: 186 IVSKANCVLIFINQIRMKIGVVYGNPETTTGGNALKFYSSVRLDIRKVSAIKDKDLIIGN 245

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+Q +FD+MY EGIS+ G I+DM V+  + +K+GA+Y+Y   RLGQ
Sbjct: 246 QTXXXXXXXXXAPPFKQVDFDIMYNEGISKVGEIIDMGVKLNIIEKAGAYYSYNGIRLGQ 305

Query: 301 GREAAKQTLKENPDLREELETKVRE--SFEIPIITRSTEEADAMSPV 345
           G+E AK  LK N    +E+E K+R   + +  +   +TE +D +  V
Sbjct: 306 GKENAKSYLKTNYTTADEIEQKIRNMLASDSDVTCFNTEGSDNLHEV 352


>RECA_RICBR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  308 bits (789), Expect = 5e-86
 Identities = 168/324 (51%), Positives = 217/324 (66%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K +     QIE  +GKGS+MK G+  + ++I  + T              P+GRI
Sbjct: 3   NIDKEKAVAAALAQIEKSYGKGSVMKLGQRPN-VDIESVSTXXXXXXXXXXXXXXPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIIEKSGSWFSYNSVRIGQG 301

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  KQ LK+NP +  E+E  VRE
Sbjct: 302 RENVKQYLKDNPKISNEIEKLVRE 325


>RECA_BURM1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  308 bits (789), Expect = 5e-86
 Identities = 162/309 (52%), Positives = 203/309 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M  EKSK       QIE +FGKGSIM+ G+G    +I V+ TG+L LD A          
Sbjct: 1   MTAEKSKXXXXXXXQIEKQFGKGSIMRMGDGEAAEDIQVVSTGSLGLDIAXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALD  YAA+LGV++ ++LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD+  GLQARLMSQALRKL G
Sbjct: 121 TGEQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTG 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 181 TIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YGEGISR+G I+D+ V+A +  K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQ 300

Query: 301 GREAAKQTL 309
           G++ A++ L
Sbjct: 301 GKDNAREFL 309


>RECA_PSEPW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  308 bits (788), Expect = 6e-86
 Identities = 176/326 (53%), Positives = 221/326 (67%), Gaps = 3/326 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHD-LNIGVIPTGALPLDAALGIGGVPRG 59
           M++ K + L     QIE +FGKG++M+ G+  H+   I  I T              P+G
Sbjct: 1   MDDNKKRALAAALGQIERQFGKGAVMRMGD--HERTGIPAISTXXXXXXXXXXXXXXPKG 58

Query: 60  RIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQP 119
           RIVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQP
Sbjct: 59  RIVEIYGPESSGKTTLTLSVIAEAQKSGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQP 118

Query: 120 DTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLA 179
           DTGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ 
Sbjct: 119 DTGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKIT 178

Query: 180 GSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
           G++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG
Sbjct: 179 GNIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVG 238

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEF ++YG+GI R G I+D+ V  G+ +KSGAWY Y   ++G
Sbjct: 239 SETRVKIVKNKVSPPFRQAEFQILYGKGIYRNGEIIDLGVSQGLVEKSGAWYAYQGNKIG 298

Query: 300 QGREAAKQTLKENPDLREELETKVRE 325
           QG+  A + L+ENP +  E+E ++RE
Sbjct: 299 QGKANAAKYLQENPAIGAEIEKQIRE 324


>RECA_LACDA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 331

 Score =  308 bits (788), Expect = 6e-86
 Identities = 182/310 (58%), Positives = 229/310 (73%), Gaps = 1/310 (0%)

Query: 16  IETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTL 75
           IE  FGKG++M+ GE   D  I  +P+G+L LDAALG+GG PRGRIVE+YGPESSGKTT+
Sbjct: 17  IEKNFGKGAVMRMGEKV-DTQISTVPSGSLALDAALGVGGYPRGRIVEIYGPESSGKTTV 75

Query: 76  ALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRS 135
           AL  +AE Q  GG  A+IDAE+A+DP YA  LGVDID++++SQP+TGE+ L+I D L   
Sbjct: 76  ALHAVAEVQKRGGTAAYIDAENAMDPAYAEALGVDIDQLILSQPNTGEEGLQIADTLXXX 135

Query: 136 GXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQL 195
                          PRAEIEGE+GD+ VGLQARLMSQALRKL+G          FINQ+
Sbjct: 136 XXXXXXXXXXXXXLVPRAEIEGEMGDSHVGLQARLMSQALRKLSGXXXXXXXXXXFINQI 195

Query: 196 REKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXF 255
           REK+GVMFGNPETT GGRALKF+                                    F
Sbjct: 196 REKVGVMFGNPETTPGGRALKFYSTIRLEVRRAEQIKQSTXXXXXXXXXXXXXXXXAPPF 255

Query: 256 RQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDL 315
           + AE D+MYG+GIS+ G ++DMA +  +  K+GAWY+Y  E++GQGRE AK+ L+E+PD+
Sbjct: 256 KVAEVDIMYGQGISQSGELLDMAADQDIVDKAGAWYSYHGEKIGQGRENAKKYLEEHPDV 315

Query: 316 REELETKVRE 325
            E+++T+VR+
Sbjct: 316 SEDIQTQVRK 325


>RECA_STRTD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  307 bits (786), Expect = 1e-85
 Identities = 174/326 (53%), Positives = 229/326 (70%), Gaps = 5/326 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+ Q  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQTQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIV 238
           +K+ T  IFINQLREK+G+MFGNPETT GGRALKF+                G    + V
Sbjct: 196 NKTKTIAIFINQLREKVGIMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDKKDQNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGIS+ G +V +A + G+ +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIMYGEGISQTGELVKIASDIGIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVR 324
           GQG E AK+ L ++P++  E++ KVR
Sbjct: 316 GQGSENAKKYLADHPEIFAEIDHKVR 341


>RECA_STRT2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 384

 Score =  307 bits (786), Expect = 1e-85
 Identities = 174/326 (53%), Positives = 229/326 (70%), Gaps = 5/326 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERRKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+ Q  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQTQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIV 238
           +K+ T  IFINQLREK+G+MFGNPETT GGRALKF+                G    + V
Sbjct: 196 NKTKTIAIFINQLREKVGIMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDKKDQNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGIS+ G +V +A + G+ +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIMYGEGISQTGELVKIASDIGIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVR 324
           GQG E AK+ L ++P++  E++ KVR
Sbjct: 316 GQGSENAKKYLADHPEIFAEIDHKVR 341


>RECA_PSEE4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  307 bits (786), Expect = 1e-85
 Identities = 175/325 (53%), Positives = 220/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKNGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V  G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKIVKNKVSPPFRQAEFQILYGKGIYRNGEIIDLGVAQGLVEKSGAWYSYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L+ENP +  E+E ++RE
Sbjct: 300 GKANAAKYLQENPAIGAEIEKQIRE 324


>RECA_HAHCH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  307 bits (786), Expect = 1e-85
 Identities = 170/325 (52%), Positives = 217/325 (66%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ + K L     QIE +FGKG++M+ GE   ++ I  + T              P GR
Sbjct: 1   MDDNRKKALTAALSQIERQFGKGAVMRMGEQPREI-IPSVSTXXXXXXXXXXXXXXPYGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL LQ+IAEAQ  G   AF+DAEHALDP+YA +LGV+ID++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLQVIAEAQRQGKTCAFVDAEHALDPIYAEKLGVNIDQLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G
Sbjct: 120 TGEQALEIADMLVRSGAVDVIIIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           S+ ++N   IFINQ+R KIGVMFG+PETTTGG ALKF+                      
Sbjct: 180 SVKQANCLMIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRXXXXXXXXXXXXX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QA+F +MYG GI R G I+D+ V+ G   KSGAWY+Y  +++GQ
Sbjct: 240 XTRVKVVKNKVSPPFKQADFQIMYGRGIYRTGEIIDLGVKEGFVDKSGAWYSYKGDKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  + + L+E+P++  E+ET +RE
Sbjct: 300 GKANSSRYLEEHPEIAVEIETAIRE 324


>RECA_AZOVD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  307 bits (786), Expect = 1e-85
 Identities = 174/325 (53%), Positives = 220/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDENKKRALAAALGQIEKQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L  IAEAQ  G   AF+DAEHALDP YAA+LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSTIAEAQKQGATCAFVDAEHALDPDYAAKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDQHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAVKESDEVIGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V+ G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKVVKNKVAPPFRQAEFQILYGKGIYRNGEIIDLGVQLGLLEKSGAWYSYQGSKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L++NP++   +E  +R+
Sbjct: 300 GKANAAKFLEDNPEVAAAVEKSIRD 324


>RECA_THEM4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  306 bits (785), Expect = 1e-85
 Identities = 165/328 (50%), Positives = 210/328 (64%), Gaps = 5/328 (1%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N++K ++LK    +IE  FGKGSIM  GE     NI  I +G++ +D A G+GG PRGRI
Sbjct: 4   NKQKKEVLKKAIGKIEKTFGKGSIMFLGEENAVQNIETISSGSVAIDIASGVGGYPRGRI 63

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE+YGPESSGKTT+AL  IA AQ  GGI AF+DAEHALDPVYA  LGVD++ +LI+QPD 
Sbjct: 64  VEIYGPESSGKTTIALHAIASAQKNGGIAAFVDAEHALDPVYAKNLGVDVENLLIAQPDY 123

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D LVRS               PRAEIEG +GD  VGLQARLMSQALRKLAG+
Sbjct: 124 GEQALEIVDELVRSNAVDLVVIDSVAALVPRAEIEGSMGDVQVGLQARLMSQALRKLAGN 183

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++KS    IFINQ R KIGVM+GNPETTTGG ALKF+                 E +G  
Sbjct: 184 INKSKAVVIFINQTRMKIGVMYGNPETTTGGVALKFYSTMRLEVRSIGKITEGKESIGNQ 243

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTY-----GEE 296
                        F++A  D++YG+GI RE  + ++AV+ G+  + G+W++Y      E 
Sbjct: 244 VRIKFVKNKVAPPFKEAIVDVIYGKGIVRENELFNLAVDEGLISRRGSWFSYVDSTGTEH 303

Query: 297 RLGQGREAAKQTLKENPDLREELETKVR 324
            LGQG+  +   L  +P+L +E+E K+R
Sbjct: 304 SLGQGKNNSLDYLLNHPELLDEIEEKIR 331


>RECA_STRT1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 384

 Score =  306 bits (785), Expect = 1e-85
 Identities = 174/326 (53%), Positives = 229/326 (70%), Gaps = 5/326 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      IE  FGKG++M+ GE      + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERLKALDDALKNIEKDFGKGAVMRLGERAEQ-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+ Q  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQTQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIAGKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIV 238
           +K+ T  IFINQLREK+G+MFGNPETT GGRALKF+                G    + V
Sbjct: 196 NKTKTIAIFINQLREKVGIMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDKKDQNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGIS+ G +V +A + G+ +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIMYGEGISQTGELVKIASDIGIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVR 324
           GQG E AK+ L ++P++  E++ KVR
Sbjct: 316 GQGSENAKKYLADHPEIFAEIDHKVR 341


>RECA_PSEPK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  306 bits (785), Expect = 1e-85
 Identities = 175/325 (53%), Positives = 218/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQ-GIPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKNGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V  G+ +KSGAWY Y   ++GQ
Sbjct: 240 ETRVKIVKNKVSPPFRQAEFQILYGKGIYRNGEIIDLGVSQGLVEKSGAWYAYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L ENP +  E+E ++RE
Sbjct: 300 GKANAAKYLAENPAIGAEIEKQIRE 324


>RECA_PSEPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  306 bits (785), Expect = 1e-85
 Identities = 175/325 (53%), Positives = 218/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDDNKKRALAAALGQIERQFGKGAVMRMGDQERQ-GIPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKNGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V  G+ +KSGAWY Y   ++GQ
Sbjct: 240 ETRVKIVKNKVSPPFRQAEFQILYGKGIYRNGEIIDLGVSQGLVEKSGAWYAYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L ENP +  E+E ++RE
Sbjct: 300 GKANAAKYLAENPAIGAEIEKQIRE 324


>RECA_PSEP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  306 bits (785), Expect = 1e-85
 Identities = 175/325 (53%), Positives = 218/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQ-GIPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKNGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V  G+ +KSGAWY Y   ++GQ
Sbjct: 240 ETRVKIVKNKVSPPFRQAEFQILYGKGIYRNGEIIDLGVSQGLVEKSGAWYAYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L ENP +  E+E ++RE
Sbjct: 300 GKANAAKYLAENPAIGAEIEKQIRE 324


>RECA_METFK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  306 bits (784), Expect = 2e-85
 Identities = 174/343 (50%), Positives = 224/343 (65%), Gaps = 3/343 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E +SK L     QIE +FGKGSIM+ G+     +I  + T              PRGR
Sbjct: 1   MDENRSKALAAALSQIEKQFGKGSIMRMGDTDVAADIQAVSTXXXXXXXXXXXXXXPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IA+ Q +GG  AFIDAEHALDPVYA +LGV++ ++LISQPD
Sbjct: 61  IVEIYGPESSGKTTLTLSVIAQMQKLGGTAAFIDAEHALDPVYAQKLGVNVSDLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKL  
Sbjct: 121 TGEQALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 E+ G 
Sbjct: 181 NIKRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKKGDEVTGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAEFD++Y              V   + +K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNKVAPPFKQAEFDILYXXXXXXXXXXXXXXVNLKLIEKAGAWYSYKGEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI---PIITRSTEEAD 340
           G++ A++ L+E+P++  E++ K+RE   +    + T   EE+D
Sbjct: 301 GKDNAREFLREHPEIANEIDAKIREHSNLANAAMTTAPDEESD 343


>RECA_BURPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  306 bits (784), Expect = 2e-85
 Identities = 161/309 (52%), Positives = 202/309 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +  EKSK       QIE +FGKGSIM+ G+G    +I V+ TG+L LD A          
Sbjct: 10  LTAEKSKXXXXXXXQIEKQFGKGSIMRLGDGEAVEDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALD  YA++LGV++ E+LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 130 TGEQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGN 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YGEGISR+G I+D+ V+A +  K+GAWY+Y  E++GQ
Sbjct: 250 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGEKIGQ 309

Query: 301 GREAAKQTL 309
           G++ A++ L
Sbjct: 310 GKDNAREFL 318


>RECA_BURMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  306 bits (784), Expect = 2e-85
 Identities = 161/309 (52%), Positives = 202/309 (65%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           +  EKSK       QIE +FGKGSIM+ G+G    +I V+ TG+L LD A          
Sbjct: 10  LTAEKSKXXXXXXXQIEKQFGKGSIMRLGDGEAVEDIQVVSTGSLGLDIAXXXXXXXXXX 69

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL LQ+IAE Q +GG  AFIDAEHALD  YA++LGV++ E+LISQPD
Sbjct: 70  XXEIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPD 129

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D LVRSG              P+AEIEGE+GD   GLQARLMSQALRKL G
Sbjct: 130 TGEQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTG 189

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++N   IFINQ+R KIGVMFGNPETTTGG ALKF+                 E++G 
Sbjct: 190 TIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGN 249

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+A FD++YGEGISR+G I+D+ V+A +  K+GAWY+Y  E++GQ
Sbjct: 250 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGEKIGQ 309

Query: 301 GREAAKQTL 309
           G++ A++ L
Sbjct: 310 GKDNAREFL 318


>RECA_PSEST RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  305 bits (782), Expect = 3e-85
 Identities = 179/348 (51%), Positives = 231/348 (66%), Gaps = 9/348 (2%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRG 59
           M+E K + L     QIE +FGKG++M+ G+  HD   I  I T              P+G
Sbjct: 1   MDENKKRALAAALGQIEKQFGKGAVMRMGD--HDRQAIPSISTXXXXXXXXXXXXXXPKG 58

Query: 60  RIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQP 119
           RIVE+YGPESSGKTTL L +IA AQ MG   AF+DAEHALDP YA +LGV++D++L+SQP
Sbjct: 59  RIVEIYGPESSGKTTLTLSVIAAAQRMGSTCAFVDAEHALDPDYAGKLGVNVDDLLVSQP 118

Query: 120 DTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLA 179
           DTGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ 
Sbjct: 119 DTGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDAHVGLQARLMSQALRKIT 178

Query: 180 GSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
           G++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG
Sbjct: 179 GNIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVG 238

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEF ++Y +   R G I+D+ V+ G+ +KSGAWY Y   ++G
Sbjct: 239 SETRVKVVKNKVAPPFRQAEFQILYDQAFYRNGEIIDLGVQQGLVEKSGAWYAYKGSKIG 298

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAK 347
           QG+  A + L+ENP++ +E+E ++R      ++T +  +A   +PVA+
Sbjct: 299 QGKANAAKYLEENPEIGQEIEQQIRAKL---LVTSANTKA---TPVAE 340


>RECA_PSEPU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  305 bits (781), Expect = 4e-85
 Identities = 174/325 (53%), Positives = 218/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDDNKKRALAAALGQIERQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAEAQ  G   AF+DAEHALDP YA +LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSVIAEAQKNGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFG+PETTTGG ALKF+                 E+VG 
Sbjct: 180 NIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V  G+ +KSGAWY Y   ++GQ
Sbjct: 240 ETRVKIVKNKVSPPFRQAEFQILYGKGIYRNGEIIDLGVSQGLVEKSGAWYAYQGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L ENP +  E+E ++R+
Sbjct: 300 GKANAAKYLAENPAIGAEIEKQIRD 324


>RECA_CAMHC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 348

 Score =  305 bits (781), Expect = 4e-85
 Identities = 176/326 (53%), Positives = 224/326 (68%), Gaps = 2/326 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K KML+     I+  FGKG++++ G+   +  I  I TG++ LD ALGIGGVP+GR
Sbjct: 1   MDDNKKKMLESALKSIDKAFGKGTLVRLGDKEVE-KIDSISTGSVGLDIALGIGGVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L IIAE Q  GG+ AF+DAEHALD  YAA LGVD+D + +SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLHIIAECQKKGGVCAFVDAEHALDVKYAANLGVDVDNLYVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQAL+I + L +SG              P++EIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALDIVETLAKSGAIDLVVVDSVAALTPKSEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K  TT IFINQ+R KIG M +G+PETTTGG ALKF+                 E +G
Sbjct: 180 VVHKMGTTVIFINQIRMKIGQMGYGSPETTTGGNALKFYASVRLDIRRIATLKQNDESIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                              EFD+M+GEGIS+ G +VD  V+  +  KSG+W++Y +++LG
Sbjct: 240 NRXXXXXXXXXXXXXXXXXEFDIMFGEGISKMGELVDYGVKLDIVDKSGSWFSYKDKKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRE 325
           QGRE AK  LKENP + +E+   +RE
Sbjct: 300 QGRENAKIYLKENPKVADEILAAIRE 325


>RECA_BORDL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  305 bits (781), Expect = 4e-85
 Identities = 178/329 (54%), Positives = 225/329 (68%), Gaps = 3/329 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K ++L   QIE  FGKGS++K GE      +  IP+G++ LD A+GIGG PRGR+VE+
Sbjct: 18  KEKAIELARVQIEKDFGKGSLIKMGESPVGKYLESIPSGSILLDEAIGIGGYPRGRVVEI 77

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ IAE Q  GGI AFIDAEHALDPVYA  LGV+I+E+ +SQPDTGEQ
Sbjct: 78  FGPESSGKTTLTLQAIAEIQKTGGIAAFIDAEHALDPVYARALGVNINELWLSQPDTGEQ 137

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           AL+I + L+RSG              P+AEI+GE+GDT +GLQARLMS+ALRK+   LSK
Sbjct: 138 ALDIAEYLIRSGGVDLIVVDSVAALTPQAEIDGEMGDTQIGLQARLMSKALRKITAILSK 197

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE--IVGXXX 242
           SNT  +FINQ+R KIG++FG+PETTTGG ALKF+                          
Sbjct: 198 SNTCIMFINQIRMKIGLVFGSPETTTGGNALKFYSSLRLEVRKVEQVIGSSSDXXXXXXX 257

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR+AE  + +G+GISRE  I+D A++  + +KSG+WY  G++ LGQGR
Sbjct: 258 XXXXXXXXXAPPFRKAELIVYFGKGISREASILDAAIKYNLVQKSGSWYAMGDDNLGQGR 317

Query: 303 EAAKQTLKENPDLREELETKVRE-SFEIP 330
           E   + L +   L  ELE K+R+  FE P
Sbjct: 318 ENVIEYLFKEKALANELENKLRKIIFESP 346


>RECA_HELPH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  305 bits (780), Expect = 5e-85
 Identities = 174/327 (53%), Positives = 222/327 (67%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD + +L+SQPD
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDIRRIAALKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGRE               +  K++ES
Sbjct: 302 QGRENXXXXXXXXXXXXXXITLKIKES 328


>RECA_AZOVI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  305 bits (780), Expect = 5e-85
 Identities = 173/325 (53%), Positives = 219/325 (67%), Gaps = 1/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K + L     QIE +FGKG++M+ G+      I  I T              P+GR
Sbjct: 1   MDENKKRALAAALGQIEKQFGKGAVMRMGDHERQA-IPAISTXXXXXXXXXXXXXXPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L  IAEAQ  G   AF+DAEHALDP YAA+LGV++D++L+SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLSTIAEAQKQGATCAFVDAEHALDPDYAAKLGVNVDDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRS               P+AEIEGE+GD  VGLQARLMSQALRK+ G
Sbjct: 120 TGEQALEITDMLVRSNXXXXXXXXXXXXXXPKAEIEGEMGDQHVGLQARLMSQALRKITG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++  +N   IFINQ+R KIGVMFGNPETTTG  ALKF+                 E++G 
Sbjct: 180 NIQNANCLVIFINQIRMKIGVMFGNPETTTGANALKFYASVRLDIRRTGAVKESDEVIGS 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FRQAEF ++YG+GI R G I+D+ V+ G+ +KSGAWY+Y   ++GQ
Sbjct: 240 ETRVKVVKNKVAPPFRQAEFQILYGKGIYRNGEIIDLGVQLGLLEKSGAWYSYQGSKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+  A + L++NP++   +E  +R+
Sbjct: 300 GKANAAKFLEDNPEVAAAVEKSIRD 324


