BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV56675.1 elen0 ACV56675.1 GIB01015CH01 "hypothetical protein"
         (607 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SYR_SHESH RecName: Full=Arginyl-tRNA synthetase;         EC=6.1....    36   8e-04

>SYR_SHESH RecName: Full=Arginyl-tRNA synthetase;       
           EC=6.1.1.19;AltName: Full=Arginine--tRNA ligase;        
           Short=ArgRS;
          Length = 581

 Score = 36.2 bits (82), Expect = 8e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 230 YQRLGSTV-------DLPVNDEIGSRLSDYCFGLWTNEDAGAVTGYQDYIDTLDGATLTV 282
           Y+RLG ++       +   ND++   + D       +E  GA   +QD   T DG  L V
Sbjct: 249 YERLGVSLTRKDVRGESTYNDDLEQVVKDLDAKGLLSESNGAKVVFQDEFKTKDGDPLPV 308

Query: 283 TIEKADGSHATKSIELTAADVKAKLVPSE 311
            I+KADG +   + +L A   ++ ++ ++
Sbjct: 309 IIQKADGGYLYATSDLAAMRYRSNVLKAD 337


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.318    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,709,915,584
Number of extensions: 424785437
Number of successful extensions: 1056969
Number of sequences better than 1.0e-03: 17936
Number of HSP's gapped: 1039051
Number of HSP's successfully gapped: 26455
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)