BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV56840.1 elen0 ACV56840.1 GIB01015CH01 "dihydropteroate
synthase"
         (435 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DHPS_SHIFL RecName: Full=Dihydropteroate synthase;         Short...   229   3e-62
DHPS_ECOLI RecName: Full=Dihydropteroate synthase;         Short...   229   3e-62
DHPS_ECOL6 RecName: Full=Dihydropteroate synthase;         Short...   229   3e-62
DHPS_SYNY3 RecName: Full=Dihydropteroate synthase;         Short...   206   3e-55
DHPS_HAEIN RecName: Full=Dihydropteroate synthase;         Short...   202   3e-54
DHPS_NEIMB RecName: Full=Dihydropteroate synthase;         Short...   192   4e-51
DHPS_STRP6 RecName: Full=Dihydropteroate synthase;         Short...   186   3e-49
DHPS_STRP8 RecName: Full=Dihydropteroate synthase;         Short...   185   7e-49
DHPS_STRP3 RecName: Full=Dihydropteroate synthase;         Short...   185   7e-49
DHPS_STRP1 RecName: Full=Dihydropteroate synthase;         Short...   184   1e-48
DHPS_NEIMC RecName: Full=Dihydropteroate synthase;         Short...   180   2e-47
DHPS_STAAU RecName: Full=Dihydropteroate synthase;         Short...   180   2e-47
DHPS_STAAR RecName: Full=Dihydropteroate synthase;         Short...   180   2e-47
DHPS_NEIMA RecName: Full=Dihydropteroate synthase;         Short...   180   2e-47
DHPS_STAAW RecName: Full=Dihydropteroate synthase;         Short...   177   2e-46
DHPS1_MYCLE RecName: Full=Dihydropteroate synthase 1;         Sh...   177   2e-46
DHPS_STRPY RecName: Full=Dihydropteroate synthase;         Short...   177   2e-46
DHPS_STAAN RecName: Full=Dihydropteroate synthase;         Short...   176   3e-46
DHPS_STAAM RecName: Full=Dihydropteroate synthase;         Short...   176   3e-46
DHPS_STAAS RecName: Full=Dihydropteroate synthase;         Short...   176   4e-46
DHPS_STAAC RecName: Full=Dihydropteroate synthase;         Short...   175   8e-46
DHPS_STAEQ RecName: Full=Dihydropteroate synthase;         Short...   171   8e-45
DHPS_STAHA RecName: Full=Dihydropteroate synthase;         Short...   168   7e-44
DHPS_STAES RecName: Full=Dihydropteroate synthase;         Short...   168   7e-44
DHPS_BACSU RecName: Full=Dihydropteroate synthase;         Short...   165   6e-43
FOL1_PNECA RecName: Full=Folic acid synthesis protein fol1;Inclu...   164   2e-42
FOL1_SCHPO RecName: Full=Folic acid synthesis protein fol1;Inclu...   159   3e-41
DHP2_SHIFL RecName: Full=Dihydropteroate synthase type-2;       ...   151   1e-38
DHP2_ECOLX RecName: Full=Dihydropteroate synthase type-2;       ...   151   1e-38
DHPS1_MYCTU RecName: Full=Dihydropteroate synthase 1;         Sh...   148   1e-37
DHPS1_MYCBO RecName: Full=Dihydropteroate synthase 1;         Sh...   148   1e-37
DHP1_PSEAE RecName: Full=Dihydropteroate synthase type-1;       ...   142   4e-36
DHP1_ECOLX RecName: Full=Dihydropteroate synthase type-1;       ...   142   4e-36
DHP1_CORGL RecName: Full=Dihydropteroate synthase type-1;       ...   142   4e-36
DHPS_CLOB8 RecName: Full=Dihydropteroate synthase;         Short...   142   5e-36
DHP1_MYCFO RecName: Full=Dihydropteroate synthase type-1;       ...   142   7e-36
FOLKP_CHLPN RecName: Full=Folate synthesis bifunctional protein;...   131   1e-32
DHPS2_MYCLE RecName: Full=Dihydropteroate synthase 2;         Sh...   117   1e-28
DHPS_STRR6 RecName: Full=Dihydropteroate synthase;         Short...   117   2e-28
FOLKP_CHLCV RecName: Full=Folate synthesis bifunctional protein;...   116   3e-28
DHPS_STRPN RecName: Full=Dihydropteroate synthase;         Short...   115   7e-28
FOL1_YEAST RecName: Full=Folic acid synthesis protein FOL1;Inclu...   114   2e-27
FOL1_DICDI RecName: Full=Folic acid synthesis protein FOL1;Inclu...   107   2e-25
FOLKP_CHLMU RecName: Full=Folate synthesis bifunctional protein;...   101   1e-23
HPPK_BACSU RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    96   6e-22
HPPK_ECOLI RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    92   1e-20
HPPK_HAEIN RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    90   3e-20
DHPS2_MYCTU RecName: Full=Dihydropteroate synthase 2;         Sh...    90   4e-20
DHPS2_MYCBO RecName: Full=Dihydropteroate synthase 2;         Sh...    90   4e-20
HPPK_METEA RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    88   2e-19
SULD_STRR6 RecName: Full=Bifunctional folate synthesis protein;I...    86   8e-19
SULD_STRPN RecName: Full=Bifunctional folate synthesis protein;I...    86   8e-19
FOLKE_LACLA RecName: Full=Bifunctional protein folKE;Includes:  ...    86   8e-19
FOLKE_LACLM RecName: Full=Bifunctional protein folKE;Includes:  ...    85   1e-18
FOLKP_CHLTR RecName: Full=Folate synthesis bifunctional protein;...    84   2e-18
HPPK_STRP8 RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    84   3e-18
HPPK_STRP3 RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    81   1e-17
HPPK_SYNY3 RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    80   3e-17
HPPK_STRPY RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    80   3e-17
HPPK_STRP1 RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    80   3e-17
HPPK_STRP6 RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    79   6e-17
HPPK_PORGI RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    75   1e-15
HPPK_PORG3 RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    75   1e-15
HPPK_HELPJ RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    65   1e-12
HPPK_HELPY RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    62   1e-11
HPPK_PSEAE RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    60   4e-11
HPPK_AQUAE RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    56   5e-10
HPPK_MYCTU RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    52   7e-09
HPPK_MYCBO RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    52   7e-09
HPPK_CAMJE RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    52   7e-09
HPPK_MYCLE RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    46   5e-07
HPPK_PSEPU RecName: Full=2-amino-4-hydroxy-6-hydroxymethyldihydr...    45   2e-06
SPEB_PHOLL RecName: Full=Agmatinase;         EC=3.5.3.11;AltName...    39   1e-04
Y2857_SHESH RecName: Full=UPF0276 protein Ssed_2857;                   37   4e-04