>RECA_WOLTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  304 bits (779), Expect = 7e-85
 Identities = 172/324 (53%), Positives = 221/324 (68%), Gaps = 1/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           + ++ K L     QIE  FGKG+IMK  +   +  I  I TG++ LD+ALG+GG+P+GRI
Sbjct: 9   SNDRQKALDNAISQIEKAFGKGAIMKLKQNPVE-KIDTISTGSIALDSALGVGGLPKGRI 67

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE++GPESSGKTTLAL +IAEAQ  GG+ AFIDAEHALD +YA +LGV+ D ++ISQPDT
Sbjct: 68  VEIFGPESSGKTTLALHVIAEAQKKGGLCAFIDAEHALDVMYARKLGVNTDNLVISQPDT 127

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQAL I + L                  PRAEIEG++GD  VGLQARL+S  LRKL  +
Sbjct: 128 GEQALHIVEYLXXXXXXXXXXXXXXXXLTPRAEIEGDMGDQHVGLQARLLSHGLRKLTSA 187

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           +SK+N   IFINQ+R KIGV++GNPETTTGG ALKF+                  I G  
Sbjct: 188 VSKANCILIFINQIRMKIGVVYGNPETTTGGNALKFYTSVRLDIRKVGAIKDKESIKGNE 247

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A+FD+MY EG+S+ G I+D+  + GV +K+GA+Y+Y   RLGQG
Sbjct: 248 TRVKVVKNKVAPPFREAKFDIMYNEGVSKLGEIIDIGAKLGVLEKAGAYYSYNNTRLGQG 307

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE  K   K N ++  E+E K+R+
Sbjct: 308 RENVKNYFKANKEVANEVEAKIRD 331


>RECA_SYNP6 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  304 bits (779), Expect = 7e-85
 Identities = 185/326 (56%), Positives = 222/326 (68%), Gaps = 2/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L L   QIE  FGKG+IM+ G+    L +  I +              P+GRI+E
Sbjct: 11  EKEKALNLVLSQIERNFGKGAIMRLGDAAR-LRVETI-SXXXXXXXXXXXXXXPKGRIIE 68

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GGI AF+DAEHALDPVYA  +GVDID +LISQPDTGE
Sbjct: 69  VYGPESSGKTTLTLHAIAEVQKQGGIAAFVDAEHALDPVYATSVGVDIDNLLISQPDTGE 128

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVR                PRAEIEGE+GD  VGLQARLMSQA+RK+ G++ 
Sbjct: 129 MALEIVDQLVRXXXXXXXXXXXXXXLVPRAEIEGEMGDAQVGLQARLMSQAMRKITGNIG 188

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR+KIGV +G+PETTTGG+ALKF+                 E  G    
Sbjct: 189 KSGCTVIFLNQLRQKIGVTYGSPETTTGGQALKFYASVRLDIRRIQTLKKGTEEYGTRAX 248

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GIS  GC+VD+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 249 XXXXXXXXAPPFRIAEFDILFGKGISTLGCLVDLAEETGVILRKGAWYSYNGDNIGQGRD 308

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
                L+E+PD R  +E +VRE   +
Sbjct: 309 NTITHLEEHPDFRATVEQQVREKLAL 334


>RECA_SYNE7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  304 bits (779), Expect = 7e-85
 Identities = 185/326 (56%), Positives = 222/326 (68%), Gaps = 2/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L L   QIE  FGKG+IM+ G+    L +  I +              P+GRI+E
Sbjct: 11  EKEKALNLVLSQIERNFGKGAIMRLGDAAR-LRVETI-SXXXXXXXXXXXXXXPKGRIIE 68

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GGI AF+DAEHALDPVYA  +GVDID +LISQPDTGE
Sbjct: 69  VYGPESSGKTTLTLHAIAEVQKQGGIAAFVDAEHALDPVYATSVGVDIDNLLISQPDTGE 128

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVR                PRAEIEGE+GD  VGLQARLMSQA+RK+ G++ 
Sbjct: 129 MALEIVDQLVRXXXXXXXXXXXXXXLVPRAEIEGEMGDAQVGLQARLMSQAMRKITGNIG 188

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR+KIGV +G+PETTTGG+ALKF+                 E  G    
Sbjct: 189 KSGCTVIFLNQLRQKIGVTYGSPETTTGGQALKFYASVRLDIRRIQTLKKGTEEYGTRAX 248

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GIS  GC+VD+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 249 XXXXXXXXAPPFRIAEFDILFGKGISTLGCLVDLAEETGVILRKGAWYSYNGDNIGQGRD 308

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
                L+E+PD R  +E +VRE   +
Sbjct: 309 NTITHLEEHPDFRATVEQQVREKLAL 334


>RECA_CHLAB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  304 bits (779), Expect = 7e-85
 Identities = 170/304 (55%), Positives = 213/304 (70%), Gaps = 1/304 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+     IE +FG GSIM  G+      I  I TGAL LD ALGIGGVP+GRIVE
Sbjct: 5   DRKKALEAAIAYIEKQFGSGSIMSLGKHSASHEISTIKTGALSLDLALGIGGVPKGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTLA  I+A AQ MGG+ A+IDAEHALDP YA+ +G +I +++ISQPD GE
Sbjct: 65  IFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHALDPSYASLIGANIHDLMISQPDCGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            AL I ++L RSG              P++E+EG+IGD  VGLQAR+MSQALRKL  +L+
Sbjct: 125 DALSIAELLARSGXXXXXXXXXXXXXXPKSELEGDIGDVHVGLQARMMSQALRKLTATLA 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEI-VGXXX 242
           +S T  IFINQ+REKIGV FGNPETTTGGRALKF+                    +G   
Sbjct: 185 RSQTCAIFINQIREKIGVSFGNPETTTGGRALKFYSSIRIDIRRIGAIKGNESFDLGNRI 244

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F+ AEFD+++ EGIS  GCI+D+AVE  + +K G+W+ Y + +LGQGR
Sbjct: 245 KVKVAKNKLAPPFKTAEFDILFNEGISSAGCILDLAVEHNIVEKKGSWFNYQDRKLGQGR 304

Query: 303 EAAK 306
           EA +
Sbjct: 305 EAVR 308


>RECA_ACIF5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  304 bits (779), Expect = 7e-85
 Identities = 161/324 (49%), Positives = 206/324 (63%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E++SK L     QI+ +FGKG++M+ G+     +I V  T                  
Sbjct: 1   MDEQRSKALSAALSQIDKQFGKGAVMRLGDHNAIKDIEVYSTXXXXXXXXXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL L  IA  QA GG  AFIDAEHALDP YA +LGVD++ +LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLHAIASCQAAGGTAAFIDAEHALDPGYAHKLGVDLENLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++S++NT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG 
Sbjct: 181 NISRTNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKKSDEVVGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+AEF + YGEGISR   +VD+ V+  + +KSGAWY+Y  ER+GQ
Sbjct: 241 DTRVKVVKNKVAPPFREAEFAIYYGEGISRLSELVDLGVKFDIVEKSGAWYSYQGERIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++ A+Q LKE+P+L   +E ++R
Sbjct: 301 GKDNARQYLKEHPELAANIEQRIR 324


>RECA_ACIF2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  304 bits (779), Expect = 7e-85
 Identities = 161/324 (49%), Positives = 206/324 (63%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E++SK L     QI+ +FGKG++M+ G+     +I V  T                  
Sbjct: 1   MDEQRSKALSAALSQIDKQFGKGAVMRLGDHNAIKDIEVYSTXXXXXXXXXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL L  IA  QA GG  AFIDAEHALDP YA +LGVD++ +LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLHAIASCQAAGGTAAFIDAEHALDPGYAHKLGVDLENLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEG++GD+ VGLQARLMSQALRKL  
Sbjct: 121 TGEQALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++S++NT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG 
Sbjct: 181 NISRTNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKKSDEVVGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+AEF + YGEGISR   +VD+ V+  + +KSGAWY+Y  ER+GQ
Sbjct: 241 DTRVKVVKNKVAPPFREAEFAIYYGEGISRLSELVDLGVKFDIVEKSGAWYSYQGERIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++ A+Q LKE+P+L   +E ++R
Sbjct: 301 GKDNARQYLKEHPELAANIEQRIR 324


>RECA_HELPY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  304 bits (778), Expect = 9e-85
 Identities = 174/327 (53%), Positives = 222/327 (67%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDSISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD + +L+SQPD
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDIRRIASLKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGRE               +  K++ES
Sbjct: 302 QGRENXXXXXXXXXXXXXXITLKIKES 328


>RECA_HELPG RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  304 bits (778), Expect = 9e-85
 Identities = 174/327 (53%), Positives = 221/327 (67%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD   +L+SQPD
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVHYAKRLGVDTQNLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDIRRIASLKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGRE               +  K++ES
Sbjct: 302 QGRENXXXXXXXXXXXXXXITLKIKES 328


>RECA_STRTR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  303 bits (777), Expect = 1e-84
 Identities = 173/326 (53%), Positives = 229/326 (70%), Gaps = 5/326 (1%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           +E+ K L      I   FGKG++M+ GE   +  + V+ +G+L LD ALG GG P+GRI+
Sbjct: 17  DERWKALDDALKNIGKDFGKGAVMRLGERAEE-KVQVMSSGSLALDIALGAGGYPKGRII 75

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTT+AL  +A+ Q  GGI AFIDAEHALDP YAA LGV+IDE+L+SQPD+G
Sbjct: 76  EIYGPESSGKTTVALHAVAQTQKEGGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSG 135

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQ LEI   L+                 PRAEI+G+IGD+ VGLQAR+MSQA+RKL+ S+
Sbjct: 136 EQGLEIACKLIXXXXXXXXXXXXXXXXXPRAEIDGDIGDSHVGLQARMMSQAMRKLSASI 195

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG----EIV 238
           +K+ T  IFINQLREK+G+MFGNPETT GGRALKF+                G    + V
Sbjct: 196 NKTKTIAIFINQLREKVGIMFGNPETTPGGRALKFYAYVALDVRGNTQIKGTGDKKDQNV 255

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERL 298
           G               F++A  ++MYGEGIS+ G +V +A + G+ +K+GAW++Y  E++
Sbjct: 256 GKETKIKVVKNKVAPPFKEAFVEIMYGEGISQTGELVKIASDIGIIQKAGAWFSYNGEKI 315

Query: 299 GQGREAAKQTLKENPDLREELETKVR 324
           GQG E AK+ L ++P++  E++ KVR
Sbjct: 316 GQGSENAKKYLADHPEIFAEIDHKVR 341


>RECA_PHOPR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  303 bits (777), Expect = 1e-84
 Identities = 158/331 (47%), Positives = 208/331 (62%), Gaps = 1/331 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L     QIE +FGKGSIM+ G+    ++I  + T              P GR
Sbjct: 1   MDDNKQKALAAALGQIEKQFGKGSIMRLGDN-KTMDIETVSTXXXXXXXXXXXXXXPMGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L++IA AQ  G   AFIDAEHALDP+YA +LGVDID++L SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLEVIASAQKAGKTCAFIDAEHALDPIYAQKLGVDIDQLLCSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI D L RSG              P+AEIEGE+GD+ +GLQAR++SQA+RKL G
Sbjct: 120 TGEQALEIVDALARSGAVDLIVVDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L  +N  CIFINQ+R KIGVMFGNPETTTGG ALKF+                 E+VG 
Sbjct: 180 NLKNANCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGDEVVGN 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+QAE  ++YG+G +R G ++D+ V+  + +K+GAWY+Y   ++GQ
Sbjct: 240 ETRIKVVKNKIAAPFKQAETQILYGQGFNRNGELIDLGVKHKLVEKAGAWYSYKGNKIGQ 299

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPI 331
           G+  + + L ENP + EE+E  +R+    P+
Sbjct: 300 GKANSCKHLVENPAIAEEIEKLLRDMLLSPV 330


>RECA_OENOB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 376

 Score =  303 bits (777), Expect = 1e-84
 Identities = 178/331 (53%), Positives = 221/331 (66%), Gaps = 3/331 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M   +   L     +IE  FGKGSIM+ GE  H   + VI TG+L LD ALG+GG P+GR
Sbjct: 1   MASGRKAALDAALKKIEKDFGKGSIMRLGENVHT-QVDVISTGSLKLDIALGVGGYPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+EV+GPESSGKTT+AL   AE Q  GG  A+IDAE++LD  YA  LGV++D++L+SQPD
Sbjct: 60  IIEVFGPESSGKTTVALHAAAEVQKQGGTAAYIDAENSLDAKYAQALGVNVDDLLLSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQ LEI D LV SG              PRAEIEGE+GD+ VGLQARLMSQALRKLAG
Sbjct: 120 TGEQGLEIADDLVNSGAIDLLVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKLAG 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           +L+++ T  IFINQ+REKIG+MFGNPETT GGRALKF+                      
Sbjct: 180 TLNRTGTIAIFINQIREKIGIMFGNPETTPGGRALKFYSTVRLEVRRSAQIKDGTXXXXX 239

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AE D+MYG+GIS+ G ++D+AV+  +  KSGAWY Y  E++GQ
Sbjct: 240 XXXXXXXXXXXAPPFKVAEVDIMYGKGISQTGELIDLAVDKDIINKSGAWYAYQGEKIGQ 299

Query: 301 GREAAKQTL--KENPDLREELETKVRESFEI 329
           GR  A   L   E+    +E+ T VR+ + I
Sbjct: 300 GRVNAISWLDSPEHKKEHDEIFTSVRDQYGI 330


>RECA_BORHE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  303 bits (776), Expect = 2e-84
 Identities = 177/329 (53%), Positives = 223/329 (67%), Gaps = 3/329 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           + K ++L   QIE  FGKGS++K GE                LD A+G+GG PRGRI+E+
Sbjct: 18  REKAIELARVQIEKDFGKGSLIKMGESPVXXXXXXXXXXXXLLDEAIGVGGYPRGRIIEI 77

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ IAE Q  GGI AFIDAEHALDP YA  LGV+IDE+ ISQPDTGEQ
Sbjct: 78  FGPESSGKTTLTLQAIAEVQKNGGIAAFIDAEHALDPAYAKALGVNIDELWISQPDTGEQ 137

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI + L+RSG              P+AEI+GE+GD+ +GLQARLMS+ALRK+ G LSK
Sbjct: 138 ALEIAEYLIRSGGVDLIVVDSVAALTPQAEIDGEMGDSQIGLQARLMSKALRKITGILSK 197

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG--EIVGXXX 242
           SNT  +FINQLR KIGVMFGNPETTTGG ALKF+                   +      
Sbjct: 198 SNTCIMFINQLRMKIGVMFGNPETTTGGNALKFYSSLRLEVRKIDQVTGSSADDXXXXXX 257

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR+ E  + +G+GISRE  I+D +V+  + +K+G+WY+ G+++LGQGR
Sbjct: 258 XXXXXXXXXAPPFRKVELVIYFGKGISREASILDASVKYNLIQKTGSWYSMGDDKLGQGR 317

Query: 303 EAAKQTLKENPDLREELETKVRE-SFEIP 330
           E A   L +  ++ +ELE+K+R+  FE P
Sbjct: 318 EHAVSYLVKEKEVTDELESKLRKIIFEDP 346


>RECA_BORHD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  303 bits (776), Expect = 2e-84
 Identities = 177/329 (53%), Positives = 223/329 (67%), Gaps = 3/329 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           + K ++L   QIE  FGKGS++K GE                LD A+G+GG PRGRI+E+
Sbjct: 18  REKAIELARVQIEKDFGKGSLIKMGESPVXXXXXXXXXXXXLLDEAIGVGGYPRGRIIEI 77

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ IAE Q  GGI AFIDAEHALDP YA  LGV+IDE+ ISQPDTGEQ
Sbjct: 78  FGPESSGKTTLTLQAIAEVQKNGGIAAFIDAEHALDPAYAKALGVNIDELWISQPDTGEQ 137

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI + L+RSG              P+AEI+GE+GD+ +GLQARLMS+ALRK+ G LSK
Sbjct: 138 ALEIAEYLIRSGGVDLIVVDSVAALTPQAEIDGEMGDSQIGLQARLMSKALRKITGILSK 197

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG--EIVGXXX 242
           SNT  +FINQLR KIGVMFGNPETTTGG ALKF+                   +      
Sbjct: 198 SNTCIMFINQLRMKIGVMFGNPETTTGGNALKFYSSLRLEVRKIDQVTGSSADDXXXXXX 257

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR+ E  + +G+GISRE  I+D +V+  + +K+G+WY+ G+++LGQGR
Sbjct: 258 XXXXXXXXXAPPFRKVELVIYFGKGISREASILDASVKYNLIQKTGSWYSMGDDKLGQGR 317

Query: 303 EAAKQTLKENPDLREELETKVRE-SFEIP 330
           E A   L +  ++ +ELE+K+R+  FE P
Sbjct: 318 EHAVSYLVKEKEVTDELESKLRKIIFEDP 346


>RECA_PSYWF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  302 bits (774), Expect = 3e-84
 Identities = 155/299 (51%), Positives = 194/299 (64%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGK +IM  G+    L++ V+ T              P+GRI+E+YGPESSGKTT
Sbjct: 15  QIEKQFGKNTIMHLGDNSATLDVDVVSTXXXXXXXXXXXXXXPKGRIIEIYGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L LQ IAE Q  GG  AFIDAEHALDP+YA +LGV+ D++L+SQPD GEQALEI DMLVR
Sbjct: 75  LTLQAIAECQKQGGTCAFIDAEHALDPIYARKLGVNTDDLLVSQPDNGEQALEITDMLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              PRAEIEGE+GD+ +GLQARLMSQALRK+ G+  +SN   IFINQ
Sbjct: 135 SGALDMIVIDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNAKRSNCMVIFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 EI+G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKSGDEIIGNQTRVKVIKNKMAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
           FRQAEF++ YGEG +    ++D+ VE GV  K+GAWY+YG+E++GQG+  +   LK+NP
Sbjct: 255 FRQAEFEITYGEGTNHLAEVIDLGVEIGVVGKAGAWYSYGDEKIGQGKANSVLFLKDNP 313


>RECA_METFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 344

 Score =  302 bits (774), Expect = 3e-84
 Identities = 172/343 (50%), Positives = 223/343 (65%), Gaps = 3/343 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E +SK L     QIE +FGKGSIM+ G+     +I  + T              PRGR
Sbjct: 1   MDENRSKALAAALSQIEKQFGKGSIMRMGDTDVAADIQAVSTXXXXXXXXXXXXXXPRGR 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IA+ Q +GG  AFIDAEHALDPVYA +LGV++ ++LISQPD
Sbjct: 61  IVEIYGPESSGKTTLTLSVIAQMQKLGGTAAFIDAEHALDPVYAQKLGVNVSDLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD+ +GLQARLMSQALRKL  
Sbjct: 121 TGEQALEIADMLVRSGXXXXXXXXXXXXLTPKAEIEGEMGDSHMGLQARLMSQALRKLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++ ++NT  IFINQ+R KIG+MFGNPETTTGG ALKF+                 E+ G 
Sbjct: 181 NIKRTNTLVIFINQIRMKIGLMFGNPETTTGGNALKFYASVRLDIRRTGAIKKGDEVTGS 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         F+ AEFD++Y              V   + +K+GAWY+Y  E++GQ
Sbjct: 241 ETRVKVVKNNVAPPFKLAEFDILYXXXXXXXXXXXXXXVNLKLIEKAGAWYSYKGEKIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI---PIITRSTEEAD 340
           G++ A++ L+E+P++  E++ K+RE   +    + T   EE+D
Sbjct: 301 GKDNAREFLREHPEIANEIDAKIREHSNLANAAMTTAPDEESD 343


>RECA_HELP2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  302 bits (773), Expect = 3e-84
 Identities = 172/327 (52%), Positives = 221/327 (67%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD + +L+SQP 
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVYYAKRLGVDTENLLVSQPS 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGE+ALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEEALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDIRRIASLKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGRE               +  K++ES
Sbjct: 302 QGRENXXXXXXXXXXXXXXITLKIKES 328


>RECA_RICM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  301 bits (772), Expect = 4e-84
 Identities = 163/312 (52%), Positives = 210/312 (67%), Gaps = 1/312 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K + +     QIE  +GKGS+MK G+  H ++I  + T              P+GRI
Sbjct: 3   NTDKERAIAAALAQIEKSYGKGSVMKLGQRPH-VDIEAVSTXXXXXXXXXXXXXXPKGRI 61

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E++GPESSGKTTL L +IAEAQ  GG  AFIDAEHALDP YA +LGV+IDE++ISQPDT
Sbjct: 62  IEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELIISQPDT 121

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GEQALEI D L+RSG              P++EIEGE+GD  +  QARLMSQALRKL  S
Sbjct: 122 GEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALRKLTAS 181

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           ++++N   +FINQ+R KIGVMFG+PETTTGG ALKF+                 E++G  
Sbjct: 182 INRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEEVIGSQ 241

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        F+ A+FD+MYG GIS+EG I+D+ V+  + +KSG+W++Y   R+GQG
Sbjct: 242 TXXXXXXXXXSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYKNVRIGQG 301

Query: 302 REAAKQTLKENP 313
           RE  KQ LKE+P
Sbjct: 302 RENVKQYLKEHP 313


>RECA_HELPS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  301 bits (772), Expect = 4e-84
 Identities = 173/327 (52%), Positives = 221/327 (67%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKIFGKGALVRLGDKQVE-KIDSISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD + +L+SQPD
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDIRRIAALKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGR                +  K++ES
Sbjct: 302 QGRXXXXXXXXXXXXXXXXITLKIKES 328


>RECA_BORBZ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  301 bits (772), Expect = 4e-84
 Identities = 171/324 (52%), Positives = 223/324 (68%), Gaps = 3/324 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K + ++L   QIE  FGKGS++K GE      I  + +G++ LD ALGIGG PRGRI+E+
Sbjct: 20  KEEAIELARVQIEKAFGKGSLIKMGESPVGQGIKSMSSGSIVLDEALGIGGYPRGRIIEI 79

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ IAE Q  GGI AFIDAEHALDPVYA  LGV++ E+ +SQPDTGEQ
Sbjct: 80  FGPESSGKTTLTLQAIAEVQKEGGIAAFIDAEHALDPVYAKALGVNVAELWLSQPDTGEQ 139

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI + L+RSG              P+ EI+GE+GD+ +GLQARLMS+ALRK+ G LSK
Sbjct: 140 ALEIAEHLIRSGGVDLIVVDSVAALTPKLEIDGEMGDSQIGLQARLMSKALRKITGILSK 199

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG---EIVGXX 241
           SNT  +FINQ+R +IGVMFGNPETTTGG ALKF+                G   +     
Sbjct: 200 SNTCIMFINQIRMRIGVMFGNPETTTGGNALKFYSSLRLEVRKIEQVTRSGSSDDXXXXX 259

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+ E  + +G+GISRE  I+D A++  + +K+G+WY+ G+ +LGQG
Sbjct: 260 XXXXXXXXXXAPPFRKVELIIYFGKGISREAGILDAAIKHNLIQKTGSWYSLGDNKLGQG 319

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE+  + L +  +L   L+ ++R+
Sbjct: 320 RESVIEYLSKEVELANNLDKRLRK 343


>RECA_BORBU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  301 bits (772), Expect = 4e-84
 Identities = 171/324 (52%), Positives = 223/324 (68%), Gaps = 3/324 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K + ++L   QIE  FGKGS++K GE      I  + +G++ LD ALGIGG PRGRI+E+
Sbjct: 20  KEEAIELARVQIEKAFGKGSLIKMGESPVGQGIKSMSSGSIVLDEALGIGGYPRGRIIEI 79

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ IAE Q  GGI AFIDAEHALDPVYA  LGV++ E+ +SQPDTGEQ
Sbjct: 80  FGPESSGKTTLTLQAIAEVQKEGGIAAFIDAEHALDPVYAKALGVNVAELWLSQPDTGEQ 139

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI + L+RSG              P+ EI+GE+GD+ +GLQARLMS+ALRK+ G LSK
Sbjct: 140 ALEIAEHLIRSGGVDLIVVDSVAALTPKLEIDGEMGDSQIGLQARLMSKALRKITGILSK 199

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG---EIVGXX 241
           SNT  +FINQ+R +IGVMFGNPETTTGG ALKF+                G   +     
Sbjct: 200 SNTCIMFINQIRMRIGVMFGNPETTTGGNALKFYSSLRLEVRKIEQVTRSGSSDDXXXXX 259

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+ E  + +G+GISRE  I+D A++  + +K+G+WY+ G+ +LGQG
Sbjct: 260 XXXXXXXXXXAPPFRKVELIIYFGKGISREAGILDAAIKHNLIQKTGSWYSLGDNKLGQG 319

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE+  + L +  +L   L+ ++R+
Sbjct: 320 RESVIEYLSKEVELANNLDKRLRK 343


>RECA_HELAH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  301 bits (771), Expect = 6e-84
 Identities = 171/327 (52%), Positives = 219/327 (66%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDSISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD + +L+SQPD
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDIRRIAALKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRAXXXXXXXXXAPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGR                +  K++ES
Sbjct: 302 QGRXXXXXXXXXXXXXXXXIILKIKES 328


>RECA_DESVM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  300 bits (769), Expect = 1e-83
 Identities = 170/301 (56%), Positives = 209/301 (69%), Gaps = 2/301 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E + + L      IE K+G+GS+MK  +  H +NI VIPTG++ LD ALG+GG+PRGR+ 
Sbjct: 11  EMRREALSTALSTIERKYGQGSVMKLSDTAH-VNIPVIPTGSIGLDLALGVGGIPRGRVS 69

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTLAL IIAE Q +GG  AFIDAEHALD  YA RLGV  DE+LISQPD G
Sbjct: 70  EIYGPESSGKTTLALHIIAECQKLGGTAAFIDAEHALDTNYARRLGVKTDELLISQPDFG 129

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQAL+I DMLVR                P+AE+EG +G+  VG QARLMS ALRKL G++
Sbjct: 130 EQALDIADMLVRXXXXXXXXXXXXXXLIPQAELEGVMGEMQVGGQARLMSHALRKLTGTI 189

Query: 183 SKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
            KS T  IFINQ+R KIG M +GNPETTTGG ALKF+                 E+ G  
Sbjct: 190 HKSRTAVIFINQIRMKIGTMGYGNPETTTGGNALKFYSSIRMDIRKIQTLKDKEEVYGSR 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A FD++YG GISR G ++D+  + G+ +KSG+W+ +G ERLGQG
Sbjct: 250 TRVKVVKNKVAPPFREALFDILYGTGISRTGELIDLGSDVGIIEKSGSWFAFGSERLGQG 309

Query: 302 R 302
           +
Sbjct: 310 K 310


>RECA_PSEU2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  300 bits (768), Expect = 1e-83
 Identities = 178/336 (52%), Positives = 224/336 (66%), Gaps = 9/336 (2%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ MG   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G IVD+AV  G  +KSGAWY+Y   ++GQG+  + + L +NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEIVDLAVLHGFVEKSGAWYSYQGSKIGQGKANSAKFLADNP 312

Query: 314 DLREELETKVRESFEIP------IITRSTEEADAMS 343
           ++ + LE ++R+    P      + +R    AD MS
Sbjct: 313 EICKALEKQIRDKLLTPGVDTKAVGSREAVAADDMS 348


>RECA_HELPJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 347

 Score =  300 bits (767), Expect = 2e-83
 Identities = 171/327 (52%), Positives = 220/327 (67%), Gaps = 2/327 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E+K K + L   QI+  FGKG++++ G+   +  I  I TG+L LD ALGIGGVP+GR
Sbjct: 3   IDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVE-KIDAISTGSLGLDLALGIGGVPKGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTL+L IIAE Q  GG+ AFIDAEHALD  YA RLGVD + +L+SQP 
Sbjct: 62  IIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDVYYAKRLGVDTENLLVSQPS 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGE+ALEI + + RSG              P+AEI+G++GD  VGLQARLMS ALRK+ G
Sbjct: 122 TGEEALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGLQARLMSHALRKITG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+  +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTLIFINQIRMKIGMTGYGSPETTTGGNALKFYASVRIDIRRIAALKQNEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG I+D  V+  +  KSGAW +Y +++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISKEGEIIDYGVKLDIVDKSGAWLSYQDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKVRES 326
           QGRE               +  K++ES
Sbjct: 302 QGRENXXXXXXXXXXXXXXITLKIKES 328


>RECAM_DICDI RecName: Full=Mitochondrial DNA repair protein recA
           homolog;AltName: Full=Recombinase A homolog;
          Length = 452

 Score =  300 bits (767), Expect = 2e-83
 Identities = 158/327 (48%), Positives = 210/327 (64%), Gaps = 3/327 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           ++E  FGKG++MK G       + VIP+G++ LD ALG+GG+P+GR+ E++GPESSGKTT
Sbjct: 96  ELEKSFGKGTLMKLGSQFSTQKVEVIPSGSMGLDIALGVGGLPKGRVTEIFGPESSGKTT 155

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           LAL +IA+AQ  GG   FIDAEHAL+P +AARLGV++DE+ +SQPD GEQALEI D L+R
Sbjct: 156 LALHVIAQAQKAGGNCTFIDAEHALNPQWAARLGVNLDELFVSQPDNGEQALEIVDSLLR 215

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           S               PR EIEGE+GD+ +G+QARLMSQALRKL+ +L  SN   IFINQ
Sbjct: 216 SKTMSVIVVDSVAALVPRVEIEGEMGDSHLGVQARLMSQALRKLSPTLKDSNCVLIFINQ 275

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFGNPE T+GG ALKFF                 +I+                
Sbjct: 276 IRMKIGVMFGNPEVTSGGNALKFFSSIRIDIRKVGTVKKGDDIIASQVKAKVVKNKLAPP 335

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTL-KENP 313
           F++A FD+ +  GI++ G I+D+AV  G+  K G+WY+Y + +L QGRE  K  L K  P
Sbjct: 336 FKEAIFDIDFQSGINKTGEIIDLAVAEGIIDKMGSWYSYNDIKLDQGREKTKYLLEKTQP 395

Query: 314 DLREELETKVRESF--EIPIITRSTEE 338
           +L  E+E K+R+      P+I +  EE
Sbjct: 396 NLLVEIENKLRDKLIKSKPLINQQQEE 422


>RECA_THIFE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 346

 Score =  299 bits (766), Expect = 2e-83
 Identities = 160/324 (49%), Positives = 203/324 (62%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E++SK L     QI+ +FGKG++M+ G+     +I V  T                  
Sbjct: 1   MDEQRSKGLSAALSQIDKQFGKGAVMRLGDHNAIKDIEVYSTXXXXXXXXXXXXXXXXXX 60

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
             E+YGPESSGKTTL L  IA  QA GG  AFIDAEHALDP YA +LGVD++ +LISQPD
Sbjct: 61  XXEIYGPESSGKTTLTLHAIASCQAAGGTAAFIDAEHALDPGYAHKLGVDLENLLISQPD 120

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI DMLVRSG              P+AEIEGE+GD+ VGLQARLMSQALR L  
Sbjct: 121 TGEQALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRNLTA 180

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++S+SNT  IFINQ+R KIGVM+G+PETTTGG ALKF+                 E+VG 
Sbjct: 181 NISRSNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKKSDEVVGN 240

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+AEF + YGEGISR   +VD+ V+  + +KSGAWY+Y   R+GQ
Sbjct: 241 DTRVKVVKNKVAPPFREAEFAIYYGEGISRLSELVDLGVKFDIVEKSGAWYSYQGHRIGQ 300

Query: 301 GREAAKQTLKENPDLREELETKVR 324
           G++ A+Q LK +P+L   +E ++R
Sbjct: 301 GKDNARQYLKVHPELAANIEQRIR 324


>RECA_PSESM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  299 bits (766), Expect = 2e-83
 Identities = 173/317 (54%), Positives = 217/317 (68%), Gaps = 3/317 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ MG   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G IVD+AV  G  +KSGAWY+Y   ++GQG+  + + L +NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEIVDLAVLHGFVEKSGAWYSYQGSKIGQGKANSAKFLADNP 312

Query: 314 DLREELETKVRESFEIP 330
           ++ + LE ++R+    P
Sbjct: 313 EICKALEKQIRDKLLTP 329


>RECA_PSE14 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  299 bits (766), Expect = 2e-83
 Identities = 173/317 (54%), Positives = 217/317 (68%), Gaps = 3/317 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ MG   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G IVD+AV  G  +KSGAWY+Y   ++GQG+  + + L +NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEIVDLAVLHGFVEKSGAWYSYQGSKIGQGKANSAKFLADNP 312

Query: 314 DLREELETKVRESFEIP 330
           ++ + LE ++R+    P
Sbjct: 313 EICKALEKQIRDKLLTP 329


>RECA_PSYCK RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  299 bits (765), Expect = 3e-83
 Identities = 153/299 (51%), Positives = 193/299 (64%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGK +IM  G+    L++ V+ T              P+GRIVE+YGPESSGKTT
Sbjct: 15  QIEKQFGKNTIMHLGDNSATLDVDVVSTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           + LQ IA  Q  GG+ AFIDAEHALDPVYA +LGV+ D++L+SQPD GEQALEI DMLVR
Sbjct: 75  MTLQAIAACQKQGGVCAFIDAEHALDPVYARKLGVNTDDLLLSQPDNGEQALEITDMLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              PRAEIEGE+GD+ +GLQARLMSQALRK+ G+  +SN   +FINQ
Sbjct: 135 SGAIDMIVIDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNAKRSNCMVLFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 EI+G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYASVRMDIRRIGAVKNGDEIIGNQTRVKVIKNKMAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
           FRQAEF++ YGEG +    ++D+ VE G   K+G+WY+YG+E++GQG+  +   LKENP
Sbjct: 255 FRQAEFEITYGEGTNHLAEVIDLGVEIGAVGKAGSWYSYGDEKIGQGKANSVLFLKENP 313


>RECA_THEAQ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  298 bits (764), Expect = 4e-83
 Identities = 185/341 (54%), Positives = 229/341 (67%), Gaps = 2/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M E K K L+     IE +FGKG++M+ GE    L + VIPT             +PRGR
Sbjct: 1   MEENKRKSLENALKTIEKEFGKGAVMRLGEMPK-LQVDVIPTXXXXXXXXXXXXXIPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           + E++GPES GKTTLAL IIA+AQ  GG+ AF+DAEHALDP+YA +LGVD+ E+L+SQPD
Sbjct: 60  VTEIFGPESGGKTTLALTIIAQAQKGGGVAAFVDAEHALDPLYAKKLGVDVQELLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI ++L RSG              P+AEIEGE+GD  VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEIVELLARSGXXXXXXXXXXXXXXPKAEIEGEMGDQHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVG 239
            LSKSNT  IFINQ+REK+GVM+GNPETT GGRALKF+                G E VG
Sbjct: 180 VLSKSNTAAIFINQVREKVGVMYGNPETTPGGRALKFYSSVRLDVRKSGQPIKVGNEAVG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AE ++ +G G+     +V++AV AGV +K+G+W++YGE RLG
Sbjct: 240 IXXXXXXXXNKLAPPFREAELEIYFGRGLDPVMDLVNVAVAAGVIEKAGSWFSYGEHRLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           QG+E                  KV E  +  ++    EE +
Sbjct: 300 QGKEKXXXXXXXXXXXXXXXXXKVLERADKVVLAAGEEEGE 340


>RECA_SYNSC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 374

 Score =  298 bits (764), Expect = 4e-83
 Identities = 187/343 (54%), Positives = 231/343 (67%), Gaps = 8/343 (2%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 17  ERDKALNLVLGQIERNFGKGSIMRLGDASR-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 74

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE
Sbjct: 75  IYGPESSGKTTLTLHAIAEVQKRGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGE 134

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVR                PRAEIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 135 MALEIVDQLVRXXXXXXXXXXXXXXXTPRAEIEGEMGDLAVGAQARLMSQAMRKITGNIG 194

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 195 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKKGTEEFGIRXX 254

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 255 XXXXXXXXXPPFRIAEFDILFGRGISTLGCLLDLAEETGVVVRKGAWYSYEGDNIGQGRD 314

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTE-EADAMSPV 345
                ++ENPD    +ET VR+      +T  +E +A++M P+
Sbjct: 315 NTISWMEENPDATATIETLVRQK-----LTEGSEVKANSMRPL 352


>RECA_LARHH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  298 bits (764), Expect = 4e-83
 Identities = 171/321 (53%), Positives = 213/321 (66%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K K L     QIE +FGKGSIM+  E   + N+ VI TG+L LD A            E
Sbjct: 5   DKQKALSAALSQIEKQFGKGSIMRMNETQVNDNLQVISTGSLGLDMAXXXXXXXXXXXXE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL LQ++AEAQ +GG  A+IDAE+ALDPVYA +LGV +D++L+SQPDTGE
Sbjct: 65  IYGPESSGKTTLCLQVVAEAQKLGGTCAYIDAENALDPVYAGKLGVKVDDLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEICDM                   P+AEIEGE+GD+ VGLQARLMSQALRKL G++ 
Sbjct: 125 QALEICDMXXXXXXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTGNIK 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           ++NT  IFINQ+R KIGVMFGNPETTTGG ALKF+                 EI+G    
Sbjct: 185 RTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKKTDEIIGNETR 244

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      F+QAEFD++Y              V      KSGAWY Y  +++GQG++
Sbjct: 245 VKVVKNKVSPPFKQAEFDILYXXXXXXXXXXXXXXVANKFVDKSGAWYAYNGQKIGQGKD 304

Query: 304 AAKQTLKENPDLREELETKVR 324
            A++ L+ENP + +E+E K+R
Sbjct: 305 NAREWLRENPAIAQEIEKKIR 325


>RECA_DESMR RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  298 bits (764), Expect = 4e-83
 Identities = 172/324 (53%), Positives = 219/324 (67%), Gaps = 2/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E +S+ L      IE K G+G++M+  +  H + I  IPT              P+GRI 
Sbjct: 11  EFRSEALATALTTIERKHGQGAVMRLEDSAH-VKIPAIPTXXXXXXXXXXXXXXPKGRIT 69

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YGPESSGKTTLAL IIAE+Q +GG  AFIDAEHALD  YA RLGV+  E+LISQPD G
Sbjct: 70  EIYGPESSGKTTLALHIIAESQKLGGTAAFIDAEHALDVNYARRLGVNTPEMLISQPDFG 129

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQAL+I D+LVRSG              P+AE+EGE+G+T VG QARLMS A+RKL G++
Sbjct: 130 EQALDIADLLVRSGXXXXXXXXXXXXLIPQAELEGEMGETQVGGQARLMSHAMRKLTGTI 189

Query: 183 SKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
            KS T+ IFINQ+R KIG+  +G+PETTTGG ALKF+                 E  G  
Sbjct: 190 HKSQTSVIFINQIRMKIGMTGYGSPETTTGGNALKFYASVRLDIRRIQTLKDKEETYGSR 249

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+A FD++YG G+SREG ++DM VEAG+  KSGAW+ +G ERLGQG
Sbjct: 250 CRVKVVKNKVAPPFREALFDILYGTGVSREGELIDMGVEAGIVDKSGAWFAFGSERLGQG 309

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           R+  +  L+E+ D+R+++E K+RE
Sbjct: 310 RDNVRAFLQEHTDIRDQIEGKLRE 333


>RECA_THEEB RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 355

 Score =  298 bits (762), Expect = 6e-83
 Identities = 184/328 (56%), Positives = 229/328 (69%), Gaps = 2/328 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++ EK K L+    QIE  FGKGSIM+ G+    + +  I +              P+GR
Sbjct: 9   LSPEKRKALEFAISQIERSFGKGSIMRLGDAT-SMKVETI-SSXXXXXXXXXXXXXPKGR 66

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTLAL  IAE Q  GG+ AF+DAEHALDP YAA L VDI  +L++QPD
Sbjct: 67  IIEIYGPESSGKTTLALHAIAEVQKAGGVAAFVDAEHALDPTYAAALRVDIQNLLVAQPD 126

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGE ALEI D LVRS               PRAEIEG++G++ VGLQARLMSQALRK+ G
Sbjct: 127 TGEAALEIVDQLVRSTXXXXXXXXXXXXXXPRAEIEGDMGESHVGLQARLMSQALRKING 186

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
           ++SK+  T IF+NQLR+KIG+ +GNPETTTGG ALKF+                 E  G 
Sbjct: 187 NISKTGCTVIFLNQLRQKIGLTYGNPETTTGGVALKFYASVRLDIRRVQTLKKGTEEFGI 246

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AEFD+++G+GI+  GCI+DMA E GV  + GAWY+Y  E L Q
Sbjct: 247 RXXXXXXXXXXXPPFRIAEFDIIFGKGIANLGCILDMAEEVGVITRKGAWYSYNGENLAQ 306

Query: 301 GREAAKQTLKENPDLREELETKVRESFE 328
           GR+     ++ENP   +E+E +VR+ F+
Sbjct: 307 GRDNTINYMEENPSFAQEIEQQVRQRFD 334


>RECA_SYNS9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 376

 Score =  297 bits (761), Expect = 8e-83
 Identities = 188/354 (53%), Positives = 233/354 (65%), Gaps = 7/354 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 19  ERDKALNLVLGQIERNFGKGSIMRLGDASR-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDP YAA LGVD++ +L+SQPDTGE
Sbjct: 77  IYGPESSGKTTLTLHAIAEVQKRGGVAAFVDAEHALDPHYAASLGVDVENLLVSQPDTGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVR                PR+EIEGE+GD +VG QARLMSQA+RK+ G++ 
Sbjct: 137 MALEIVDQLVRXXXXXXXXXXXXXXLTPRSEIEGEMGDVSVGAQARLMSQAMRKITGNIG 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGVM+GNPETTTGG ALKF+                 E  G    
Sbjct: 197 KSGCTVIFLNQLRLKIGVMYGNPETTTGGNALKFYASVRLDIRRIQTLKKGTEEFGIRXX 256

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 257 XXXXXXXXXPPFRIAEFDILFGRGISTVGCLLDLAEETGVVVRKGAWYSYEGDNIGQGRD 316

Query: 304 AAKQTLKENPDLREELETKVR----ESFEIPIIT-RSTEEADAMSPVAKPAKKK 352
                +++NP+    +ET VR    E  E+   T +S E A A +   KP + K
Sbjct: 317 NTIVWMEQNPEAATTIETLVRQKLNEGTEVTANTVKSLEPAAARAATDKPVETK 370


>RECA_PSEFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  297 bits (761), Expect = 8e-83
 Identities = 171/317 (53%), Positives = 214/317 (67%), Gaps = 3/317 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ MG   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G ++D+ V  G  +KSGAWY Y   ++GQG+  + + L +NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEMIDLGVLHGFVEKSGAWYAYNGSKIGQGKANSAKFLADNP 312

Query: 314 DLREELETKVRESFEIP 330
           D+   LE ++R+    P
Sbjct: 313 DIVATLEKQIRDKLLTP 329


>RECA_THENN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 351

 Score =  297 bits (760), Expect = 1e-82
 Identities = 181/322 (56%), Positives = 214/322 (66%), Gaps = 7/322 (2%)

Query: 1   MNEEKSK--MLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPR 58
           M EEK K  +L+    +IE  FGKGSIM  G+      + VIPTG++ +D A G+GG PR
Sbjct: 1   MAEEKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSIAIDIATGVGGYPR 60

Query: 59  GRIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQ 118
           GRIVE++GPESSGKTTLAL  IAEAQ MGG+ AFIDAEHALDPVYA  LGVD+  +LISQ
Sbjct: 61  GRIVEIFGPESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQ 120

Query: 119 PDTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKL 178
           PD GEQALEI D LVRSG              PRAEIEG +GD  VGLQARLMSQALRK+
Sbjct: 121 PDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGDMQVGLQARLMSQALRKI 180

Query: 179 AGSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           AGS++KS    IF NQ+R KIGVMFG+PETTTGG ALKF+                 +  
Sbjct: 181 AGSVNKSKAVVIFTNQIRMKIGVMFGSPETTTGGLALKFYATMRLEVRRGEALKEGKDXX 240

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTY----G 294
                           F+ A+  ++YG+GI RE  +  + V+ GV  + G+WY Y    G
Sbjct: 241 XXXXXXXXXXXXXAPPFKTAQTYIIYGKGIDREYELFHIGVDEGVITRKGSWYYYTTLKG 300

Query: 295 EE-RLGQGREAAKQTLKENPDL 315
           EE  LGQG     Q LKENP +
Sbjct: 301 EEVSLGQGGSNVVQFLKENPQI 322


>RECA_PSETO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  297 bits (760), Expect = 1e-82
 Identities = 170/312 (54%), Positives = 213/312 (68%), Gaps = 3/312 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ MG   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G ++D+ V  G  +KSGAWY Y   ++GQG+  + + L +NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEMIDLGVLHGFVEKSGAWYAYNGSKIGQGKANSAKFLADNP 312