>DHPS_SHIFL RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 282

 Score =  229 bits (585), Expect = 3e-62
 Identities = 123/257 (47%), Positives = 163/257 (63%), Gaps = 2/257 (0%)

Query: 11  DTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS 70
           D   P VMGILNVTPDSFSDGG H+    A+ HA  M   GA IIDVGGESTRPGAA VS
Sbjct: 11  DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS 70

Query: 71  VDEELARVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVR 129
           V+EEL RV+PVV A+AQR +V +S+DT   EV R   + GA I+ND+    +P  ++A  
Sbjct: 71  VEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAA 130

Query: 130 DSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF 189
           ++   + +MHMQG+P TMQ AP YDDV A+V  +  ++ A  E AG+A +++ +DPG GF
Sbjct: 131 ETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGF 190

Query: 190 GKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACEL 249
           GK  S    L+    EF     P++V +SRKS +G    +  PS R   S A A++A   
Sbjct: 191 GKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQ 249

Query: 250 GASVVRAHNVAATVAAL 266
           GA ++R H+V  TV A+
Sbjct: 250 GAHIIRVHDVKETVEAM 266


>DHPS_ECOLI RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 282

 Score =  229 bits (585), Expect = 3e-62
 Identities = 123/257 (47%), Positives = 163/257 (63%), Gaps = 2/257 (0%)

Query: 11  DTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS 70
           D   P VMGILNVTPDSFSDGG H+    A+ HA  M   GA IIDVGGESTRPGAA VS
Sbjct: 11  DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS 70

Query: 71  VDEELARVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVR 129
           V+EEL RV+PVV A+AQR +V +S+DT   EV R   + GA I+ND+    +P  ++A  
Sbjct: 71  VEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAA 130