Query: 314 DLREELETKVRE 325
           D+   LE ++R+
Sbjct: 313 DIAATLEKQIRD 324


>RECA_PSEFS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  297 bits (760), Expect = 1e-82
 Identities = 170/312 (54%), Positives = 213/312 (68%), Gaps = 3/312 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ MG   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G ++D+ V  G  +KSGAWY Y   ++GQG+  + + L +NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEMIDLGVLHGFVEKSGAWYAYNGSKIGQGKANSAKFLADNP 312

Query: 314 DLREELETKVRE 325
           D+   LE ++R+
Sbjct: 313 DIAATLEKQIRD 324


>RECA_PROMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  297 bits (760), Expect = 1e-82
 Identities = 187/348 (53%), Positives = 234/348 (67%), Gaps = 8/348 (2%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 24  ERDKALSLVLGQIERNFGKGSIMRLGDASK-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 81

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVDI+ +L+SQPDTGE
Sbjct: 82  VYGPESSGKTTLTLHAIAEVQKRGGVAAFVDAEHALDPVYAASLGVDIENLLVSQPDTGE 141

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L+R                PR+EIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 142 MALEIVDQLIRXXXXXXXXXXXXXXXTPRSEIEGEMGDHAVGSQARLMSQAMRKITGNIG 201

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 202 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 261

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GIS  GC++DMA E  +  + GAWY+Y  + +GQGR+
Sbjct: 262 XXXXXXXXXPPFRIAEFDILFGKGISTLGCLLDMAEETNIVTRKGAWYSYEGDNIGQGRD 321

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTE-EADAMSPVAKPAK 350
                L+EN + +E++E  VR+      +T  +E  A++M P+A  A+
Sbjct: 322 NTITWLEENSEAKEKIEKLVRQK-----LTEGSEVSANSMKPLASAAR 364


>RECA_SPIPL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  296 bits (759), Expect = 1e-82
 Identities = 179/319 (56%), Positives = 222/319 (69%), Gaps = 2/319 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N EK K L    +QIE  FGKGSI++ G+    + +  I +              PRGR+
Sbjct: 7   NSEKQKALNSVLNQIEKSFGKGSIVRLGDSAR-MKVETI-SSXXXXXXXXXXXXXPRGRV 64

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLAL  IAE Q  GGI AF+DAEHALDP YAA LGVDI+ +L+SQPDT
Sbjct: 65  IEIYGPESSGKTTLALHAIAEIQKTGGIAAFVDAEHALDPTYAAALGVDIENLLVSQPDT 124

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GE ALEI D                    PRAEIEG++GD+ +GLQARLMSQALRK+ G+
Sbjct: 125 GEMALEIVDQXXXXXXXXXXXXXXXXXXXPRAEIEGDMGDSHMGLQARLMSQALRKITGN 184

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           + KS  T IF+NQLR+KIG+++GNPETTTGG ALKF+                 +  G  
Sbjct: 185 IGKSGCTVIFLNQLRQKIGIVYGNPETTTGGNALKFYASVRLDIRRTQTLKKGSDEYGIR 244

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR AEFD+++G+GIS  GC++D+A E GV K+ GAWY+Y  E +GQG
Sbjct: 245 XXXXXXXXXXXPPFRIAEFDIIFGQGISTIGCLIDLAEETGVIKRKGAWYSYNNENIGQG 304

Query: 302 REAAKQTLKENPDLREELE 320
           R+     ++ENP   EE++
Sbjct: 305 RDRTITYMQENPAFTEEID 323


>RECAC_ARATH RecName: Full=DNA repair protein recA homolog 1,
           chloroplastic;AltName: Full=Recombinase A homolog
           1;Flags: Precursor;
          Length = 439

 Score =  296 bits (759), Expect = 1e-82
 Identities = 156/323 (48%), Positives = 205/323 (63%), Gaps = 4/323 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+   + I + FGKGS+ + G  G  L +    +G L LD ALG GG+P+GR+VE
Sbjct: 82  DRQKALEAAMNDINSSFGKGSVTRLGSAGGAL-VETFSSGILTLDLALG-GGLPKGRVVE 139

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IAE Q +GG    +DAEHA DP Y+  LGVD++ +++ QPD GE
Sbjct: 140 IYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYSKALGVDVENLIVCQPDNGE 199

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALE  D + RSG              PRAEIEGEIG   +GLQARLMSQALRK++G+ S
Sbjct: 200 MALETADRMCRSGAVDLICVDSVSALTPRAEIEGEIGMQQMGLQARLMSQALRKMSGNAS 259

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFF--XXXXXXXXXXXXXXXXGEIVGXX 241
           K+  T IF+NQ+R KIGV +GNPE T+GG ALKFF                   E +G  
Sbjct: 260 KAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLEIRSAGKIKSSKGDEDIGLR 319

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        ++QAEF++M+GEG+S+ GC++D A    V  K G+WY+Y ++RLGQG
Sbjct: 320 ARVRVQKSKVSRPYKQAEFEIMFGEGVSKLGCVLDCAEIMEVVVKKGSWYSYEDQRLGQG 379

Query: 302 REAAKQTLKENPDLREELETKVR 324
           RE A Q L+ENP L++E+E KVR
Sbjct: 380 REKALQHLRENPALQDEIEKKVR 402


>RECA_THESQ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  296 bits (758), Expect = 2e-82
 Identities = 181/320 (56%), Positives = 214/320 (66%), Gaps = 7/320 (2%)

Query: 1   MNEEKSK--MLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPR 58
           M EEK K  +L+    +IE  FGKGSIM  G+      + VIPTG+L +D A G+GG PR
Sbjct: 1   MPEEKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSLAIDIATGVGGYPR 60

Query: 59  GRIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQ 118
           GRIVE++G ESSGKTTLAL  IAEAQ MGG+ AFIDAEHALDPVYA  LGVD+  +LISQ
Sbjct: 61  GRIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQ 120

Query: 119 PDTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKL 178
           PD GEQALEI D LVRSG              PRAEIEG +GD  VGLQARLMSQALRK+
Sbjct: 121 PDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGDMQVGLQARLMSQALRKI 180

Query: 179 AGSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           AGS++KS    IF NQ+R KIGVMFG+PETTTGG ALKF+                 +  
Sbjct: 181 AGSVNKSKAVVIFTNQIRMKIGVMFGSPETTTGGLALKFYATMRMEVRRGEPIKEGKDXX 240

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTY----G 294
                           F+ A+  ++YG+GI RE  + ++AV  G+  + G+WY Y    G
Sbjct: 241 XXXXXXXXXXXXXAPPFKTAQTYIIYGKGIDREYELFNIAVNEGIVDRKGSWYYYTTLKG 300

Query: 295 EE-RLGQGREAAKQTLKENP 313
           EE  LGQG   A Q LK+NP
Sbjct: 301 EEVSLGQGSSNAVQFLKDNP 320


>RECA_THEMA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  296 bits (758), Expect = 2e-82
 Identities = 181/320 (56%), Positives = 214/320 (66%), Gaps = 7/320 (2%)

Query: 1   MNEEKSK--MLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPR 58
           M EEK K  +L+    +IE  FGKGSIM  G+      + VIPTG+L +D A G+GG PR
Sbjct: 1   MPEEKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSLAIDIATGVGGYPR 60

Query: 59  GRIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQ 118
           GRIVE++G ESSGKTTLAL  IAEAQ MGG+ AFIDAEHALDPVYA  LGVD+  +LISQ
Sbjct: 61  GRIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQ 120

Query: 119 PDTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKL 178
           PD GEQALEI D LVRSG              PRAEIEG +GD  VGLQARLMSQALRK+
Sbjct: 121 PDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGDMQVGLQARLMSQALRKI 180

Query: 179 AGSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           AGS++KS    IF NQ+R KIGVMFG+PETTTGG ALKF+                 +  
Sbjct: 181 AGSVNKSKAVVIFTNQIRMKIGVMFGSPETTTGGLALKFYATMRMEVRRGEPIKEGKDXX 240

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTY----G 294
                           F+ A+  ++YG+GI RE  + ++AV  G+  + G+WY Y    G
Sbjct: 241 XXXXXXXXXXXXXAPPFKTAQTYIIYGKGIDREYELFNIAVNEGIVDRKGSWYYYTTLKG 300

Query: 295 EE-RLGQGREAAKQTLKENP 313
           EE  LGQG   A Q LK+NP
Sbjct: 301 EEVSLGQGSSNAVQFLKDNP 320


>RECA_WOLSU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  296 bits (757), Expect = 2e-82
 Identities = 169/324 (52%), Positives = 218/324 (67%), Gaps = 2/324 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           ++E K K + L   QI+  FGKG++++ GE   +  I  I T              P+GR
Sbjct: 3   LDENKRKAIDLAIKQIDKAFGKGALVRLGEKPVE-KIDSISTXXXXXXXXXXXXXXPQGR 61

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           I+E+YGPESSGKTTLALQ+IAE Q  GGI AFIDAEHALD  YA RLGVD + +L+SQPD
Sbjct: 62  IIEIYGPESSGKTTLALQVIAECQKKGGICAFIDAEHALDVSYAKRLGVDAENLLVSQPD 121

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + L RSG              P++EI+G++GD  VGLQARLMSQALRK+ G
Sbjct: 122 YGEQALEILETLTRSGAVDLIVVDSVAALTPKSEIDGDMGDQHVGLQARLMSQALRKVTG 181

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K NTT IFINQ+R KIG+M +G+PETTTGG ALKF+                 + +G
Sbjct: 182 VLHKMNTTVIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDVRRIASLKQGEQHIG 241

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AEFD+M+GEGIS+EG ++D  V+  +  KSG+W +YG+++LG
Sbjct: 242 NRXXXXXXXXXXXPPFREAEFDIMFGEGISQEGELIDYGVKLDIVDKSGSWLSYGDKKLG 301

Query: 300 QGREAAKQTLKENPDLREELETKV 323
           QG+E AK  LKEN ++  E++ K+
Sbjct: 302 QGKENAKAFLKENKEIANEIQAKI 325


>RECA_THEP1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  296 bits (757), Expect = 2e-82
 Identities = 180/320 (56%), Positives = 216/320 (67%), Gaps = 7/320 (2%)

Query: 1   MNEEKSK--MLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPR 58
           M++EK K  +L+    +IE  FGKGSIM  G+      + VIPTG+L +D A G+GG PR
Sbjct: 1   MSDEKQKKSVLEKALKRIEENFGKGSIMILGDETQVQPVEVIPTGSLAIDIATGVGGYPR 60

Query: 59  GRIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQ 118
           GRIVE++G ESSGKTTLAL  IAEAQ MGG+ AFIDAEHALDPVYA  LGVD+  +LISQ
Sbjct: 61  GRIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEHALDPVYAKNLGVDLKSLLISQ 120

Query: 119 PDTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKL 178
           PD GEQALEI D LVRSG              PRAEIEG +GD  VGLQARLMSQALRK+
Sbjct: 121 PDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEGAMGDMQVGLQARLMSQALRKI 180

Query: 179 AGSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIV 238
           AGS++KS    IF NQ+R KIGVMFG+PETTTGG ALKF+                 +  
Sbjct: 181 AGSVNKSKAVVIFTNQIRMKIGVMFGSPETTTGGLALKFYATMRMEVRRGEPIKEGKDXX 240

Query: 239 GXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTY----G 294
                           F+ A+  ++YG+GI RE  + ++AVE  + ++ G+WY Y    G
Sbjct: 241 XXXXXXXXXXXXXAPPFKTAQTYIIYGKGIDREYELFNIAVEESMVERKGSWYYYTTLKG 300

Query: 295 EE-RLGQGREAAKQTLKENP 313
           EE  LGQG   A Q LK+NP
Sbjct: 301 EEVSLGQGSSNAVQFLKDNP 320


>RECA_NOSP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 359

 Score =  296 bits (757), Expect = 2e-82
 Identities = 180/324 (55%), Positives = 224/324 (69%), Gaps = 2/324 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L +  +QIE  FGKG+IM+ G+    + +  I +              P+GR++E+
Sbjct: 10  KQKALTMVLNQIERSFGKGAIMRLGDATR-MRVETI-SSXXXXXXXXXXXXXPKGRVIEI 67

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTT+AL  +AE Q  GGI AF+DAEHALDP YAA LGVDID +LISQPDTGE 
Sbjct: 68  YGPESSGKTTVALHALAEVQRNGGIAAFVDAEHALDPTYAAALGVDIDNLLISQPDTGES 127

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI D LVR                PRAEIEG++GD  VGLQARLMSQALRK+ G++ K
Sbjct: 128 ALEIVDQLVRXXXXXXXXXXXXXXLVPRAEIEGDMGDAHVGLQARLMSQALRKITGNIGK 187

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           S  T IFINQLR+KIGV +G+PETTTGG ALKF+                 +  G     
Sbjct: 188 SGCTVIFINQLRQKIGVTYGSPETTTGGNALKFYASVRLDIRRIQTLKKGTDEYGNRXXX 247

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     FR AEFD+++G+GIS  GC+VD+A E G+  + GAWY+Y  + + QGR+ 
Sbjct: 248 XXXXXXXXPPFRIAEFDIIFGKGISTLGCVVDLAEETGIIIRKGAWYSYNGDNISQGRDN 307

Query: 305 AKQTLKENPDLREELETKVRESFE 328
           A + L+E P+  EE++  VRE  +
Sbjct: 308 AIKYLEEKPEFAEEIKKLVREKLD 331


>RECA1_MYXXA RecName: Full=Protein recA 1;AltName: Full=Recombinase
           A 1;
          Length = 342

 Score =  296 bits (757), Expect = 2e-82
 Identities = 167/312 (53%), Positives = 214/312 (68%)

Query: 19  KFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQ 78
           +FG+GS+M  G    +  + VIP+G++ +D ALG+GG PRGR+VEV+G ESSGKTTL L 
Sbjct: 21  QFGRGSVMTLGGEAREQKVAVIPSGSVGVDRALGVGGYPRGRVVEVFGNESSGKTTLTLH 80

Query: 79  IIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXX 138
            I           FIDAEHALD  YA +LGV ++E+L+SQPDTGEQALEI + LVRSG  
Sbjct: 81  AIXXXXXXXXXXXFIDAEHALDVSYARKLGVRVEELLVSQPDTGEQALEITEHLVRSGAV 140

Query: 139 XXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREK 198
                       PRAEIEGE+GD  +G+QARLMSQALRKL G++S+S T  IFINQ+R K
Sbjct: 141 DLIVVDSVAALVPRAEIEGEMGDAHMGVQARLMSQALRKLTGAVSRSGTCIIFINQIRMK 200

Query: 199 IGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQA 258
           IGVMFGNPETTTGG ALKF+                  +VG               F++A
Sbjct: 201 IGVMFGNPETTTGGNALKFYASVRMEIRRTGNIKDGDAVVGSXXXXXXXXXXXXPPFQEA 260

Query: 259 EFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREE 318
           EFDLMYG GI R G ++D+ V  G+ +KSG++++   ER+GQGRE A + L+E+PD+ E 
Sbjct: 261 EFDLMYGSGIHRVGEVLDLGVATGLIEKSGSYFSLRGERIGQGRERAAEWLREHPDVLEA 320

Query: 319 LETKVRESFEIP 330
           L  ++  +  +P
Sbjct: 321 LGKEITGTSALP 332


>RECA_PSEF5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 350

 Score =  295 bits (756), Expect = 3e-82
 Identities = 170/312 (54%), Positives = 214/312 (68%), Gaps = 3/312 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLN-IGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKT 73
           QIE +FGKG++M+ G+  HD   I  I T              P+GRIVE+YGPESSGKT
Sbjct: 15  QIERQFGKGAVMRMGD--HDRQAIPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKT 72

Query: 74  TLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLV 133
           TL L +IA+AQ  G   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLV
Sbjct: 73  TLTLSVIAQAQKAGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLV 132

Query: 134 RSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFIN 193
           RS               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFIN
Sbjct: 133 RSNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFIN 192

Query: 194 QLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXX 253
           Q+R KIGVMFG+PETTTGG ALKF+                 E+VG              
Sbjct: 193 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKIVKNKVAP 252

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAEF ++YG+GI   G I+D+ V  G  +KSGAWY+Y   ++GQG+  + + L++NP
Sbjct: 253 PFRQAEFQILYGKGIYLNGEIIDLGVLHGFLEKSGAWYSYQGNKIGQGKANSAKFLQDNP 312

Query: 314 DLREELETKVRE 325
           ++   LE ++RE
Sbjct: 313 EIGNALEKQIRE 324


>RECA_BORT9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 363

 Score =  295 bits (756), Expect = 3e-82
 Identities = 172/323 (53%), Positives = 217/323 (67%), Gaps = 2/323 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           + K ++L   QIE  FGKGS++K GE                LD A+G+GG PRGRI+E+
Sbjct: 18  REKAIELARIQIEKDFGKGSLIKMGESPVXXXXXXXXXXXXLLDEAIGVGGYPRGRIIEI 77

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ I+E Q  GGI AFIDAEHALDPVYA  LGV+IDE+ +SQPDTGEQ
Sbjct: 78  FGPESSGKTTLTLQAISEVQKNGGIAAFIDAEHALDPVYAKALGVNIDELWLSQPDTGEQ 137

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI + L+RSG              P+AEI+GE+GD  +GLQARLMS+ALRK+ G LSK
Sbjct: 138 ALEIAEYLIRSGGVDLIVVDSVAALTPQAEIDGEMGDCQIGLQARLMSKALRKITGILSK 197

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG--EIVGXXX 242
           S T  +FINQLR KIGVMFGNPETTTGG ALKF+                   +      
Sbjct: 198 SKTCIMFINQLRMKIGVMFGNPETTTGGNALKFYSSLRLEVRKIEQVTGSSADDXXXXXX 257

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR+ E  + +G+GISRE  I+D +++  + +K G+WY+ G+++LGQGR
Sbjct: 258 XXXXXXXXXAPPFRKIELVIYFGKGISREASILDASIKYKLIQKIGSWYSIGDDKLGQGR 317

Query: 303 EAAKQTLKENPDLREELETKVRE 325
           E+A   L +  +L  ELE K+R+
Sbjct: 318 ESAIIYLIKEKELTNELEIKLRK 340


>RECA_PETMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 368

 Score =  295 bits (755), Expect = 4e-82
 Identities = 160/337 (47%), Positives = 215/337 (63%), Gaps = 5/337 (1%)

Query: 21  GKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQII 80
           G GS+M  G+G  + N+ V+P+G L LD ALG+GG PRGRI+E+YG ESSGKTTLAL  +
Sbjct: 27  GTGSVMLMGKGLDNSNLAVVPSGCLSLDIALGVGGYPRGRIIEIYGNESSGKTTLALHSL 86

Query: 81  AEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXX 140
           AE Q + GIVAF+DAEHALD  YA +LGVD+D++++SQPD GEQALEI D LVRS     
Sbjct: 87  AEVQKLNGIVAFVDAEHALDVEYARKLGVDVDKLIVSQPDYGEQALEIVDSLVRSNIVDL 146

Query: 141 XXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIG 200
                     P+AEIEG +GD+ +GLQARLMSQALRKLAGS++KS +  IFINQ+R KIG
Sbjct: 147 IVVDSVAALVPKAEIEGAMGDSHMGLQARLMSQALRKLAGSINKSKSIVIFINQVRMKIG 206

Query: 201 VMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEF 260
           V++GNPETTTGG ALKF+                 + +G               F+QA  
Sbjct: 207 VVYGNPETTTGGIALKFYATIRVEVRKGNPIREGKDQIGNETTLKVVKNKVAPPFKQANV 266

Query: 261 DLMYGEGISREGCIVDMAVEAGVAKKSGAWYTY----GEE-RLGQGREAAKQTLKENPDL 315
           D+++G GI +E  I ++AVE  + ++ GAW+++    GEE  LGQG+  +   L ENPD+
Sbjct: 267 DMIFGRGIPKENDIFNIAVEEELIQRKGAWFSFINENGEEISLGQGKTNSVSYLMENPDI 326

Query: 316 REELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK 352
            + LE  +R+   + I     E+ ++ S   K  K +
Sbjct: 327 LDYLEYTIRKKHNLIIPDYLIEKFESNSSKGKKVKSE 363


>RECA_CYAP4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  295 bits (755), Expect = 4e-82
 Identities = 186/326 (57%), Positives = 221/326 (67%), Gaps = 2/326 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L L   QIE  FGKGSIM+ G+    + +  +PT                  +VE
Sbjct: 10  EKQKALNLVMTQIERSFGKGSIMRLGDATR-MKVETVPTXXXXXXXXXXXXXXXXX-VVE 67

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL  IA  Q  GGI AF+DAEHALDP YAA LGVDI  +LISQPDTGE
Sbjct: 68  IYGPESSGKTTLALHAIAAVQQTGGIAAFVDAEHALDPAYAAVLGVDIQNLLISQPDTGE 127

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVRS               P+AEIEG++GD  VGLQARLMSQALRK+ G++ 
Sbjct: 128 TALEIVDQLVRSTXXXXXXXXXXXXXXPKAEIEGDMGDAHVGLQARLMSQALRKITGNIG 187

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+    IF+NQLR+KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 188 KTGCIVIFLNQLRQKIGVTYGNPETTTGGNALKFYASVRLDIRRVQTLKKGTEEFGNRXX 247

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GISR GCI+DMA E GV  + GAWY+Y  E L QGR+
Sbjct: 248 XXXXXXXXXPPFRVAEFDIIFGKGISRLGCILDMAEETGVVNRKGAWYSYNGENLAQGRD 307

Query: 304 AAKQTLKENPDLREELETKVRESFEI 329
              + ++ENP+    +E  VR+  E+
Sbjct: 308 NTIKYMEENPEFARNIEQLVRQKLEM 333


>RECA_BORAP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  294 bits (753), Expect = 7e-82
 Identities = 168/324 (51%), Positives = 218/324 (67%), Gaps = 3/324 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K + ++L   QIE  FGKGS++K GE                LD ALGIGG PRGRI+E+
Sbjct: 20  KEEAVELARVQIEKTFGKGSLIKMGESPVXXXXXXXXXXXXVLDEALGIGGYPRGRIIEI 79

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTL LQ IAE Q  GGI AFIDAEHALDPVYA  LGV++ E+ +SQPDTGEQ
Sbjct: 80  FGPESSGKTTLTLQAIAEVQKEGGIAAFIDAEHALDPVYAKALGVNVAELWLSQPDTGEQ 139

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI + L+RSG              P+ EI+GE+GD+ +GLQARLMS+ALRK+ G LSK
Sbjct: 140 ALEIAEHLIRSGGIDLIVVDSVAALTPKLEIDGEMGDSQIGLQARLMSKALRKITGILSK 199

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG---EIVGXX 241
           SNT  +FINQ+R +IG+MFGNPETTTGG ALKF+                G   +     
Sbjct: 200 SNTCIMFINQIRMRIGIMFGNPETTTGGNALKFYASLRLEVRKVEQITRSGSSDDXXXXX 259

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR+ E  + +G+GISRE  I+D A++  + +K+G+WY+ G+ +LGQG
Sbjct: 260 XXXXXXXXXXAPPFRKVELVIYFGKGISREAGILDAAIKHNLIQKTGSWYSLGDNKLGQG 319

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE+  + L +  +L  +L+ ++R+
Sbjct: 320 RESVIEYLSKEVELTNDLDKRLRK 343


>RECA_SYNPX RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 375

 Score =  293 bits (750), Expect = 2e-81
 Identities = 184/343 (53%), Positives = 229/343 (66%), Gaps = 8/343 (2%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 19  ERDKALNLVLGQIERNFGKGSIMRLGDASR-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE
Sbjct: 77  IYGPESSGKTTLTLHAIAEVQKRGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVR                PRAEIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 137 MALEIVDQLVRXXXXXXXXXXXXXXLTPRAEIEGEMGDLAVGSQARLMSQAMRKITGNIG 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 197 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKKGTEEFGIRXX 256

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 257 XXXXXXXXXPPFRIAEFDILFGRGISTLGCLLDLAEETGVVIRKGAWYSYEGDNIGQGRD 316

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTE-EADAMSPV 345
                ++ENP+    +E  VR+      +T  +E +A++M P+
Sbjct: 317 NTITWMEENPEAAITIEQLVRQK-----LTEGSEVKANSMKPL 354


>RECA_PROM4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 367

 Score =  293 bits (749), Expect = 2e-81
 Identities = 169/349 (48%), Positives = 221/349 (63%), Gaps = 8/349 (2%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 24  ERDKALNLVLGQIERNFGKGSIMRLGDASR-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 81

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE
Sbjct: 82  VYGPESSGKTTLTLHAIAEVQRRGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGE 141

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L+RS               PRAEIEGE+GD  +G QARLMSQA+RK+ G++ 
Sbjct: 142 MALEIVDQLIRSAAVELVVVDSVAALTPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIG 201

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 +  G    
Sbjct: 202 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTDEYGIRXX 261

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  + +GQGR+
Sbjct: 262 XXXXXXXXXPPFRIAEFDILFGKGISTIGCLLDLAEETNIVARKGAWYSYEGDNIGQGRD 321

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTE-EADAMSPVAKPAKK 351
                L++N + +E++E  VR+      +T  +E  +++M P+    +K
Sbjct: 322 NTITWLEQNTEAKEKIEKLVRQK-----LTEGSEVSSNSMRPLTTANRK 365


>RECA_HAEDU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 372

 Score =  293 bits (749), Expect = 2e-81
 Identities = 166/305 (54%), Positives = 209/305 (68%), Gaps = 1/305 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGSIM+ G+    L+I  + T              P GRIVE+YGPESSGKTTL L +
Sbjct: 36  FGKGSIMRLGDT-QALDIEAVSTXXXXXXXXXXXXXXPMGRIVEIYGPESSGKTTLTLSV 94

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           IA+AQ +G   AFIDAEHALDPVYA +LGVDID +LISQPD GEQALEICD LVRSG   
Sbjct: 95  IAQAQRIGKTCAFIDAEHALDPVYARKLGVDIDALLISQPDNGEQALEICDALVRSGXXX 154

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+AEIEG++GD+ +GLQARLMSQALRKL  ++  +N   +FINQ+R KI
Sbjct: 155 XXXXXXXXXLTPKAEIEGDMGDSYMGLQARLMSQALRKLTANIKATNCLVVFINQIRMKI 214

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GVMFGNPETTTGG ALKF+                 E+VG               FR+ +
Sbjct: 215 GVMFGNPETTTGGNALKFYASVRLDIRRSGVVKDGDEVVGSETKVKIVKNKVAPPFREVQ 274

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
           FD+MYGEGI+R   ++ +A   G  +K+GAW++Y   ++GQG+  A + LKENP++ E++
Sbjct: 275 FDIMYGEGIARMNELLILAEANGFIQKAGAWFSYNGTKIGQGKNNAIKWLKENPEVAEKI 334

Query: 320 ETKVR 324
           E ++R
Sbjct: 335 EQEIR 339


>RECA_PSYA2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  292 bits (747), Expect = 3e-81
 Identities = 152/299 (50%), Positives = 188/299 (62%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGK +IM  G            T              P+GRIVE+YGPESSGKTT
Sbjct: 15  QIEKQFGKNTIMHLGXXXXXXXXXXXXTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKTT 74

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           + LQ IAE Q  GG+ AFIDAEHALDPVYA +LGV+ D++L+SQPD GEQALEI DMLVR
Sbjct: 75  MTLQAIAECQKQGGVCAFIDAEHALDPVYARKLGVNTDDLLLSQPDNGEQALEITDMLVR 134

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              PRAEIEGE+GD+ +GLQARLMSQALRK+ G+  +SN   +FINQ
Sbjct: 135 SGAIDMIVIDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNAKRSNCMVLFINQ 194

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 EI+G               
Sbjct: 195 IRMKIGVMFGSPETTTGGNALKFYASVRMDIRRIGAVKNGDEIIGNQTRVKVIKNKMAPP 254

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
           FRQAEF++ YGEG +    ++D+ VE G   K+G+WY+YG+E++GQG+  +   LKENP
Sbjct: 255 FRQAEFEITYGEGTNHLAEVIDLGVEIGAVGKAGSWYSYGDEKIGQGKANSVLFLKENP 313


>RECA_PSEPF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  292 bits (747), Expect = 3e-81
 Identities = 167/318 (52%), Positives = 213/318 (66%), Gaps = 1/318 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKG++M+ G+      I  I T              P+GRIVE+YGPESSGKTT
Sbjct: 15  QIERQFGKGAVMRMGDQDRQA-IPAISTXXXXXXXXXXXXXXPKGRIVEIYGPESSGKTT 73

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L +IA+AQ  G   AF+DAEHALDP YA +LGV++D++L+SQPDTGEQALEI DMLVR
Sbjct: 74  LTLSVIAQAQKAGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTGEQALEITDMLVR 133

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           S               P+AEIEGE+GD  VGLQARLMSQALRK+ G++  +N   IFINQ
Sbjct: 134 SNXXXXXXXXXXXXXXPKAEIEGEMGDMHVGLQARLMSQALRKITGNIKNANCLVIFINQ 193

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXX 254
           +R KIGVMFG+PETTTGG ALKF+                 E+VG               
Sbjct: 194 IRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSETRVKVVKNKVASP 253

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           FRQAEF ++YG+GI   G ++D+ V  G  +KSGAWY Y   ++GQG+  + + L +NP+
Sbjct: 254 FRQAEFQILYGKGIYLNGEMIDLGVLHGFVEKSGAWYAYEGTKIGQGKANSAKFLADNPE 313

Query: 315 LREELETKVRESFEIPII 332
           +  +LE ++R+    P +
Sbjct: 314 VAAKLEKQLRDKLLSPAV 331


>RECA_ANAVT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 358

 Score =  292 bits (747), Expect = 3e-81
 Identities = 176/324 (54%), Positives = 224/324 (69%), Gaps = 2/324 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L +  +QIE  FGKG+IM+ G+    + +  I +              P+GR++E+
Sbjct: 10  KQKALTMVLNQIERSFGKGAIMRLGDATR-MRVETI-SXXXXXXXXXXXXXXPKGRVIEI 67

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTT+AL  IAE Q  GGI AF+DAEHALDP YA+ LGVDI  +L+SQPDTGE 
Sbjct: 68  YGPESSGKTTVALHAIAEVQKEGGIAAFVDAEHALDPTYASALGVDIQNLLVSQPDTGES 127

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI D LVR                PRAEIEG++GD  VGLQARLMSQALRK+ G++ K
Sbjct: 128 ALEIVDQLVRXXXXXXXXXXXXXXLVPRAEIEGDMGDAHVGLQARLMSQALRKITGNIGK 187

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           S  T IFINQLR+KIGV +G+PETTTGG ALKF+                 +  G     
Sbjct: 188 SGCTVIFINQLRQKIGVTYGSPETTTGGNALKFYASVRLDIRRIQTLKKGTDEFGNRXXX 247

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     FR AEFD+++G+G+S  GC+VD+A E G+  + GAWY+Y  + + QGR+ 
Sbjct: 248 XXXXXXXXPPFRIAEFDIIFGKGVSTLGCLVDLAEETGILLRKGAWYSYNGDNISQGRDN 307

Query: 305 AKQTLKENPDLREELETKVRESFE 328
           A + L+E P+  E+++ +VRE  +
Sbjct: 308 AIKYLEEKPEFAEQIKQQVREKLD 331


>RECA_SYNS3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 382

 Score =  291 bits (746), Expect = 5e-81
 Identities = 179/322 (55%), Positives = 218/322 (67%), Gaps = 2/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 19  ERDKALDLVLGQIERNFGKGSIMRLGDASR-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVDI+ +L+SQPDTGE
Sbjct: 77  VYGPESSGKTTLTLHAIAEVQKRGGVAAFVDAEHALDPVYAASLGVDIENLLVSQPDTGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L                  PRAEIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 137 MALEIVDQLXXXXXXXXXXXXXXXXLTPRAEIEGEMGDLAVGAQARLMSQAMRKITGNIG 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 197 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 256

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 257 XXXXXXXXXPPFRIAEFDILFGRGISTLGCVLDLAEETGVVTRKGAWYSYEGDNIGQGRD 316

Query: 304 AAKQTLKENPDLREELETKVRE 325
                L++NP+ ++ +E  VR+
Sbjct: 317 NTIGWLEQNPEAKDAIEVLVRQ 338


>RECA_SYNPW RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 382

 Score =  291 bits (746), Expect = 5e-81
 Identities = 179/322 (55%), Positives = 219/322 (68%), Gaps = 2/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ + L L   QIE  FGKGSIM+ G+    + +  I +              P+GR+VE
Sbjct: 19  ERDQALNLVLGQIERNFGKGSIMRLGDASR-MRVETI-SXXXXXXXXXXXXXYPKGRVVE 76

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVDI+ +L+SQPDTGE
Sbjct: 77  VYGPESSGKTTLTLHAIAEVQRRGGVAAFVDAEHALDPVYAASLGVDIENLLVSQPDTGE 136

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L                  PRAEIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 137 MALEIVDQLXXXXXXXXXXXXXXXXLTPRAEIEGEMGDLAVGSQARLMSQAMRKITGNIG 196

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 197 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 256

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 257 XXXXXXXXXPPFRIAEFDILFGRGISTLGCLLDLAEETGVVTRKGAWYSYEGDNIGQGRD 316

Query: 304 AAKQTLKENPDLREELETKVRE 325
                L++NP+ ++ +ET VR+
Sbjct: 317 NTIGWLEQNPEAKDTIETLVRQ 338


>RECA_ANASP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 357

 Score =  291 bits (746), Expect = 5e-81
 Identities = 176/324 (54%), Positives = 224/324 (69%), Gaps = 2/324 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K K L +  +QIE  FGKG+IM+ G+    + +  I +              P+GR++E+
Sbjct: 10  KQKALTMVLNQIERSFGKGAIMRLGDATR-MRVETI-SXXXXXXXXXXXXXXPKGRVIEI 67

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           YGPESSGKTT+AL  IAE Q  GGI AF+DAEHALDP YA+ LGVDI  +L+SQPDTGE 
Sbjct: 68  YGPESSGKTTVALHAIAEVQKEGGIAAFVDAEHALDPTYASALGVDIQNLLVSQPDTGES 127

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           ALEI D LVR                PRAEIEG++GD  VGLQARLMSQALRK+ G++ K
Sbjct: 128 ALEIVDQLVRXXXXXXXXXXXXXXLVPRAEIEGDMGDAHVGLQARLMSQALRKITGNIGK 187

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           S  T IFINQLR+KIGV +G+PETTTGG ALKF+                 +  G     
Sbjct: 188 SGCTVIFINQLRQKIGVTYGSPETTTGGNALKFYASVRLDIRRIQTLKKGTDEFGNRXXX 247

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     FR AEFD+++G+G+S  GC+VD+A E G+  + GAWY+Y  + + QGR+ 
Sbjct: 248 XXXXXXXXPPFRIAEFDIIFGKGVSTLGCLVDLAEETGILIRKGAWYSYNGDNISQGRDN 307

Query: 305 AKQTLKENPDLREELETKVRESFE 328
           A + L+E P+  E+++ +VRE  +
Sbjct: 308 AIKYLEEKPEFSEQIKQQVREKLD 331


>RECA_CYAA5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  291 bits (745), Expect = 6e-81
 Identities = 181/340 (53%), Positives = 232/340 (68%), Gaps = 3/340 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L L  +QIE  FGKGSIM+ G+    + +  I +              P GR+
Sbjct: 7   NPDKEKALGLVLNQIERNFGKGSIMRLGDAAR-MKVETI-SXXXXXXXXXXXXXXPMGRV 64

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           VE+YGPESSGKTTLAL  IAE Q  GG+ AF+DAEHALDP Y+A LGVDI+ +L++QPDT
Sbjct: 65  VEIYGPESSGKTTLALHAIAEVQKAGGVAAFVDAEHALDPTYSAALGVDINNLLVAQPDT 124

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GE ALEI D                    PRAEIEGE+GDT VGLQARLMS+ALRK+AG+
Sbjct: 125 GESALEIVDQXXXXXXXXXXXXXXXXXXXPRAEIEGEMGDTQVGLQARLMSKALRKIAGN 184

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE-IVGX 240
           + KS    IF+NQLR+KIG+ +G+PE TTGG ALKF+                 E   G 
Sbjct: 185 IGKSGCVVIFLNQLRQKIGITYGSPEVTTGGTALKFYASVRLDIRRIQTLKKGSEGEYGI 244

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AEFD+++G+GISR GC++D+A ++ V  + GAWY+Y  + + Q
Sbjct: 245 RXXXXXXXXXXXPPFRIAEFDIIFGQGISRMGCMLDLAEQSDVVLRKGAWYSYNGDNISQ 304

Query: 301 GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           GR+ A + L+ENP + E +E +VRE  E+  ++ +  + D
Sbjct: 305 GRDNAVKYLEENPKIAETIEQQVREKLELGSLSFAISQGD 344


>RECA_SULDN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  290 bits (741), Expect = 2e-80
 Identities = 158/325 (48%), Positives = 200/325 (61%), Gaps = 2/325 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+  K K L L   QI+  FGKG++M+ G+    + I  I T             +P+GR
Sbjct: 1   MDANKQKSLDLAMKQIDKAFGKGALMRLGDK-EIMPIESISTXXXXXXXXXXXXXIPQGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           +VE+YGPESSGKTTLALQI AE Q  GG+ AFIDAEHALD  YA  LGVD+D +L+SQPD
Sbjct: 60  VVEIYGPESSGKTTLALQITAECQKAGGVCAFIDAEHALDVGYAKNLGVDVDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQAL+I + + RSG              P++EIEGE+ D  VG+QARLMS+ALRKL G
Sbjct: 120 YGEQALDIVETIARSGAIDLIVIDSVAALTPKSEIEGEMSDQNVGVQARLMSKALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            L K N T IFINQ+R KIG+M +G+PETTTGG ALKF+                   +G
Sbjct: 180 ILHKMNCTVIFINQIRMKIGMMGYGSPETTTGGNALKFYASVRIDVRRIASLKQGESQIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEGIS+EG +VD  V+  +  KSGAW++YGE +LG
Sbjct: 240 NRVKAKVIKNKVAPPFRQAEFDIMFGEGISKEGELVDYGVKLDIIDKSGAWFSYGETKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVR 324
           QGRE  K    E+  L  E+E K++
Sbjct: 300 QGRENVKAKFMEDKVLAHEIEEKIK 324


>RECA_PROMM RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  289 bits (740), Expect = 2e-80
 Identities = 178/322 (55%), Positives = 217/322 (67%), Gaps = 2/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +   P               P+GR+VE
Sbjct: 24  ERDKALNLVLGQIERNFGKGSIMRLGDASR-MRVETFPXXXXXXXXXXXXX-YPKGRVVE 81

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVDI+ +L+SQPDTGE
Sbjct: 82  VYGPESSGKTTLTLHAIAEVQRRGGVAAFVDAEHALDPVYAASLGVDIENLLVSQPDTGE 141

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L                  PR+EIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 142 MALEIVDQLXXXXXXXXXXXXXXXXLTPRSEIEGEMGDLAVGSQARLMSQAMRKITGNIG 201

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 202 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 261

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 262 XXXXXXXXXPPFRIAEFDILFGRGISTLGCLLDLAEETGVVIRKGAWYSYEGDNIGQGRD 321

Query: 304 AAKQTLKENPDLREELETKVRE 325
                L++N + +E++E  VR+
Sbjct: 322 NTITWLEQNSEAQEQIEVLVRQ 343


>RECA_PROM3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 379

 Score =  289 bits (740), Expect = 2e-80
 Identities = 178/322 (55%), Positives = 217/322 (67%), Gaps = 2/322 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           E+ K L L   QIE  FGKGSIM+ G+    + +   P               P+GR+VE
Sbjct: 24  ERDKALNLVLGQIERNFGKGSIMRLGDASR-MRVETFPXXXXXXXXXXXXX-YPKGRVVE 81

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVDI+ +L+SQPDTGE
Sbjct: 82  VYGPESSGKTTLTLHAIAEVQRRGGVAAFVDAEHALDPVYAASLGVDIENLLVSQPDTGE 141

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L                  PR+EIEGE+GD  VG QARLMSQA+RK+ G++ 
Sbjct: 142 MALEIVDQLXXXXXXXXXXXXXXXXLTPRSEIEGEMGDLAVGSQARLMSQAMRKITGNIG 201

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G    
Sbjct: 202 KSGCTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 261

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G GIS  GC++D+A E GV  + GAWY+Y  + +GQGR+
Sbjct: 262 XXXXXXXXXPPFRIAEFDILFGRGISTLGCLLDLAEETGVVIRKGAWYSYEGDNIGQGRD 321

Query: 304 AAKQTLKENPDLREELETKVRE 325
                L++N + +E++E  VR+
Sbjct: 322 NTITWLEQNSEAQEQIEVLVRQ 343


>RECA_THET2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  289 bits (739), Expect = 3e-80
 Identities = 185/341 (54%), Positives = 228/341 (66%), Gaps = 2/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L+     IE +FGKG++M+ GE      + VIPT              PRGR
Sbjct: 1   MDESKRKALENALKAIEKEFGKGAVMRLGEMPKQ-QVDVIPTXXXXXXXXXXXXXXPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPES GKTTLAL IIA+AQ  GG+ AF+DAEHALDP+YA RLGV ++++L+SQPD
Sbjct: 60  IVEIYGPESGGKTTLALTIIAQAQRRGGVAAFVDAEHALDPLYAQRLGVQVEDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI ++L RSG              PRAEIEGE+GD  VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEIVELLARSGXXXXXXXXXXXXXXPRAEIEGEMGDQHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVG 239
            L+KSNT  IFINQ+REK+GV +GNPETT GGRALKF+                G E   
Sbjct: 180 VLAKSNTAAIFINQVREKVGVTYGNPETTPGGRALKFYASVRLDVRKSGQPIKVGNEAXX 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AE ++ +G G+     +V++AV AGV +K+G+W++YGE RLG
Sbjct: 240 XXXXXXXXXXXLAPPFREAELEIYFGRGLDPVADLVNVAVAAGVIEKAGSWFSYGELRLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           QG+                  TKV E     ++    +E +
Sbjct: 300 QGKXXXXXXXXXXXXXXXXXXTKVLERAGEVVLAAGEDEGE 340


>RECA_THET8 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  288 bits (738), Expect = 4e-80
 Identities = 180/303 (59%), Positives = 219/303 (72%), Gaps = 2/303 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L+     IE +FGKG++M+ GE      + VIPT              PRGR
Sbjct: 1   MDESKRKALENALKAIEKEFGKGAVMRLGEMPKQ-QVDVIPTXXXXXXXXXXXXXXPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPES GKTTLAL IIA+AQ  GG+ AF+DAEHALDP+YA RLGV ++++L+SQPD
Sbjct: 60  IVEIYGPESGGKTTLALTIIAQAQRRGGVAAFVDAEHALDPLYAQRLGVQVEDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI ++L RSG              PRAEIEGE+GD  VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEIVELLARSGXXXXXXXXXXXXXXPRAEIEGEMGDQHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVG 239
            L+KSNT  IFINQ+REK+GV +GNPETT GGRALKF+                G E   
Sbjct: 180 VLAKSNTAAIFINQVREKVGVTYGNPETTPGGRALKFYASVRLDVRKSGQPIKVGNEAXX 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AE ++ +G G+     +V++AV AGV +K+G+W++YGE RLG
Sbjct: 240 XXXXXXXXXXXLAPPFREAELEIYFGRGLDPVADLVNVAVAAGVIEKAGSWFSYGELRLG 299