Query: 130 DSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF 189
           ++   + +MHMQG+P TMQ AP YDDV A+V  +  ++ A  E AG+A +++ +DPG GF
Sbjct: 131 ETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGF 190

Query: 190 GKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACEL 249
           GK  S    L+    EF     P++V +SRKS +G    +  PS R   S A A++A   
Sbjct: 191 GKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQ 249

Query: 250 GASVVRAHNVAATVAAL 266
           GA ++R H+V  TV A+
Sbjct: 250 GAHIIRVHDVKETVEAM 266


>DHPS_ECOL6 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 282

 Score =  229 bits (585), Expect = 3e-62
 Identities = 123/257 (47%), Positives = 163/257 (63%), Gaps = 2/257 (0%)

Query: 11  DTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS 70
           D   P VMGILNVTPDSFSDGG H+    A+ HA  M   GA IIDVGGESTRPGAA VS
Sbjct: 11  DLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS 70

Query: 71  VDEELARVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVR 129
           V+EEL RV+PVV A+AQR +V +S+DT   EV R   + GA I+ND+    +P  ++A  
Sbjct: 71  VEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAA 130

Query: 130 DSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF 189
           ++   + +MHMQG+P TMQ AP YDDV A+V  +  ++ A  E AG+A +++ +DPG GF
Sbjct: 131 ETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGF 190

Query: 190 GKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACEL 249
           GK  S    L+    EF     P++V +SRKS +G    +  PS R   S A A++A   
Sbjct: 191 GKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVG-PSERLSGSLACAVIAAMQ 249

Query: 250 GASVVRAHNVAATVAAL 266
           GA ++R H+V  TV A+
Sbjct: 250 GAHIIRVHDVKETVEAM 266


>DHPS_SYNY3 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 289

 Score =  206 bits (524), Expect = 3e-55
 Identities = 108/247 (43%), Positives = 154/247 (62%), Gaps = 2/247 (0%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           VMGILN TPDSFSDGG+ +    A+  A+ M + GA IID+GG+STRPGA  VS+ EEL 
Sbjct: 30  VMGILNTTPDSFSDGGEFNSLPTAIHQAKTMVQGGAHIIDIGGQSTRPGAETVSLKEELE 89

Query: 77  RVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDCG 134
           R +P+++AL Q  D+ +SIDT  AEVAR  L+AGA +VND+SG   +P ++         
Sbjct: 90  RTIPIIQALRQELDIPISIDTTRAEVARQALQAGADMVNDISGATFEPEILAVAAQHKAP 149

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           +++MH++G+P TMQN   Y D++ ++R++   +       GV  ++I +DPG GF KT  
Sbjct: 150 IILMHIRGNPQTMQNLTDYGDLIGEMRQFFSAQVDLARHYGVLPEQIILDPGIGFAKTAE 209

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVV 254
           Q + L+R   E  RLG+P++V  SRKSF+G      +P  R   + A    A   GA +V
Sbjct: 210 QNITLLRQLPELKRLGFPLLVGPSRKSFIGKILDQPDPKERVWGTGATCCRAIAGGADIV 269

Query: 255 RAHNVAA 261
           R H+V A
Sbjct: 270 RVHDVEA 276


>DHPS_HAEIN RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 275

 Score =  202 bits (515), Expect = 3e-54
 Identities = 113/254 (44%), Positives = 155/254 (61%), Gaps = 4/254 (1%)

Query: 11  DTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS 70
           D  +P +MGILN TPDSFSD GQ    D AL   E+M EEGA IID+GGESTRP A  VS
Sbjct: 11  DLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGESTRPNADEVS 70

Query: 71  VDEELARVLPVVRALAQRDVC-VSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVR 129
             EEL RV+PVV A+  R  C +S+D+  A V R     G  ++ND+   ++P  ++   
Sbjct: 71  EQEELHRVVPVVEAVRNRFDCWISVDSSKAVVMREAANVGMDLINDIRALQEPNALETAV 130

Query: 130 DSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF 189
                + +MHMQG P TMQ  P Y++VV DV  +L+ R     +AG+  + +  D G GF
Sbjct: 131 KLALPVCIMHMQGQPRTMQANPYYENVVQDVLAFLQKRTNECLSAGIKKENLIWDMGFGF 190