Query: 300 QGR 302
           QG+
Sbjct: 300 QGK 302


>RECA_CAMFF RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  288 bits (738), Expect = 4e-80
 Identities = 167/341 (48%), Positives = 216/341 (63%), Gaps = 2/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L L   QI+  FGKG++++ G+   +                     VP+GR
Sbjct: 1   MDDNKKKSLDLALKQIDKAFGKGTVLRLGDKEIE-PXXXXXXXXXXXXXXXXXXXVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAE+Q +GG+ AF+DAEHALD  YA  LGVD D + ISQPD
Sbjct: 60  IVEIYGPESSGKTTLTLHLIAESQKVGGVCAFVDAEHALDVKYAKNLGVDTDNLYISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQAL+I + L RSG              P++EIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALDIVETLARSGAVDLIVIDSVAALTPKSEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K  TT +FINQ+R KIG M +G PETTTGG ALKF+                 E +G
Sbjct: 180 VVHKMGTTVVFINQIRMKIGAMGYGTPETTTGGNALKFYASVRLDVRKIATLKQSDEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEGIS+EG I+D  V+  +  KSGAW++Y   +LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDIMFGEGISKEGEIIDYGVKLDIIDKSGAWFSYDNSKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           QGRE +K  LKEN  + +E+  K+R +    I++ + +E +
Sbjct: 300 QGRENSKAFLKENKAIADEITEKIRANMGDSIMSGAVDEEE 340


>RECA_CAMFE RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  288 bits (738), Expect = 4e-80
 Identities = 167/341 (48%), Positives = 216/341 (63%), Gaps = 2/341 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L L   QI+  FGKG++++ G+   +                     VP+GR
Sbjct: 1   MDDNKKKSLDLALKQIDKAFGKGTVLRLGDKEIE-PXXXXXXXXXXXXXXXXXXXVPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L +IAE+Q +GG+ AF+DAEHALD  YA  LGVD D + ISQPD
Sbjct: 60  IVEIYGPESSGKTTLTLHLIAESQKVGGVCAFVDAEHALDVKYAKNLGVDTDNLYISQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQAL+I + L RSG              P++EIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALDIVETLARSGAVDLIVIDSVAALTPKSEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K  TT +FINQ+R KIG M +G PETTTGG ALKF+                 E +G
Sbjct: 180 VVHKMGTTVVFINQIRMKIGAMGYGTPETTTGGNALKFYASVRLDVRKIATLKQSDEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEGIS+EG I+D  V+  +  KSGAW++Y   +LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDIMFGEGISKEGEIIDYGVKLDIIDKSGAWFSYDNSKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEAD 340
           QGRE +K  LKEN  + +E+  K+R +    I++ + +E +
Sbjct: 300 QGRENSKAFLKENKAIADEITEKIRANMGDSIMSGAVDEEE 340


>RECA_RALSO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 352

 Score =  288 bits (737), Expect = 5e-80
 Identities = 167/306 (54%), Positives = 203/306 (66%), Gaps = 1/306 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGSIMK G+   +  + V+ T                    E+YGPESSGKTTL LQ+
Sbjct: 29  FGKGSIMKMGDAEVE-PVQVVSTXXXXXXXXXXXXXXXXXXXXEIYGPESSGKTTLTLQV 87

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           +AE Q +GG  AFIDAEHALD  YA +LGV + ++LISQPDTGEQALEI D LVRSG   
Sbjct: 88  VAEMQKLGGTCAFIDAEHALDVTYADKLGVKVPDLLISQPDTGEQALEIADALVRSGSVD 147

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+AEIEGE+GD   GLQARLMSQALRKL G++ ++N   IFINQ+R KI
Sbjct: 148 LIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 207

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GVMFG+PETTTGG ALKF+                                    FR+A 
Sbjct: 208 GVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDXXXXXXXXXXXXXXXXAPPFREAI 267

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
           FD++YG G+SREG I+D+ VEA V +KSGAWY+Y  ER+GQGR+  ++ L+EN +L  E+
Sbjct: 268 FDILYGAGVSREGEIIDLGVEAKVVEKSGAWYSYNGERIGQGRDNCREFLRENAELAREI 327

Query: 320 ETKVRE 325
           E KVRE
Sbjct: 328 ENKVRE 333


>RECA_FRASC RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  288 bits (736), Expect = 7e-80
 Identities = 170/342 (49%), Positives = 208/342 (60%), Gaps = 5/342 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QI+ +FGKGS+M+ G+      +  IPTG++ LD A             
Sbjct: 5   DREKALDNALAQIDKQFGKGSVMRLGDDTRP-PVQAIPTGSIALDVAXXXXXXXXXXXXX 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
            YGPESSGKTT+                    EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 64  XYGPESSGKTTVXXXXXXXXXXXXXXXXXXXXEHALDPEYAGKLGVDTDGLLVSQPDTGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DMLVRSG              PRAEIEGE+GD+ VGLQARLMSQALRK+  +L+
Sbjct: 124 QALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTAALA 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
            S TT IFINQLREKIGVMFG+PETTTGG+ALKF+                 E VG    
Sbjct: 184 NSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTEAVGNRTR 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD++YG GISREG ++DM VE G+ +KSGAWYTY  ++LGQG+E
Sbjct: 244 XXXXXXXXAPPFRTAEFDIVYGGGISREGSLIDMGVEHGIIRKSGAWYTYDGDQLGQGKE 303

Query: 304 AAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPV 345
            A+  L++NPDL             I      + E+DA++PV
Sbjct: 304 NARSFLRDNPDLANXXXXXXXXXLGI----LPSLESDAVAPV 341


>RECA_CAMJD RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 343

 Score =  288 bits (736), Expect = 7e-80
 Identities = 168/339 (49%), Positives = 218/339 (64%), Gaps = 2/339 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M++ K K L      ++  FGKG+I++ G+   +  I  I TG++ LD ALGIGG+P+GR
Sbjct: 1   MDDNKRKSLDAALKSLDKTFGKGTILRLGDKEVE-QIDSIGTGSVGLDLALGIGGIPKGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPESSGKTTL L IIAE Q  GG+ AFIDAEHALD  YA  LGV+ D++ +SQPD
Sbjct: 60  IVEIYGPESSGKTTLTLHIIAECQKAGGVCAFIDAEHALDVKYAKNLGVNTDDLYVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + + RSG              P+AEIEG++GD  VGLQARLMSQALRKL G
Sbjct: 120 FGEQALEIVETIARSGAVDLIVVDSVAALTPKAEIEGDMGDQHVGLQARLMSQALRKLTG 179

Query: 181 SLSKSNTTCIFINQLREKI-GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            + K NTT IFINQ+R KI               ALKF+                 E +G
Sbjct: 180 IVHKMNTTVIFINQIRIKIXXXXXXXXXXXXXXNALKFYASVRLDVRKIATLKQNEEPIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FRQAEFD+M+GEG+SREG ++D  V+  +  KSGAW++Y +++LG
Sbjct: 240 NRXXXXXXXXXXAPPFRQAEFDVMFGEGLSREGELIDYGVKLDIVDKSGAWFSYKDKKLG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEE 338
           QGRE +K  LKENP++ +E+   ++ S  I  +   +E+
Sbjct: 300 QGRENSKAFLKENPEIADEITKAIQNSMGIEGMISGSED 338


>RECA_TRIEI RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 360

 Score =  286 bits (732), Expect = 2e-79
 Identities = 177/324 (54%), Positives = 221/324 (68%), Gaps = 2/324 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N+EK K L      IE  FGKGSI++ G+    + +  I +              P+GR+
Sbjct: 7   NKEKQKALDSVLKTIEKTFGKGSIVRLGDATR-MKVETI-SSXXXXXXXXXXXXXPKGRV 64

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLAL  IAE Q  GGI AF+DAEHALDP YAA LGVDI+ +L+SQPDT
Sbjct: 65  IEIYGPESSGKTTLALHAIAETQKSGGIAAFVDAEHALDPTYAAALGVDIENLLVSQPDT 124

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GE ALE+ D                    PRAEIEG++GD+ +GLQARLMSQALRK+ G+
Sbjct: 125 GEMALEVVDHXXXXXXXXXXXXXXXXXXXPRAEIEGDMGDSHMGLQARLMSQALRKITGN 184

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXX 241
           + KS  T +F+NQLR+KIGV++GNPETTTGG ALKF+                 E  G  
Sbjct: 185 IGKSGCTVVFLNQLRQKIGVVYGNPETTTGGNALKFYASVRLDIRRTQTLKKSSEEYGIH 244

Query: 242 XXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQG 301
                        FR AEFD+++G+GIS  GCI+D+A E  V K+ GAWY+Y      QG
Sbjct: 245 XXXXXXXXXXXPPFRVAEFDIIFGKGISNVGCIIDLAEETDVIKRKGAWYSYQGSNFAQG 304

Query: 302 REAAKQTLKENPDLREELETKVRE 325
           RE A   ++ N D  +++E +VR+
Sbjct: 305 REKAIAYMESNIDFAKKIEKQVRD 328


>RECA_THETH RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 340

 Score =  286 bits (731), Expect = 2e-79
 Identities = 179/303 (59%), Positives = 218/303 (71%), Gaps = 2/303 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E K K L+     IE +FGKG++M+ GE      + VIPT              PRGR
Sbjct: 1   MDESKRKALENALKAIEKEFGKGAVMRLGEMPKQ-QVDVIPTXXXXXXXXXXXXXXPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           IVE+YGPES GKTTLAL IIA+AQ  GG+ AF+DAEHALDP+YA RLGV ++++L+SQPD
Sbjct: 60  IVEIYGPESGGKTTLALTIIAQAQRRGGVAAFVDAEHALDPLYAQRLGVQVEDLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
           TGEQALEI ++L RSG              P AEIEGE+GD  VGLQARLMSQALRKL  
Sbjct: 120 TGEQALEIVELLARSGXXXXXXXXXXXXXXPGAEIEGEMGDQHVGLQARLMSQALRKLTA 179

Query: 181 SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVG 239
            L+KSNT  IFINQ+REK+GV +GNPETT GGRALKF+                G E   
Sbjct: 180 VLAKSNTAAIFINQVREKVGVTYGNPETTPGGRALKFYASVRLDVRKSGQPIKVGNEAXX 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          FR+AE ++ +G G+     +V++AV AGV +K+G+W++YGE RLG
Sbjct: 240 XXXXXXXXXXXLAPPFREAELEIYFGRGLDPVADLVNVAVAAGVIEKAGSWFSYGELRLG 299

Query: 300 QGR 302
           QG+
Sbjct: 300 QGK 302


>RECA_PROM0 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  286 bits (731), Expect = 2e-79
 Identities = 179/331 (54%), Positives = 223/331 (67%), Gaps = 7/331 (2%)

Query: 7   KMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYG 66
           K L L   QIE  FG+GSIM+ G+    + +  I +              P+GR+VEVYG
Sbjct: 16  KALSLVLGQIERNFGRGSIMRLGDASR-MKVETI-SXXXXXXXXXXXXXYPKGRVVEVYG 73

Query: 67  PESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQAL 126
           PESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE AL
Sbjct: 74  PESSGKTTLTLHAIAEVQKNGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGEMAL 133

Query: 127 EICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSN 186
           EI D L+R                PRAEIEGE+GD  +G QARLMSQA+RK+ G++ KS 
Sbjct: 134 EIVDQLIRXXXXXXXXXXXXXXXTPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIGKSG 193

Query: 187 TTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXX 246
            T IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G       
Sbjct: 194 CTVIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXXXXX 253

Query: 247 XXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAK 306
                   FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  E +GQGR+   
Sbjct: 254 XXXXXXPPFRIAEFDILFGKGISTTGCLLDLAEETNIIIRRGAWYSYEGENIGQGRDNTI 313

Query: 307 QTLKENPDLREELETKVRESFEIPIITRSTE 337
             L +N ++R ++E+ V+E      +T  TE
Sbjct: 314 IWLDQNLEIRNKVESMVKEK-----LTEGTE 339


>RECA_MYCMS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  286 bits (731), Expect = 2e-79
 Identities = 160/309 (51%), Positives = 207/309 (66%), Gaps = 1/309 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGSIM  G+  + LN+    +G+L LD ALGIGG P+GRI+E+YGPESSGKTTL+L  
Sbjct: 35  FGKGSIMVLGQSDN-LNVETFSSGSLLLDNALGIGGYPKGRIIEIYGPESSGKTTLSLHA 93

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           I E Q +GGI AFIDAEH+LDP Y   LG+D +++L+SQPD GEQAL+I +ML+ S    
Sbjct: 94  ICEIQKLGGIAAFIDAEHSLDPKYCHNLGIDTNKLLVSQPDNGEQALDILEMLINSNSID 153

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+ E+EGE+ D ++GLQAR+MS+ALRKL G ++KSNTT IFINQLREKI
Sbjct: 154 LIIVDSVAALVPKTELEGEMSDQSIGLQARMMSKALRKLNGLIAKSNTTVIFINQLREKI 213

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GV+FGNPETTTGG+ALKFF                 E                  F+ A 
Sbjct: 214 GVIFGNPETTTGGKALKFFSSIRLEVRKSENILSNSEXXXXXXXXXXXXXXTAIPFKTAT 273

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
             L+Y +GI + G +VD+ V   + +KSG WY+Y  E++GQG+ +  Q L  +     EL
Sbjct: 274 ISLLYNKGIDKIGELVDLLVSYEIVEKSGVWYSYQNEKIGQGKTSVIQWLNADEKRTNEL 333

Query: 320 ETKVRESFE 328
             +V++  E
Sbjct: 334 IQQVKKIIE 342


>RECA_MYCMY RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 345

 Score =  285 bits (728), Expect = 6e-79
 Identities = 159/306 (51%), Positives = 208/306 (67%), Gaps = 1/306 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FGKGSIM  G+  + LNI    +G+L LD ALGIGG P+GRI+E+YGPESSGKTTL+L  
Sbjct: 36  FGKGSIMVLGQSDN-LNIETFSSGSLLLDNALGIGGYPKGRIIEIYGPESSGKTTLSLHA 94

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           I E Q +GGI AFIDAEH+L+P Y   LG+D +++L+SQPD GEQAL+I +ML+ S    
Sbjct: 95  ICEVQKLGGIAAFIDAEHSLEPKYCQTLGIDTNKLLVSQPDNGEQALDILEMLINSNSID 154

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P+ E++GE+ D ++GLQAR+MS+ALRKL   ++KSNTT IFINQLREKI
Sbjct: 155 LIVVDSVAALVPKTELDGEMSDQSIGLQARMMSKALRKLNWLIAKSNTTVIFINQLREKI 214

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GV+FGNPETTTGG+ALKFF                 EI+G               F+   
Sbjct: 215 GVIFGNPETTTGGKALKFFSSIRLEVRKAENILNNYEIIGXXXXXXXXXXXTAIPFKTTT 274

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
             L+Y +GI + G +VD+ V   + +KSG WY+Y  E++GQGR +  Q L  + +   EL
Sbjct: 275 ISLLYNKGIDKLGELVDLLVSYEIIEKSGVWYSYQNEKIGQGRTSVIQWLNADENRINEL 334

Query: 320 ETKVRE 325
             +V++
Sbjct: 335 TEQVKK 340


>RECA_PROMS RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  284 bits (727), Expect = 7e-79
 Identities = 178/329 (54%), Positives = 222/329 (67%), Gaps = 7/329 (2%)

Query: 9   LKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPE 68
           L L   QIE  FG+GSIM+ G+    + +  I +              P+GR+VEVYGPE
Sbjct: 18  LSLVLGQIERNFGRGSIMRLGDASR-MKVETI-SXXXXXXXXXXXXXYPKGRVVEVYGPE 75

Query: 69  SSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEI 128
           SSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE ALEI
Sbjct: 76  SSGKTTLTLHAIAEVQKNGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGEMALEI 135

Query: 129 CDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTT 188
            D L+R                PRAEIEGE+GD  +G QARLMSQA+RK+ G++ KS  T
Sbjct: 136 VDQLIRXXXXXXXXXXXXXXXTPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIGKSGCT 195

Query: 189 CIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXX 248
            IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G         
Sbjct: 196 VIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXXXXXXX 255

Query: 249 XXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQT 308
                 FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  E +GQGR+     
Sbjct: 256 XXXXPPFRIAEFDILFGKGISTTGCLLDLAEETNIIIRRGAWYSYEGENIGQGRDNTIIW 315

Query: 309 LKENPDLREELETKVRESFEIPIITRSTE 337
           L +N ++R ++E+ V+E      +T  TE
Sbjct: 316 LDQNLEIRNKVESMVKEK-----LTEGTE 339


>RECA_PROM9 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  284 bits (727), Expect = 7e-79
 Identities = 178/329 (54%), Positives = 222/329 (67%), Gaps = 7/329 (2%)

Query: 9   LKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPE 68
           L L   QIE  FG+GSIM+ G+    + +  I +              P+GR+VEVYGPE
Sbjct: 18  LSLVLGQIERNFGRGSIMRLGDASR-MKVETI-SXXXXXXXXXXXXXYPKGRVVEVYGPE 75

Query: 69  SSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEI 128
           SSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE ALEI
Sbjct: 76  SSGKTTLTLHAIAEVQKNGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGEMALEI 135

Query: 129 CDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTT 188
            D L+R                PRAEIEGE+GD  +G QARLMSQA+RK+ G++ KS  T
Sbjct: 136 VDQLIRXXXXXXXXXXXXXXXTPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIGKSGCT 195

Query: 189 CIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXX 248
            IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G         
Sbjct: 196 VIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXXXXXXX 255

Query: 249 XXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQT 308
                 FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  E +GQGR+     
Sbjct: 256 XXXXPPFRIAEFDILFGKGISTTGCLLDLAEETNIIIRRGAWYSYEGENIGQGRDNTIIW 315

Query: 309 LKENPDLREELETKVRESFEIPIITRSTE 337
           L +N ++R ++E+ V+E      +T  TE
Sbjct: 316 LDQNLEIRNKVESMVKEK-----LTEGTE 339


>RECA_CYAP7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 356

 Score =  284 bits (727), Expect = 7e-79
 Identities = 179/329 (54%), Positives = 223/329 (67%), Gaps = 3/329 (0%)

Query: 2   NEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRI 61
           N +K K L L  +QIE  FGKGSIM+ G+    + +  IP+              P+GR+
Sbjct: 7   NPDKEKALNLVLNQIERSFGKGSIMRLGDAAR-MRVETIPSXXXXXXXXXXXXX-PKGRV 64

Query: 62  VEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDT 121
           +E+YGPESSGKTTLAL  IAE Q  GG+ AF+DAEHALDP Y+  LGVDI  +L++QPDT
Sbjct: 65  IEIYGPESSGKTTLALHAIAEVQKAGGVAAFVDAEHALDPTYSEVLGVDIHNLLVAQPDT 124

Query: 122 GEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGS 181
           GE ALEI D                    PRAEIEGE+GD  VGLQARLMS+ALRK+AG+
Sbjct: 125 GESALEIVDQXXXXXXXXXXXXXXXXXXXPRAEIEGEMGDNQVGLQARLMSKALRKIAGN 184

Query: 182 LSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE-IVGX 240
           + KS    IF+NQLR+KIGV +G+PE TTGG ALKF+                 E   G 
Sbjct: 185 IGKSGCVVIFLNQLRQKIGVTYGSPEVTTGGTALKFYASVRLDIRRIQTLKKGSEGEYGI 244

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR AEFD+++G+GIS+ GC++DMA    V  + GAWY+Y  E + Q
Sbjct: 245 RXXXXXXXXXXXPPFRIAEFDIIFGKGISQMGCMIDMAEHTDVITRKGAWYSYNGENIAQ 304

Query: 301 GREAAKQTLKENPDLREELETKVRESFEI 329
           GR+ A + L+EN D+   +E +VRE  +I
Sbjct: 305 GRDNAVKYLEENLDVAAIIEKQVREKLDI 333


>RECA_PROMT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  284 bits (726), Expect = 9e-79
 Identities = 174/310 (56%), Positives = 214/310 (69%), Gaps = 2/310 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR++E
Sbjct: 22  EKEKALSLVVGQIERNFGKGSIMRLGDASK-MRVETI-SXXXXXXXXXXXXXYPKGRVIE 79

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE
Sbjct: 80  VYGPESSGKTTLTLHAIAEIQRNGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGE 139

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L+R                PR+EIEGE+GD +VG QARLMSQA+RK+ G++ 
Sbjct: 140 MALEIVDQLIRXXXXXXXXXXXXXXXTPRSEIEGEMGDHSVGAQARLMSQAMRKITGNIG 199

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIG+ +GNPETTTGG ALKF+                 E  G    
Sbjct: 200 KSGCTVIFLNQLRLKIGITYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 259

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GIS  GC++D+A E  V  + GAWY+Y  + +GQGR+
Sbjct: 260 XXXXXXXXXPPFRIAEFDILFGKGISTLGCLLDLADETNVVTRKGAWYSYEGDNIGQGRD 319

Query: 304 AAKQTLKENP 313
                L++NP
Sbjct: 320 NTITWLEQNP 329


>RECA_PROM2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 365

 Score =  284 bits (726), Expect = 9e-79
 Identities = 176/331 (53%), Positives = 223/331 (67%), Gaps = 7/331 (2%)

Query: 7   KMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYG 66
           K L L   QIE  FG+GSIM+ G+    + +  I +              P+GR+VEVYG
Sbjct: 16  KALSLVLGQIERNFGRGSIMRLGDASR-MKVETI-SXXXXXXXXXXXXXYPKGRVVEVYG 73

Query: 67  PESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQAL 126
           PESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE AL
Sbjct: 74  PESSGKTTLTLHAIAEVQKNGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGEMAL 133

Query: 127 EICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSN 186
           EI D L+R                PRAEIEGE+GD  +G QARLMSQA+RK+ G++ KS 
Sbjct: 134 EIVDQLIRXXXXXXXXXXXXXXXTPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIGKSG 193

Query: 187 TTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXX 246
            T IF+NQLR KIG+ +GNPETTTGG ALKF+                 E  G       
Sbjct: 194 CTVIFLNQLRLKIGITYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXXXXX 253

Query: 247 XXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAK 306
                   FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  E +GQGR+   
Sbjct: 254 XXXXXXPPFRIAEFDILFGKGISTTGCLLDLAEETNIIIRRGAWYSYEGENIGQGRDNTI 313

Query: 307 QTLKENPDLREELETKVRESFEIPIITRSTE 337
             L +N +++ ++E+ ++E      +T  TE
Sbjct: 314 IWLDQNLEIKNKVESMIKEK-----LTEGTE 339


>RECA_PROM1 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 377

 Score =  284 bits (726), Expect = 9e-79
 Identities = 174/310 (56%), Positives = 214/310 (69%), Gaps = 2/310 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EK K L L   QIE  FGKGSIM+ G+    + +  I +              P+GR++E
Sbjct: 22  EKEKALSLVVGQIERNFGKGSIMRLGDASK-MRVETI-SXXXXXXXXXXXXXYPKGRVIE 79