Query: 190 GKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEP-SARDEVSAAEALMACE 248
           GK+     +L++N  EF ++GYPV+  +SRKS +G    +D+P   R   SAA AL+A +
Sbjct: 191 GKSVQHNYQLLQNLNEFCQIGYPVLAGLSRKSMIGAV--LDKPVDQRIIGSAAGALIAVQ 248

Query: 249 LGASVVRAHNVAAT 262
            GA ++R H+VAAT
Sbjct: 249 KGAKILRVHDVAAT 262


>DHPS_NEIMB RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 285

 Score =  192 bits (489), Expect = 4e-51
 Identities = 113/272 (41%), Positives = 157/272 (57%), Gaps = 6/272 (2%)

Query: 2   IWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHD-GFDAALAHAERMAEEGARIIDVGGE 60
           +W+   +E     P +MGI+N+TPDSFSDGG +      ALAHAE++ +EGA I+D+GGE
Sbjct: 5   VWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGVYSQNAQTALAHAEQLLKEGADILDIGGE 64

Query: 61  STRPGAAPVSVDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAA-IVNDVSGF 119
           STR GA  VS +EE ARV PV+  +A   V +S+DTR   +    L  G   I+NDV+  
Sbjct: 65  STRSGADYVSPEEEWARVEPVLAEVAGWGVPISLDTRRTVIMEKALALGGIDIINDVAAL 124

Query: 120 RDPAMVDAV-RDSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAH 178
            D   V+ + R +D G+ +MHMQG P TMQ  P Y DVV +V  +L+ R+A   AAG+A 
Sbjct: 125 NDEGAVELLARQADTGICLMHMQGLPKTMQINPKYQDVVGEVARYLKARSAECIAAGIAP 184

Query: 179 DRICIDP--GPGFGKTPSQTLELVRNFQEFV-RLGYPVMVAVSRKSFLGWAYGIDEPSAR 235
            RI +DP  G GFGK     + L+R+  E +   G+P+++ VSRKS +G   G    + R
Sbjct: 185 QRIILDPGFGSGFGKPLQHNIALMRHLPELMAETGFPLLIGVSRKSTIGELTGEANAAER 244

Query: 236 DEVSAAEALMACELGASVVRAHNVAATVAALE 267
                            +VR H+V AT  AL+
Sbjct: 245 VHXXXXXXXXXXXXXXQIVRVHDVKATADALK 276


>DHPS_STRP6 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 266

 Score =  186 bits (472), Expect = 3e-49
 Identities = 111/251 (44%), Positives = 150/251 (59%), Gaps = 16/251 (6%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG +     AL H E+M  +GA+IIDVGGESTRPG   VS  +E+ 
Sbjct: 14  IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVSATDEID 73

Query: 77  RVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCG 134
           RV+PV++A+ +  D+ +SIDT   E ARA LEAGA I+NDV +G  D  M     + D  
Sbjct: 74  RVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYDGQMFALAAEYDAP 133

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           +++MH Q +         Y +V  DV ++L +RA A   AGV  + I IDPG GF K+  
Sbjct: 134 IILMHNQDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFGFAKSVQ 186

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRK----SFLGWAYGIDEPSARDEVSAAEALMACELG 250
           Q +EL++      +LGYPV+  +SRK    + LG   G  +   RD  +AA +  A   G
Sbjct: 187 QNMELLKGLDRVCQLGYPVLFGISRKRVVDALLG---GNTKAKERDGATAALSAYALGKG 243

Query: 251 ASVVRAHNVAA 261
             +VR H+V A
Sbjct: 244 CQIVRVHDVKA 254


>DHPS_STRP8 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 266

 Score =  185 bits (469), Expect = 7e-49
 Identities = 111/251 (44%), Positives = 149/251 (59%), Gaps = 16/251 (6%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG +     AL H E+M  +GA+IIDVGGESTRPG   VS  +E+ 
Sbjct: 14  IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVSATDEID 73

Query: 77  RVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCG 134
           RV+PV++A+ +  D+ +SIDT   E ARA LEAGA I+NDV +G  D  M     + D  
Sbjct: 74  RVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYDGQMFALAAEYDAP 133

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           +++MH Q +         Y +V  DV ++L +RA A   AGV  + I IDPG GF K+  
Sbjct: 134 IILMHNQDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFGFAKSVQ 186

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRK----SFLGWAYGIDEPSARDEVSAAEALMACELG 250
           Q  EL++      +LGYPV+  +SRK    + LG   G  +   RD  +AA +  A   G
Sbjct: 187 QNTELLKGLDRVCQLGYPVLFGISRKRVVDALLG---GNTKAKERDGATAALSAYALGKG 243

Query: 251 ASVVRAHNVAA 261
             +VR H+V A
Sbjct: 244 CQIVRVHDVKA 254


>DHPS_STRP3 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 266

 Score =  185 bits (469), Expect = 7e-49
 Identities = 111/251 (44%), Positives = 149/251 (59%), Gaps = 16/251 (6%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG +     AL H E+M  +GA+IIDVGGESTRPG   VS  +E+ 
Sbjct: 14  IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVSATDEID 73

Query: 77  RVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCG 134
           RV+PV++A+ +  D+ +SIDT   E ARA LEAGA I+NDV +G  D  M     + D  
Sbjct: 74  RVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYDGQMFALAAEYDAP 133

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           +++MH Q +         Y +V  DV ++L +RA A   AGV  + I IDPG GF K+  
Sbjct: 134 IILMHNQDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFGFAKSVQ 186

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRK----SFLGWAYGIDEPSARDEVSAAEALMACELG 250
           Q  EL++      +LGYPV+  +SRK    + LG   G  +   RD  +AA +  A   G
Sbjct: 187 QNTELLKRLDRVCQLGYPVLFGISRKRVVDALLG---GNTKAKERDGATAALSAYALGKG 243

Query: 251 ASVVRAHNVAA 261
             +VR H+V A
Sbjct: 244 CQIVRVHDVKA 254


>DHPS_STRP1 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 266

 Score =  184 bits (468), Expect = 1e-48
 Identities = 110/251 (43%), Positives = 149/251 (59%), Gaps = 16/251 (6%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG +     AL H E+M  +GA+IIDVGGESTRPG   VS  +E+ 
Sbjct: 14  IMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTRPGCQFVSATDEID 73

Query: 77  RVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCG 134
           RV+PV++A+ +  D+ +SIDT   E ARA LEAGA I+NDV +G  D  M     + D  
Sbjct: 74  RVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYDGQMFALAAEYDAP 133

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           +++MH Q +         Y +V  DV ++L +RA A   AGV  + I +DPG GF K+  
Sbjct: 134 IILMHNQDE-------EVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWVDPGFGFAKSVQ 186

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRK----SFLGWAYGIDEPSARDEVSAAEALMACELG 250
           Q  EL++      +LGYPV+  +SRK    + LG   G  +   RD  +AA +  A   G
Sbjct: 187 QNTELLKGLDRVCQLGYPVLFGISRKRVVDALLG---GNTKAKERDGATAALSAYALGKG 243

Query: 251 ASVVRAHNVAA 261
             +VR H+V A
Sbjct: 244 CQIVRVHDVKA 254


>DHPS_NEIMC RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 283

 Score =  180 bits (457), Expect = 2e-47
 Identities = 106/270 (39%), Positives = 147/270 (54%), Gaps = 4/270 (1%)

Query: 2   IWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHD-GFDAALAHAERMAEEGARIIDVGGE 60
           +W+   +E     P +MGI+N+TPDSFSDGG +      ALAHAE++ +EGA I+D+GGE
Sbjct: 5   VWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGVYSQNAQTALAHAEQLLKEGADILDIGGE 64

Query: 61  STRPGAAPVSVDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAA-IVNDVSGF 119
           STR GA  VS +EE ARV PV+  +A   V +S+DTR   +    L  G   I+NDV+  
Sbjct: 65  STRSGADYVSPEEEWARVEPVLAEVAGWGVPISLDTRRTVIMEKALALGGIDIINDVAAL 124

Query: 120 RDPAMVDAV-RDSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAH 178
            D   V+ + R +D G+ +MHMQG P  MQ  P Y DVV +V  +L+             
Sbjct: 125 NDEGAVELLARQADTGICLMHMQGLPKNMQINPKYQDVVGEVARYLKXXXXXXXXXXXXP 184

Query: 179 DRICIDPGPGFGKTPSQTLELVRNFQEFV-RLGYPVMVAVSRKSFLGWAYGIDEPSARDE 237
            RI +DPG  FGKT    + L+R+  E +   GYP+++ VSRKS +G   G  +      
Sbjct: 185 QRITLDPGFCFGKTLQHNITLMRHLPELMAETGYPLLIGVSRKSMIGELTGETDXXXXXX 244

Query: 238 VSAAEALMACELGASVVRAHNVAATVAALE 267
                          +VR H+V AT  AL+
Sbjct: 245 XXXXXXXXXXXXXXKIVRVHDVKATADALK 274


>DHPS_STAAU RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  180 bits (456), Expect = 2e-47
 Identities = 107/255 (41%), Positives = 145/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  ++A+   + M +EGA IIDVGG STRPG   ++V+EEL 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMITVEEELN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  I+ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           V+MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 VLMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS_STAAR RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  180 bits (456), Expect = 2e-47
 Identities = 107/255 (41%), Positives = 145/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  ++A+   + M +EGA IIDVGG STRPG   ++V+EEL 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMITVEEELN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  I+ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           V+MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 VLMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS_NEIMA RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 283

 Score =  180 bits (456), Expect = 2e-47
 Identities = 107/270 (39%), Positives = 146/270 (54%), Gaps = 4/270 (1%)

Query: 2   IWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHD-GFDAALAHAERMAEEGARIIDVGGE 60
           +W+   +E     P +MGI+N+TPDS SDGG +      ALAHAER+ +EGA I+D+GGE
Sbjct: 5   VWQAGRFEIGLDKPKIMGIVNLTPDSLSDGGAYSQNAQTALAHAERLLKEGADILDIGGE 64

Query: 61  STRPGAAPVSVDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAA-IVNDVSGF 119
           STRPGA  VS +EE ARV  V+  +A   V VS+DTRH  V    L  G   I+NDV+  
Sbjct: 65  STRPGADYVSPEEEWARVESVLAEVAGWGVPVSLDTRHTVVMEKALALGGIDIINDVAAL 124

Query: 120 RDPAMVDAVR-DSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAH 178
            D   ++ +   +D G+ +MHMQG P  MQ  P Y DVV +V  +L+             
Sbjct: 125 TDEGALELLACQADTGICLMHMQGLPKNMQINPKYQDVVGEVARYLKXXXXXXXXXXXXP 184

Query: 179 DRICIDPGPGFGKTPSQTLELVRNFQEFV-RLGYPVMVAVSRKSFLGWAYGIDEPSARDE 237
            RI +DPG  FGKT    + L+R+  E +   GYP+++ VSRKS +G   G  +      
Sbjct: 185 QRITLDPGFCFGKTLQHNITLMRHLPELMAETGYPLLIGVSRKSMIGELTGETDXXXXXX 244

Query: 238 VSAAEALMACELGASVVRAHNVAATVAALE 267
                          +VR H+V AT  AL+
Sbjct: 245 XXXXXXXXXXXXXXKIVRVHDVKATADALK 274


>DHPS_STAAW RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  177 bits (449), Expect = 2e-46
 Identities = 105/255 (41%), Positives = 145/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  ++A+   + M +EGA IIDVGG STRPG   VS++EE+ 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSTRPGHEMVSLEEEMN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  ++ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           ++MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 ILMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS1_MYCLE RecName: Full=Dihydropteroate synthase 1;       
           Short=DHPS 1;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase 1;
          Length = 284

 Score =  177 bits (449), Expect = 2e-46
 Identities = 110/258 (42%), Positives = 145/258 (56%), Gaps = 7/258 (2%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           V+G+LNVT +SFSDGG++   D A+ H   M  EGA I+DVGGESTRPGA       EL+
Sbjct: 8   VIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGGESTRPGAIRTDPRVELS 67

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDCGL 135
           R++PVV+ LA + + VSIDT  A+VARA L++GA IVNDVSG R DPAM   V ++    
Sbjct: 68  RIVPVVKELAAQGITVSIDTTRADVARAALQSGARIVNDVSGGRADPAMAPLVAEAGVAW 127