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           VYGPESSGKTTL L  IAE Q  GG+ AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE
Sbjct: 80  VYGPESSGKTTLTLHAIAEIQRNGGVAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGE 139

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D L+R                PR+EIEGE+GD +VG QARLMSQA+RK+ G++ 
Sbjct: 140 MALEIVDQLIRXXXXXXXXXXXXXXXTPRSEIEGEMGDHSVGAQARLMSQAMRKITGNIG 199

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           KS  T IF+NQLR KIG+ +GNPETTTGG ALKF+                 E  G    
Sbjct: 200 KSGCTVIFLNQLRLKIGITYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXX 259

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGRE 303
                      FR AEFD+++G+GIS  GC++D+A E  V  + GAWY+Y  + +GQGR+
Sbjct: 260 XXXXXXXXXPPFRIAEFDILFGKGISTLGCLLDLADETNVVTRKGAWYSYEGDNIGQGRD 319

Query: 304 AAKQTLKENP 313
                L++NP
Sbjct: 320 NTITWLEQNP 329


>RECA_BORGA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 362

 Score =  282 bits (721), Expect = 4e-78
 Identities = 162/325 (49%), Positives = 213/325 (65%), Gaps = 3/325 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K + ++L   QIE  FGKGS+                     LD ALGIGG PRGRI+E
Sbjct: 19  KKEEAIELARVQIEKTFGKGSLXXXXXXXXXXXXXXXXXXXXVLDEALGIGGYPRGRIIE 78

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           ++GPESSGKTTL LQ IAE Q  GGI AFIDAEHAL+PVYA  LGV++ E+ +SQPDTGE
Sbjct: 79  IFGPESSGKTTLTLQAIAEVQKEGGIAAFIDAEHALNPVYAKALGVNVSELWLSQPDTGE 138

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI + L+RSG              P+ EI+GE+GD+ +GLQARLMS++LRK+ G LS
Sbjct: 139 QALEIAEHLIRSGGIDLIVVDSVAALTPKLEIDGEMGDSQIGLQARLMSKSLRKITGILS 198

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG---EIVGX 240
           KSNT  +FINQ+R +IG+MFGNPETT GG ALKF+                G   +    
Sbjct: 199 KSNTCIMFINQIRMRIGIMFGNPETTAGGNALKFYSSLRLEVRKIEQITRSGSSDDXXXX 258

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR+ E  + +G+GISRE  I+D A++  + +K+G+WY+ G  +LGQ
Sbjct: 259 XXXXXXXXXXXAPPFRKVELVIYFGKGISREAGILDAALKHNLIQKTGSWYSLGNNKLGQ 318

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           GRE+  + L +  +L  +L+ ++R+
Sbjct: 319 GRESVVEYLNKEVELANDLDKRLRK 343


>RECA_PROMP RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 370

 Score =  281 bits (719), Expect = 6e-78
 Identities = 178/325 (54%), Positives = 221/325 (68%), Gaps = 6/325 (1%)

Query: 9   LKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPE 68
           L L   QIE  FG+GSIM+ G+    + +  I +              P+GR+VEVYGPE
Sbjct: 23  LNLVLGQIERNFGRGSIMRLGDASR-MKVETI-SXXXXXXXXXXXXXYPKGRVVEVYGPE 80

Query: 69  SSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEI 128
           SSGKTTL L  IAE Q  GGI AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE ALEI
Sbjct: 81  SSGKTTLTLHAIAEVQKNGGIAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGEMALEI 140

Query: 129 CDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTT 188
            D L+R                PRAEIEGE+GD  +G QARLMSQA+RK+ G++ KS  T
Sbjct: 141 VDQLIRXXXXXXXXXXXXXXXXPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIGKSGCT 200

Query: 189 CIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXX 248
            IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G         
Sbjct: 201 VIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXXXXXXX 260

Query: 249 XXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQT 308
                 FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  E +GQGR+     
Sbjct: 261 XXXXPPFRIAEFDILFGKGISTTGCLLDLAEETNIIIRRGAWYSYEGENIGQGRDNTIIW 320

Query: 309 LKENPDLREELE----TKVRESFEI 329
           L +N +++ ++E    TK+ E  E+
Sbjct: 321 LDQNLEIKNKVESIVKTKLTEGTEV 345


>RECA_PHYMT RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 339

 Score =  280 bits (717), Expect = 1e-77
 Identities = 160/320 (50%), Positives = 216/320 (67%), Gaps = 3/320 (0%)

Query: 12  TTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSG 71
           T  ++E +FGKGSI K     +  +I  I TG++ LD ALGIGG P+GRI+E++GPESSG
Sbjct: 21  TIKEVEKQFGKGSIFKLNSNNNQ-SIETISTGSMSLDIALGIGGYPKGRIIEIFGPESSG 79

Query: 72  KTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDM 131
           KTTL L  IAEAQ +GG VAFIDAEHALDP YA  +GV+IDE+++SQPD+GE+AL+I   
Sbjct: 80  KTTLTLHAIAEAQKLGGNVAFIDAEHALDPKYAQAIGVNIDELVLSQPDSGEKALDIATS 139

Query: 132 LVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIF 191
           L++SG              P +E+ GE+ D  VGLQAR+M +A+R  +G +SK+NT  I+
Sbjct: 140 LIKSGSISLLVIDSVAALTPESELMGEMKDINVGLQARMMGKAMRIQSGIISKTNTVVIY 199

Query: 192 INQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG--EIVGXXXXXXXXXX 249
           INQLREK+G  +GNPE TTGG+ALKFF                   E             
Sbjct: 200 INQLREKVGNFYGNPEVTTGGKALKFFCSLRLDIRRTAEKIKNNNDEXXXXXXXXXXXXX 259

Query: 250 XXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTL 309
                F+ A  D++YG+GIS+ G I+D+A++  + K++GAWY Y  E   QG+E AK  L
Sbjct: 260 XXXTPFKTATVDIIYGKGISKIGEILDLAIDLNLIKRNGAWYNYKNENFAQGKENAKIFL 319

Query: 310 KENPDLREELETKVRESFEI 329
           + N ++   LE ++R+ ++I
Sbjct: 320 QNNLEIYNFLEEQIRKKYKI 339


>RECA_PROM5 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 370

 Score =  280 bits (716), Expect = 1e-77
 Identities = 177/325 (54%), Positives = 222/325 (68%), Gaps = 6/325 (1%)

Query: 9   LKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPE 68
           L L   QIE  FG+GSIM+ G+    + +  I +              P+GR+VEVYGPE
Sbjct: 23  LNLVLGQIERNFGRGSIMRLGDASR-MKVETI-SXXXXXXXXXXXXXYPKGRVVEVYGPE 80

Query: 69  SSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEI 128
           SSGKTTL L  IAE Q  GGI AF+DAEHALDPVYAA LGVD++ +L+SQPDTGE ALEI
Sbjct: 81  SSGKTTLTLHAIAEVQKNGGIAAFVDAEHALDPVYAASLGVDVENLLVSQPDTGEMALEI 140

Query: 129 CDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTT 188
            D L+R                PRAEIEGE+GD  +G QARLMSQA+RK+ G++ KS  T
Sbjct: 141 VDQLIRXXXXXXXXXXXXXXXXPRAEIEGEMGDHVIGSQARLMSQAMRKITGNIGKSGCT 200

Query: 189 CIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXX 248
            IF+NQLR KIGV +GNPETTTGG ALKF+                 E  G         
Sbjct: 201 VIFLNQLRLKIGVTYGNPETTTGGNALKFYASVRLDIRRIQTLKRGTEEYGIRXXXXXXX 260

Query: 249 XXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQT 308
                 FR AEFD+++G+GIS  GC++D+A E  +  + GAWY+Y  E +GQGR+     
Sbjct: 261 XXXXPPFRIAEFDILFGKGISTTGCLLDLAEETNIIIRRGAWYSYEGENIGQGRDNTIIW 320

Query: 309 LKENPDLREELE----TKVRESFEI 329
           L +N ++++++E    +K+ E  E+
Sbjct: 321 LDQNLEIKKKVEGIVKSKLTEGTEV 345


>RECA_MESFL RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 333

 Score =  276 bits (706), Expect = 2e-76
 Identities = 160/310 (51%), Positives = 210/310 (67%), Gaps = 1/310 (0%)

Query: 5   KSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEV 64
           K++ L      IE  +GK +++ + EG  D++  VI +G+  +D A+GIGG P+GR+VE+
Sbjct: 9   KNEALISALKTIEKNYGKEALVVYNEGD-DIDHDVISSGSFLIDQAIGIGGYPKGRVVEI 67

Query: 65  YGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQ 124
           +GPESSGKTTLAL  IAEAQ  G I AFIDAEH+LD  YA ++GVDI+ +L+SQP  GE+
Sbjct: 68  FGPESSGKTTLALHAIAEAQKQGEIAAFIDAEHSLDLNYAKKIGVDINSLLVSQPSYGEE 127

Query: 125 ALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSK 184
           AL+I + LV+S               P+ E+EGE+ D ++GLQAR+MS+ALRKL G +SK
Sbjct: 128 ALDILETLVKSNSISLIVVDSVAALVPKTELEGEMSDQSIGLQARMMSKALRKLNGVISK 187

Query: 185 SNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXX 244
           S TT IFINQLREKIG+MFGNPETTTGGRALKFF                G         
Sbjct: 188 SKTTVIFINQLREKIGIMFGNPETTTGGRALKFFSTLRIEVRKGESLIENGIXXXXXXXX 247

Query: 245 XXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREA 304
                     F+Q    + Y +GI R   I+++A    +  KSG WY+Y +E++GQG+ A
Sbjct: 248 XXXXXXXXXPFKQTLITIGYDKGIERINEIIELATLYNILDKSGVWYSYEKEKIGQGKNA 307

Query: 305 AKQTLKENPD 314
            K+ L +NPD
Sbjct: 308 VKEWLNKNPD 317


>RECA_FUSNN RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 378

 Score =  275 bits (703), Expect = 4e-76
 Identities = 151/324 (46%), Positives = 196/324 (60%), Gaps = 1/324 (0%)

Query: 3   EEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIV 62
           E K K +K     I   FG G IMK GE    +N+  IPTG++ LD ALGIGGVP+GRI+
Sbjct: 18  EGKEKAVKDAMAAITKGFGSGLIMKLGEKS-SMNVESIPTGSINLDIALGIGGVPKGRII 76

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E+YG ESSGKTTLAL +IAEAQ  GG VAFIDAEHALDPVYA  LGVDIDE+LISQPD G
Sbjct: 77  EIYGAESSGKTTLALHVIAEAQKQGGTVAFIDAEHALDPVYAKALGVDIDELLISQPDYG 136

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEI D LVRSG              P+AEI+GE+ D  +GLQARLMS+ LRKL G+L
Sbjct: 137 EQALEIADTLVRSGAIDLIVIDSVAALVPKAEIDGEMSDQQMGLQARLMSKGLRKLTGNL 196

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
           +K  TT IFINQ+REKI             +ALKF+                 + +G   
Sbjct: 197 NKYKTTMIFINQIREKIXXXXXXXXXXXXXKALKFYSSVRMEVKKMGTVKQGDDPIGSEV 256

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       F++A F+++YG+GIS+ G               G+W+++ ++ +GQG+
Sbjct: 257 IVKVTKNKVAPPFKEAAFEILYGKGISKVGEXXXXXXXXXXXXXXGSWFSFRDQSIGQGK 316

Query: 303 EAAKQTLKENPDLREELETKVRES 326
           E  +  L+ NP+L  ++E  ++E+
Sbjct: 317 EKVRAELEINPELLAQVEKDLKEA 340


>RECA_MYCPU RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 339

 Score =  274 bits (701), Expect = 7e-76
 Identities = 143/306 (46%), Positives = 195/306 (63%), Gaps = 1/306 (0%)

Query: 20  FGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQI 79
           FG  SIM  G+     ++ V  +G+  +++ALGIGG P+GRI+E++GPESSGKTT+AL  
Sbjct: 28  FGNESIMLLGQK-EKCDVDVFSSGSYAINSALGIGGFPKGRIIEIFGPESSGKTTIALHT 86

Query: 80  IAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXX 139
           IAE Q   G  AFID EH++DPVYA  LG+DID +LISQPD+GEQALEI D+L +SG   
Sbjct: 87  IAEIQKKNGFAAFIDVEHSIDPVYAKNLGIDIDNLLISQPDSGEQALEIVDILAKSGSID 146

Query: 140 XXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKI 199
                      P AE+ GE+ D ++GLQARLMS+ALRK+ GSLSK+ T+ IFINQ+REKI
Sbjct: 147 LIVVDSVAALVPEAELNGEMKDQSIGLQARLMSKALRKITGSLSKNKTSVIFINQVREKI 206

Query: 200 GVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAE 259
           GV+FGNPETT GGRALKF+                 +I G               F+ AE
Sbjct: 207 GVVFGNPETTPGGRALKFYASIRLDVRKSTNIMLNNDISGNQIRVKVVKNKLAPPFKIAE 266

Query: 260 FDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREEL 319
            ++++ +GI++ G + D+A+   V +K GAW++Y    + QGR+     L+ N +L EE+
Sbjct: 267 TEIIFSKGINKFGEVADLALVHDVLQKKGAWFSYNGNNIAQGRQKLIAQLESNNELFEEI 326

Query: 320 ETKVRE 325
             K+ E
Sbjct: 327 FQKIVE 332


>RECA_NEIPO RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  273 bits (697), Expect = 2e-75
 Identities = 140/270 (51%), Positives = 175/270 (64%)

Query: 24  SIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQIIAEA 83
           +IMK      + N+ VI T              PRGRIVE++GPESSGKTTL L+ +A+ 
Sbjct: 1   AIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTTLCLEAVAQC 60

Query: 84  QAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXXXXX 143
           Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVRSG       
Sbjct: 61  QKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVRSGGIDMVVV 120

Query: 144 XXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMF 203
                  P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ+R KIGVMF
Sbjct: 121 DSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQIRMKIGVMF 180

Query: 204 GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLM 263
           G+PETTTGG ALKF+                 E++G               FRQAEFD++
Sbjct: 181 GSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPPFRQAEFDIL 240

Query: 264 YGEGISREGCIVDMAVEAGVAKKSGAWYTY 293
           YGEGIS EG ++D+ V+  +  KSGAWY+Y
Sbjct: 241 YGEGISWEGELIDIGVKNDIINKSGAWYSY 270


>RECA_NEILA RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  273 bits (697), Expect = 2e-75
 Identities = 140/270 (51%), Positives = 175/270 (64%)

Query: 24  SIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQIIAEA 83
           +IMK      + N+ VI T              PRGRIVE++GPESSGKTTL L+ +A+ 
Sbjct: 1   AIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTTLCLEAVAQC 60

Query: 84  QAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXXXXX 143
           Q  GG+ AF+DAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD LVRSG       
Sbjct: 61  QKNGGVCAFVDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTLVRSGGIDMVVV 120

Query: 144 XXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMF 203
                  P+AEIEG++GD+ VGLQARLMSQALRKL G + K+NT  +FINQ+R KIGVMF
Sbjct: 121 DSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLTGHIKKTNTLVVFINQIRMKIGVMF 180

Query: 204 GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLM 263
           G+PETTTGG ALKF+                 E++G               FRQAEFD++
Sbjct: 181 GSPETTTGGNALKFYSSVRLDIRRTGSIKKGEEVLGNETRVKVIKNKVAPPFRQAEFDIL 240

Query: 264 YGEGISREGCIVDMAVEAGVAKKSGAWYTY 293
           YGEGIS EG ++D+ V+  +  KSGAWY+Y
Sbjct: 241 YGEGISWEGELIDIGVKNDIINKSGAWYSY 270


>RECA_ARCB4 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 349

 Score =  272 bits (695), Expect = 4e-75
 Identities = 169/330 (51%), Positives = 219/330 (66%), Gaps = 2/330 (0%)

Query: 1   MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR 60
           M+E + K L+L   QI+  FGKG++++ G+    + +  I T              PRGR
Sbjct: 1   MDENQKKSLELAIKQIDKAFGKGTLIRLGDK-EVIPVETISTXXXXXXXXXXXXXXPRGR 59

Query: 61  IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD 120
           ++E+YGPESSGKTTL L  IAEAQ  GG+ AFIDAEHALD  YA  +GVD D +L+SQPD
Sbjct: 60  VIEIYGPESSGKTTLTLHAIAEAQKAGGVCAFIDAEHALDVKYAKEIGVDTDNLLVSQPD 119

Query: 121 TGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAG 180
            GEQALEI + ++RSG              P+ EI            ARLMS+ALRK+ G
Sbjct: 120 FGEQALEILETVIRSGXXXXXXXXXXXXXTPKVEIXXXXXXXXXXXXARLMSKALRKVTG 179

Query: 181 SLSKSNTTCIFINQLREKIGVM-FGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVG 239
            LSK N T IFINQ+R KIG+  +G+PETTTGG ALKF+                   +G
Sbjct: 180 LLSKMNCTVIFINQIRMKIGMTGYGSPETTTGGNALKFYSSVRLDIRRIATLKQGENSIG 239

Query: 240 XXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLG 299
                          F+QAEFD+M+GEGIS+ G +VD  V+  +  K+GAW++YG+ ++G
Sbjct: 240 NRXXXXXXXXXXAAPFKQAEFDIMFGEGISKTGELVDYGVKLDIVDKAGAWFSYGDSKIG 299

Query: 300 QGREAAKQTLKENPDLREELETKVRESFEI 329
           QGRE +K  LK+NP++  E+E K+ ES  +
Sbjct: 300 QGRENSKVFLKDNPEVAREIENKILESMGV 329


>RECA_MYCMO RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 331

 Score =  270 bits (689), Expect = 2e-74
 Identities = 165/317 (52%), Positives = 212/317 (66%), Gaps = 1/317 (0%)

Query: 7   KMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYG 66
           K +K    +IE KFGK SIM  G    DLN+ +  TG+L +D ALGI G P+GRI+E+YG
Sbjct: 3   KEIKNILMEIEKKFGKESIMLLGSK-QDLNVEIFSTGSLAIDHALGINGFPKGRIIEIYG 61

Query: 67  PESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQAL 126
           PESSGKTT+AL  IAE Q  GG+ AFIDAEH++DP YA  LGV+ID +++SQPD+GEQAL
Sbjct: 62  PESSGKTTIALHAIAEIQKSGGVAAFIDAEHSIDPNYAKNLGVNIDNLILSQPDSGEQAL 121

Query: 127 EICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSN 186
           EI D+L +                P  E+ GE+ D  +G QARLMS+ALRK+ GSL+KS 
Sbjct: 122 EIVDILAKXXXXXXXXXXXXAALVPEVELNGEMKDQVMGAQARLMSKALRKITGSLNKSK 181

Query: 187 TTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXX 246
           TT IFINQ+REKIG  FGNPETT GGRALKF+                            
Sbjct: 182 TTVIFINQIREKIGTFFGNPETTPGGRALKFYSSIRLDVRKVSSVSTGEXXXXXXXXXXX 241

Query: 247 XXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAK 306
                   F++A  ++++ +GIS+    V+ A    +  + GAW+ Y ++ + QG+   K
Sbjct: 242 XXXXLSAPFKEAFTEIVFSKGISKISEAVEFAENLKIITRKGAWFYYNDQNIAQGKSNLK 301

Query: 307 QTLKENPDLREELETKV 323
             L++N  L  E+ TKV
Sbjct: 302 DLLEKNEALYSEILTKV 318


>RECA_SYNY3 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  265 bits (678), Expect = 3e-73
 Identities = 170/327 (51%), Positives = 217/327 (66%), Gaps = 3/327 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L     QIE  FGKG+IM+ G+    + +  I +              P+GRIVE
Sbjct: 8   DREKALNAALAQIERSFGKGAIMRLGDATQ-MRVETI-SXXXXXXXXXXXXXXPKGRIVE 65

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTTLAL              F+DAEHALDPVY+  LGVDID +L++QPD GE
Sbjct: 66  IYGPESSGKTTLALHXXXXXXXXXXXXXFVDAEHALDPVYSKALGVDIDNLLVAQPDNGE 125

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
            ALEI D LVRS               PRAEIEGE+GDT+VG QARLMS+A+RK+AG++ 
Sbjct: 126 SALEIVDQLVRSTXXXXXXXXXXXXXXPRAEIEGEMGDTSVGSQARLMSKAMRKIAGNIG 185

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE-IVGXXX 242
           +S    IF+NQLR+KIGV +G+PE TTGG ALKF+                 E   G   
Sbjct: 186 RSGCLVIFLNQLRQKIGVTYGSPEVTTGGNALKFYASVRLDIRRIQTLKKGTEGEYGIRX 245

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                       FR AEFD+++G+GISR GC +D+A +  V  + GAWY+Y  E + QGR
Sbjct: 246 XXXXXXXXXXPPFRIAEFDIIFGQGISRMGCTIDLAEKCEVITRKGAWYSYNGENIAQGR 305

Query: 303 EAAKQTLKENPDLREELETKVRESFEI 329
           + A + L+ENP++   ++ +VRE   +
Sbjct: 306 DNAMKYLEENPEIAATIDQQVREKLSL 332


>RECA_NEIFL RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  262 bits (669), Expect = 4e-72
 Identities = 136/270 (50%), Positives = 170/270 (62%)

Query: 24  SIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQIIAEA 83
           SIMK      + N+ VI T                    E++GPESSGKTTL L+ IA+ 
Sbjct: 1   SIMKMDGSQQEENLDVISTXXXXXXXXXXXXXXXXXXXXEIFGPESSGKTTLCLEAIAQC 60

Query: 84  QAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXXXXX 143
           Q  GGI AFIDAEHA DP+YA +LGV ++E+ +SQPDTGEQALEICD LVRSG       
Sbjct: 61  QKNGGICAFIDAEHAFDPIYARKLGVKVEELYLSQPDTGEQALEICDTLVRSGGIDMVVV 120

Query: 144 XXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMF 203
                  P+AEIEGE+GD+ VGLQARLMSQALRKL G + ++NT  +FINQ+R KIGVMF
Sbjct: 121 DSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGHIKRTNTLVVFINQIRMKIGVMF 180

Query: 204 GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLM 263
           G+PETTTGG ALKF+                 +++G               FRQAEFD++
Sbjct: 181 GSPETTTGGNALKFYASVRLDIRRTGQIKKGDDVIGNETKVKVIKNKVAPPFRQAEFDIL 240