Query: 136 VVMHMQ-GDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           V+MH +         AP+Y DVVA+VR                   + IDPG GF KT  
Sbjct: 128 VLMHWRLMSAERPYEAPNYRDVVAEVRXXXXXXXXXXXXXXXXPGSLVIDPGLGFAKTGQ 187

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAY-----GIDEPSARDEVSAAEALMACEL 249
               L+    E V  G P+++  SRK FLG         +  P  R+  +A  + +A   
Sbjct: 188 HNWALLNALPELVATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALH 247

Query: 250 GASVVRAHNVAATVAALE 267
           GA  VR H+V A+V AL+
Sbjct: 248 GAWGVRVHDVRASVDALK 265


>DHPS_STRPY RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 266

 Score =  177 bits (448), Expect = 2e-46
 Identities = 107/248 (43%), Positives = 146/248 (58%), Gaps = 10/248 (4%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG +      L   +++   GA+IIDVGGESTRPG   VS  +E+ 
Sbjct: 14  IMGILNVTPDSFSDGGSYTTVQKVLQQVDQLIAGGAKIIDVGGESTRPGYQFVSAADEIE 73

Query: 77  RVLPVVRAL-AQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCG 134
           RV+P+++A+ A+ DV +SIDT   E ARA LEAGA I+NDV +G  D  M+    + D  
Sbjct: 74  RVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVRAGLYDGEMLALAAEYDVP 133

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           +++MH Q +         Y DV  DV ++L  RA A   AGV  D I IDPG GF K+  
Sbjct: 134 IILMHNQKE-------EVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFGFPKSVQ 186

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASV 253
             +EL++      +LGYPV+  +SRK  +    G + +   RD  +AA +  A   G  +
Sbjct: 187 HNMELLKGLDHVCQLGYPVLFGISRKGVVDALLGGNTKAKERDGATAALSAYALGKGCQL 246

Query: 254 VRAHNVAA 261
           VR H+V A
Sbjct: 247 VRVHDVKA 254


>DHPS_STAAN RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  176 bits (447), Expect = 3e-46
 Identities = 105/255 (41%), Positives = 144/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  + A+   + M +EGA IIDVGG STRPG   V+++EEL 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVETAINRVKAMIDEGADIIDVGGVSTRPGHEMVTLEEELN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  ++ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           ++MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 ILMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS_STAAM RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  176 bits (447), Expect = 3e-46
 Identities = 105/255 (41%), Positives = 144/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  + A+   + M +EGA IIDVGG STRPG   V+++EEL 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVETAINRVKAMIDEGADIIDVGGVSTRPGHEMVTLEEELN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  ++ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           ++MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 ILMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS_STAAS RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  176 bits (445), Expect = 4e-46
 Identities = 104/255 (40%), Positives = 144/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  ++A+   + M +EG  IIDVGG STRPG   VS++EE+ 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGVDIIDVGGVSTRPGHEMVSLEEEMN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  ++ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           ++MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 ILMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS_STAAC RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  175 bits (443), Expect = 8e-46
 Identities = 104/255 (40%), Positives = 144/255 (56%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSFSDGG+ +  ++A+   + M +EGA IIDVGG S RPG   VS++EE+ 
Sbjct: 6   IMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGADIIDVGGVSMRPGHEMVSLEEEMN 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
           RVLPVV A+   DV +S+DT  +EVA ACL+ G  ++ND  +G  D  M   V   D  +
Sbjct: 66  RVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDHRMFQIVAKYDAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           ++MH         N    + VV ++   L  +A   + AG+  ++I +DPG GF KT ++
Sbjct: 126 ILMH-------NGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F     G D  P  RDEV+AA        G   V
Sbjct: 179 EAEVMARLDELVATEYPVLLATSRKRFTKKMMGYDTTPVERDEVTAATTAYGIMKGVRAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV       +G+
Sbjct: 239 RVHNVELNAKLAKGI 253


>DHPS_STAEQ RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 272

 Score =  171 bits (434), Expect = 8e-45
 Identities = 106/252 (42%), Positives = 143/252 (56%), Gaps = 18/252 (7%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPG-----AAPVSV 71
           +MGILNVTPDSFSDGGQ+   D A+  A+ M +EG  IIDVGG STRPG        VS+
Sbjct: 6   IMGILNVTPDSFSDGGQYHSVDQAVKRAKEMIDEGVDIIDVGGVSTRPGHKEVSHKEVSL 65