Query: 264 YGEGISREGCIVDMAVEAGVAKKSGAWYTY 293
           YGEGIS EG ++D+ V+  + +KSGAWY+Y
Sbjct: 241 YGEGISWEGELIDLGVKHDIVEKSGAWYSY 270


>RECA_NEICI RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  261 bits (668), Expect = 5e-72
 Identities = 149/270 (55%), Positives = 183/270 (67%)

Query: 24  SIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQIIAEA 83
           SIMK      + N+ VI T              PRGRIVE++GPESSGKTTL L+ +A+ 
Sbjct: 1   SIMKMDGSQQEENLEVISTXXXXXXXXXXXXXXPRGRIVEIFGPESSGKTTLCLEAVAQC 60

Query: 84  QAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXXXXX 143
           Q  GG+ AFIDAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD             
Sbjct: 61  QKDGGVCAFIDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTXXXXXXXXXXXX 120

Query: 144 XXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMF 203
                  P+AEIEG++GD+ VGL ARLMSQALRKL G + K+NT  +FINQ+R KIGVMF
Sbjct: 121 XXXXXXXPKAEIEGDMGDSHVGLHARLMSQALRKLTGHIKKTNTLVVFINQIRMKIGVMF 180

Query: 204 GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLM 263
           G+PETTTGG ALKF+                 E++G               FRQAEFD++
Sbjct: 181 GSPETTTGGNALKFYSSVRLDIRRTGQIKKGEEVIGNETRVKVIKNKVAPPFRQAEFDIL 240

Query: 264 YGEGISREGCIVDMAVEAGVAKKSGAWYTY 293
           YGEG+S EG ++D+ V+  +  KSGAWY+Y
Sbjct: 241 YGEGVSWEGELIDIGVKNDIINKSGAWYSY 270


>RECA_MYCHJ RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 337

 Score =  261 bits (667), Expect = 7e-72
 Identities = 136/299 (45%), Positives = 186/299 (62%), Gaps = 2/299 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EKS +LK    +I+ KFG  SIM  GE    ++  V  +G++ +D ALGIGG P+GRIVE
Sbjct: 6   EKS-LLKQALAEIKKKFGNESIMVLGEKP-PIDTEVFSSGSMAIDMALGIGGFPKGRIVE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GGI AFIDAEH++DP YA  LG+DID +++SQPD+GE
Sbjct: 64  IYGPESSGKTTISLHAIAEVQKQGGIAAFIDAEHSIDPQYAKNLGIDIDNLILSQPDSGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QAL+I D L ++               P AE++GE+ D  +G QARLMS+ALRK+  SL+
Sbjct: 124 QALDIVDTLTKTKAIDLIVVDSVAALVPMAELQGEMKDQVIGAQARLMSKALRKITASLN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+ TT IFINQ+REK+GV+FGNPETT GGR LKF+                 +I G    
Sbjct: 184 KNGTTVIFINQIREKVGVIFGNPETTPGGRGLKFYASIRLDVRKIQQITSGNDITGHSVK 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                      F+ A  ++++ +GIS+   I  +  E G+  + G+W+ Y  E + QG+
Sbjct: 244 IKVVKNKLAIPFKTALVEIVFAKGISKSAEIAQLGEELGILVRKGSWFAYKGENIAQGK 302


>RECA_MYCH7 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 337

 Score =  261 bits (666), Expect = 9e-72
 Identities = 135/299 (45%), Positives = 186/299 (62%), Gaps = 2/299 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EKS +LK    +I+ KFG  SIM  GE    ++  V  +G++ +D ALGIGG P+GRI+E
Sbjct: 6   EKS-LLKQALAEIKKKFGNESIMVLGEKP-PIDTEVFSSGSMAIDMALGIGGFPKGRIIE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GGI AFIDAEH++DP YA  LG+DID +++SQPD+GE
Sbjct: 64  IYGPESSGKTTISLHAIAEVQKQGGIAAFIDAEHSIDPQYAKNLGIDIDNLILSQPDSGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QAL+I D L ++               P AE++GE+ D  +G QARLMS+ALRK+  SL+
Sbjct: 124 QALDIVDTLTKTKAIDLIVVDSVAALVPMAELQGEMKDQVIGAQARLMSKALRKITASLN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+ TT IFINQ+REK+GV+FGNPETT GGR LKF+                 +I G    
Sbjct: 184 KNGTTVIFINQIREKVGVIFGNPETTPGGRGLKFYASIRLDVRKIQQITSGNDITGHSVK 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                      F+ A  ++++ +GIS+   I  +  E G+  + G+W+ Y  E + QG+
Sbjct: 244 IKVVKNKLAIPFKTALVEIVFAKGISKSAEIAQLGEELGILVRKGSWFAYKGENIAQGK 302


>RECA_MYCH2 RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 337

 Score =  261 bits (666), Expect = 9e-72
 Identities = 135/299 (45%), Positives = 186/299 (62%), Gaps = 2/299 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           EKS +LK    +I+ KFG  SIM  GE    ++  V  +G++ +D ALGIGG P+GRI+E
Sbjct: 6   EKS-LLKQALAEIKKKFGNESIMVLGEKP-PIDTEVFSSGSMAIDMALGIGGFPKGRIIE 63

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT++L  IAE Q  GGI AFIDAEH++DP YA  LG+DID +++SQPD+GE
Sbjct: 64  IYGPESSGKTTISLHAIAEVQKQGGIAAFIDAEHSIDPQYAKNLGIDIDNLILSQPDSGE 123

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QAL+I D L ++               P AE++GE+ D  +G QARLMS+ALRK+  SL+
Sbjct: 124 QALDIVDTLTKTKAIDLIVVDSVAALVPMAELQGEMKDQVIGAQARLMSKALRKITASLN 183

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXX 243
           K+ TT IFINQ+REK+GV+FGNPETT GGR LKF+                 +I G    
Sbjct: 184 KNGTTVIFINQIREKVGVIFGNPETTPGGRGLKFYASIRLDVRKIQQITSGNDITGHSVK 243

Query: 244 XXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGR 302
                      F+ A  ++++ +GIS+   I  +  E G+  + G+W+ Y  E + QG+
Sbjct: 244 IKVVKNKLAIPFKTALVEIVFAKGISKSAEIAQLGEELGILVRKGSWFAYKGENIAQGK 302


>RECA_ARTAU RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 218

 Score =  252 bits (644), Expect = 3e-69
 Identities = 132/218 (60%), Positives = 153/218 (70%)

Query: 51  LGIGGVPRGRIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVD 110
           LGIGG+PRGR+VE+YGPESSGKTT+AL  +A AQ  GGI AFIDAEHALDP YAA+LGVD
Sbjct: 1   LGIGGLPRGRVVEIYGPESSGKTTVALHAVANAQRAGGIAAFIDAEHALDPDYAAKLGVD 60

Query: 111 IDEVLISQPDTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARL 170
            D +L+SQPDTGEQALEI DMLV SG              PRAEIEGE+GD+ VGLQARL
Sbjct: 61  TDALLVSQPDTGEQALEIMDMLVGSGSLDIVVIDSVAALVPRAEIEGEMGDSHVGLQARL 120

Query: 171 MSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXX 230
           MSQALRK+ G LS++ TT IFINQLREKIGV FG+PETTTGG+ALKF+            
Sbjct: 121 MSQALRKITGRLSQTKTTAIFINQLREKIGVFFGSPETTTGGKALKFYASVRIDVRRIQT 180

Query: 231 XXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLMYGEGI 268
                + VG               F+ AEFD++YG+GI
Sbjct: 181 LKEGADSVGNRTKAKIVKNKMAPPFKIAEFDIIYGQGI 218


>RECA_NEIPH RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  251 bits (642), Expect = 5e-69
 Identities = 145/270 (53%), Positives = 179/270 (66%)

Query: 24  SIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQIIAEA 83
           SIMK      + N+ VI T                    E++GPESSGKTTL L+ IA+ 
Sbjct: 1   SIMKMDGSQQEENLDVISTXXXXXXXXXXXXXXXXXXXXEIFGPESSGKTTLCLEAIAQC 60

Query: 84  QAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXXXXX 143
           Q  GGI AFIDAEHA DPVYA +LGV ++E+ +SQPDTGEQALEICD             
Sbjct: 61  QKTGGICAFIDAEHAFDPVYARKLGVKVEELYLSQPDTGEQALEICDTXXXXXXXXXXXX 120

Query: 144 XXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMF 203
                  P+AEIEGE+GD+ VGLQARLMSQALRKL G + ++NT  +FINQ+R KIGVMF
Sbjct: 121 XXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTGHIKRTNTLVVFINQIRMKIGVMF 180

Query: 204 GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLM 263
           G+PETTTGG ALKF+                 +++G               FRQAEFD++
Sbjct: 181 GSPETTTGGNALKFYASVRLDIRRTGQIKKGDDVIGNETKVKVIKNKVAPPFRQAEFDIL 240

Query: 264 YGEGISREGCIVDMAVEAGVAKKSGAWYTY 293
           YGEG+S EG ++D+ V+  + +KSGAWY+Y
Sbjct: 241 YGEGVSWEGELIDLGVKYDIVEKSGAWYSY 270


>RECA_NEIMU RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  251 bits (640), Expect = 9e-69
 Identities = 144/270 (53%), Positives = 179/270 (66%)

Query: 24  SIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTTLALQIIAEA 83
           SIMK      + N+ VI T                    E++GPESSGKTTL L+ IA+ 
Sbjct: 1   SIMKMDGSQQEENLDVISTXXXXXXXXXXXXXXXXXXXXEIFGPESSGKTTLCLEAIAQC 60

Query: 84  QAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXXXXX 143
           Q  GGI AFIDAEHA DP+YA +LGV ++E+ +SQPDTGEQALEICD             
Sbjct: 61  QKNGGICAFIDAEHAFDPIYARKLGVKVEELYLSQPDTGEQALEICDTXXXXXXXXXXXX 120

Query: 144 XXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMF 203
                  P+AEIEGE+GD+ VGLQARLMSQALRKL G + ++NT  +FINQ+R KIGVMF
Sbjct: 121 XXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTGHIKRTNTLVVFINQIRMKIGVMF 180

Query: 204 GNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLM 263
           G+PETTTGG ALKF+                 +++G               FRQAEFD++
Sbjct: 181 GSPETTTGGNALKFYASVRLDIRRTGQIKKGDDVIGNETKVKVIKNKVAPPFRQAEFDIL 240

Query: 264 YGEGISREGCIVDMAVEAGVAKKSGAWYTY 293
           YGEG+S EG ++D+ V+  + +KSGAWY+Y
Sbjct: 241 YGEGVSWEGELIDLGVKYDIVEKSGAWYSY 270


>RECA_NEIEG RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 237

 Score =  250 bits (639), Expect = 1e-68
 Identities = 124/221 (56%), Positives = 156/221 (70%)

Query: 57  PRGRIVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLI 116
           PRGRIVE++GPESSGKTTL L+ IA+ Q  GG+ AFIDAE+A DP+YA +LGV ++E+++
Sbjct: 17  PRGRIVEIFGPESSGKTTLCLETIAQCQKNGGVCAFIDAENAFDPIYARKLGVKVEELMV 76

Query: 117 SQPDTGEQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALR 176
           SQPDTGEQALEICDMLVRSG              P+AEIEG++GD+ VGLQARLMSQALR
Sbjct: 77  SQPDTGEQALEICDMLVRSGGVDMVVIDSVAALVPKAEIEGDMGDSHVGLQARLMSQALR 136

Query: 177 KLAGSLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGE 236
           KL G + K+NT  +FINQ+R KIGVMFG+PETTTGG ALKF+                 +
Sbjct: 137 KLTGHIKKTNTLVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRGLQIKKGDD 196

Query: 237 IVGXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDM 277
           ++G               FRQAEFD++YGEG+S EG ++D+
Sbjct: 197 VIGNETKVKVIKNKVAPPFRQAEFDILYGEGVSWEGELIDL 237


>RECA_MYCTU RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Contains:  RecName: Full=Endonuclease PI-MtuI;        
             EC=3.1.-.-;
          Length = 790

 Score =  247 bits (631), Expect = 1e-67
 Identities = 126/215 (58%), Positives = 153/215 (71%), Gaps = 1/215 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 6   DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAE+EGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFF 218
            S TT IFINQLR+KIGVMFG+PETTTGG+ALKF+
Sbjct: 185 NSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFY 219



 Score = 84.3 bits (207), Expect = 1e-18
 Identities = 36/63 (57%), Positives = 51/63 (80%)

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD++YG+GISREG ++DM V+ G+ +KSGAW+TY  E+LGQG+E A+  L EN D
Sbjct: 696 FKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENAD 755

Query: 315 LRE 317
           + +
Sbjct: 756 VAD 758


>RECA_MYCBO RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Contains:  RecName: Full=Endonuclease PI-MboI;        
             EC=3.1.-.-;
          Length = 790

 Score =  247 bits (631), Expect = 1e-67
 Identities = 126/215 (58%), Positives = 153/215 (71%), Gaps = 1/215 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGR++E
Sbjct: 6   DREKALELAVAQIEKSYGKGSVMRLGDEARQ-PISVIPTGSIALDVALGIGGLPRGRVIE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT                     EHALDP YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTXXXXXXXXXXXXXXXXXXXXXEHALDPDYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG              PRAE+EGE+GD+ VGLQARLMSQALRK+ G+L+
Sbjct: 125 QALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALN 184

Query: 184 KSNTTCIFINQLREKIGVMFGNPETTTGGRALKFF 218
            S TT IFINQLR+KIGVMFG+PETTTGG+ALKF+
Sbjct: 185 NSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFY 219



 Score = 84.3 bits (207), Expect = 1e-18
 Identities = 36/63 (57%), Positives = 51/63 (80%)

Query: 255 FRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENPD 314
           F+QAEFD++YG+GISREG ++DM V+ G+ +KSGAW+TY  E+LGQG+E A+  L EN D
Sbjct: 696 FKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENAD 755

Query: 315 LRE 317
           + +
Sbjct: 756 VAD 758


>RECA_NEIAN RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 274

 Score =  244 bits (622), Expect = 1e-66
 Identities = 136/235 (57%), Positives = 170/235 (72%)

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L+ IA+ Q  GG+ AFIDAEHA DP+YA +LGV ++E+ +SQPDTG
Sbjct: 40  EIFGPESSGKTTLCLESIAQCQKNGGVCAFIDAEHAFDPIYARKLGVKVEELYLSQPDTG 99

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD                    P+AEIEGE+GD+ VGLQARLMSQALRKL G +
Sbjct: 100 EQALEICDTXXXXXXXXXXXXXXXXXXXPKAEIEGEMGDSHVGLQARLMSQALRKLTGHI 159

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            ++NT  +FINQ+R KIGV++G+PETTTGG ALKF+                 EI+G   
Sbjct: 160 KRTNTLVVFINQIRMKIGVVYGSPETTTGGNALKFYASVRLDIRRAGQIKKGDEILGNET 219

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEER 297
                       FRQAEFD++YGEGIS EG ++D+ V+  +  KSGAWY+Y + +
Sbjct: 220 KVKVIKNKVAPPFRQAEFDILYGEGISWEGELIDIGVKHDIIDKSGAWYSYNDTK 274


>RECA3_ARATH RecName: Full=DNA repair protein recA homolog 3,
           mitochondrial;AltName: Full=Recombinase A homolog
           3;Flags: Precursor;
          Length = 430

 Score =  241 bits (614), Expect = 9e-66
 Identities = 150/325 (46%), Positives = 198/325 (60%), Gaps = 4/325 (1%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           +K   L+   DQI + FGKGSIM  G      N+ V  TG+  LD ALG+GG+P+GR+VE
Sbjct: 57  KKEIALQQALDQITSSFGKGSIMYLGRAVSPRNVPVFSTGSFALDVALGVGGLPKGRVVE 116

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPE+SGKTTLAL +IAEAQ  GG   F+DAEHALD   A  +GV+ + +L+SQPD GE
Sbjct: 117 IYGPEASGKTTLALHVIAEAQKQGGTCVFVDAEHALDSSLAKAIGVNTENLLLSQPDCGE 176

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QAL + D L+RSG              P+ E+EGE+GD  + +QARLMSQALRK      
Sbjct: 177 QALSLVDTLIRSGXXXXXXXXXXXXXXPKGELEGEMGDAHMAMQARLMSQALRKXXXXXX 236

Query: 184 KSNTTCIFINQLREKIGVM--FGNP-ETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGX 240
                 IFINQ+R K+     FG P E T GG ALKF+                 E  G 
Sbjct: 237 XXXXXXIFINQVRSKLSTFGGFGGPTEVTCGGNALKFYASMRLNIKRIGLIKKGEETTGS 296

Query: 241 XXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ 300
                         FR A+F+L +G+GI +   I+D++++     K+G +Y    +    
Sbjct: 297 QVSVKIVKNKLAPPFRTAQFELEFGKGICKITEIIDLSIKHKFIAKNGTFYNLNGKNY-H 355

Query: 301 GREAAKQTLKENPDLREELETKVRE 325
           G+EA K+ LK+N   +EEL  K+++
Sbjct: 356 GKEALKRFLKQNESDQEELMKKLQD 380


>RECA_ACIFA RecName: Full=Protein recA;AltName: Full=Recombinase A;
          Length = 354

 Score =  239 bits (611), Expect = 2e-65
 Identities = 144/335 (42%), Positives = 183/335 (54%), Gaps = 2/335 (0%)

Query: 15  QIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESSGKTT 74
           QIE +FGKG++M+ G+     +  V  T              PRGR+VE+YGPESSGKTT
Sbjct: 16  QIEGQFGKGAVMRAGDKPGINDPDVKSTXXXXXXXXXXXXXXPRGRVVEIYGPESSGKTT 75

Query: 75  LALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVR 134
           L L+ IA AQA G   AF DAEHALDP +A++LGV++  +LISQPDTGEQALEI DML R
Sbjct: 76  LTLKAIASAQAEGATPAFTDAEHALDPGFASKLGVNVKRLLISQPDTGEQALEIADMLFR 135

Query: 135 SGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQ 194
           SG              P+AEIEGE+GD+  GL ARLMSQALR    ++S+ N   IF  Q
Sbjct: 136 SGAVDVIVKDSVAALTPKAEIEGEMGDSHQGLHARLMSQALRNKTANISRWNKLVIFKKQ 195

Query: 195 LREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXG-EIVGXXXXXXXXXXXXXX 253
           +R K+GV +G PETTTGG ALKF+                  +                 
Sbjct: 196 IRMKMGV-YGRPETTTGGNALKFYASVRLDIRRMGAMKKSATKSYDWSTRVKVVKNKVAP 254

Query: 254 XFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQGREAAKQTLKENP 313
            FRQAE  + YGEGI R    VD+ V+    +KSG WY+Y   R+GQG+  A+Q L+  P
Sbjct: 255 PFRQAELAIYYGEGIYRGSEPVDLGVKLENVEKSGGWYSYPGRRIGQGKANARQYLRVKP 314

Query: 314 DLREELETKVRESFEIPIITRSTEEADAMSPVAKP 348
           +     E  +R +   P      E  D      +P
Sbjct: 315 EFPGIFEQGIRGAMAAPHPLGFGERRDVQQESGEP 349


>RECA_NEISU RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 237

 Score =  238 bits (607), Expect = 6e-65
 Identities = 120/215 (55%), Positives = 148/215 (68%)

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L+ IA+ Q  GGI AFIDAEHA DP+YA +LGV ++E+ +SQPDTG
Sbjct: 23  EIFGPESSGKTTLCLEAIAQCQKNGGICAFIDAEHAFDPIYARKLGVKVEELYLSQPDTG 82

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G +
Sbjct: 83  EQALEICDTLVRSGGIDMVVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGHI 142

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            ++NT  +FINQ+R KIGVMFG+PETTTGG ALKF+                 +++G   
Sbjct: 143 KRTNTLVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGQIKKGDDVIGNET 202

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDM 277
                       FRQAEFD++YGEGIS EG ++D+
Sbjct: 203 KVKVIKNKVAPPFRQAEFDILYGEGISWEGELIDL 237


>RECA_NEIPE RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Flags: Fragment;
          Length = 237

 Score =  238 bits (607), Expect = 6e-65
 Identities = 120/215 (55%), Positives = 148/215 (68%)

Query: 63  EVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTG 122
           E++GPESSGKTTL L+ IA+ Q  GGI AFIDAEHA DP+YA +LGV ++E+ +SQPDTG
Sbjct: 23  EIFGPESSGKTTLCLEAIAQCQKNGGICAFIDAEHAFDPIYARKLGVKVEELYLSQPDTG 82

Query: 123 EQALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSL 182
           EQALEICD LVRSG              P+AEIEGE+GD+ VGLQARLMSQALRKL G +
Sbjct: 83  EQALEICDTLVRSGGIDMVVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGHI 142

Query: 183 SKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFXXXXXXXXXXXXXXXXGEIVGXXX 242
            ++NT  +FINQ+R KIGVMFG+PETTTGG ALKF+                 +++G   
Sbjct: 143 KRTNTLVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGQIKKGDDVIGNET 202

Query: 243 XXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDM 277
                       FRQAEFD++YGEGIS EG ++D+
Sbjct: 203 KVKVIKNKVAPPFRQAEFDILYGEGISWEGELIDL 237


>RECA_MYCLE RecName: Full=Protein recA;AltName: Full=Recombinase
           A;Contains:  RecName: Full=Mle recA intein;
          Length = 711

 Score =  236 bits (602), Expect = 2e-64
 Identities = 124/201 (61%), Positives = 146/201 (72%), Gaps = 1/201 (0%)

Query: 4   EKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVE 63
           ++ K L+L   QIE  +GKGS+M+ G+      I VIPTG++ LD ALGIGG+PRGRIVE
Sbjct: 6   DREKALELAMAQIEKNYGKGSVMRLGDEMCQ-PISVIPTGSIALDVALGIGGLPRGRIVE 64

Query: 64  VYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGE 123
           +YGPESSGKTT+AL              FIDAEHAL+P YA +LGVD D +L+SQPDTGE
Sbjct: 65  IYGPESSGKTTVALHXXXXXXXXXXXXXFIDAEHALEPEYAKKLGVDTDSLLVSQPDTGE 124

Query: 124 QALEICDMLVRSGXXXXXXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLS 183
           QALEI DML+RSG