Query: 72  DEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRD 130
            EE+ RVLPVV ++ + DV +S+DT  +EVA ACL+ G +++ND  +G  D  M + V  
Sbjct: 66  KEEMNRVLPVVESIVKYDVQISVDTFRSEVAEACLKLGVSMINDQWAGLFDSNMFNVVSQ 125

Query: 131 SDCGLVVMHMQGDPSTMQNAPSYDD--VVADVREWLRDRAAALEAAGVAHDRICIDPGPG 188
               +V+MH         N   + D  VV ++   L  +A   E AG+ H++I +DPG G
Sbjct: 126 YGAEIVLMH---------NGDGHRDKPVVEEMLVSLLAQANKAELAGIPHNKIWLDPGIG 176

Query: 189 FGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMAC 247
           F KT  +  E++    E V   YPV++A SRK ++      D  PS RDE +AA      
Sbjct: 177 FAKTREEENEVMARLDELVATEYPVLLATSRKRYIKEMMNQDSSPSDRDEATAATTAYGI 236

Query: 248 ELGASVVRAHNV 259
             G   VR HNV
Sbjct: 237 MKGVRGVRVHNV 248


>DHPS_STAHA RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 267

 Score =  168 bits (426), Expect = 7e-44
 Identities = 102/255 (40%), Positives = 141/255 (55%), Gaps = 9/255 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           ++GILNVTPDSFSDGG+++  D A+A A+ M +EG  IIDVGG STRPG   VS+     
Sbjct: 6   IIGILNVTPDSFSDGGKYNSVDKAIARAKEMIDEGVDIIDVGGVSTRPGHTEVSLXXXXX 65

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRDSDCGL 135
                   L + DV +S+DT  +EVA ACL+ GA ++ND  +G  DP + D V D +  +
Sbjct: 66  XXXXXXXQLVKLDVQISVDTYRSEVAEACLKLGATMINDQWAGLYDPKIFDVVSDYNAEI 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQ 195
           V+MH  GD    Q       VV ++   L  +A   E AG+    I +DPG GF K+ S+
Sbjct: 126 VLMH-NGDGQREQ------PVVEEMLLSLLTQANKAEMAGIEKGNIWLDPGIGFAKSRSE 178

Query: 196 TLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMACELGASVV 254
             E++    E V   YPV++A SRK F+    G +  P+ RDE +AA  +     G   V
Sbjct: 179 EKEVMARLDELVATEYPVLLATSRKRFIKEMIGKETTPAERDEATAATTVYGIMKGIQAV 238

Query: 255 RAHNVAATVAALEGL 269
           R HNV   V   + +
Sbjct: 239 RVHNVDLNVKLAQSI 253


>DHPS_STAES RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 272

 Score =  168 bits (426), Expect = 7e-44
 Identities = 105/252 (41%), Positives = 142/252 (56%), Gaps = 18/252 (7%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPG-----AAPVSV 71
           +MGILNVTPDSFSDGGQ+   D A+  A+ M +EG  IIDVGG STRPG        VS+
Sbjct: 6   IMGILNVTPDSFSDGGQYHSVDQAVKRAKEMIDEGVDIIDVGGVSTRPGHKEVSHKEVSL 65

Query: 72  DEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDV-SGFRDPAMVDAVRD 130
            EE+ RVLPVV ++ + DV +S+DT  +EVA ACL+ G +++ND  +G  D  M + V  
Sbjct: 66  KEEMNRVLPVVESIVKYDVQISVDTFRSEVAEACLKLGVSMINDQWAGLFDSNMFNVVSQ 125

Query: 131 SDCGLVVMHMQGDPSTMQNAPSYDD--VVADVREWLRDRAAALEAAGVAHDRICIDPGPG 188
               +V+ H         N   + D  VV ++   L  +A   E AG+ H++I +DPG G
Sbjct: 126 YGAEIVLTH---------NGDGHRDKPVVEEMLVSLLAQANKAELAGIPHNKIWLDPGIG 176

Query: 189 FGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGID-EPSARDEVSAAEALMAC 247
           F KT  +  E++    E V   YPV++A SRK ++      D  PS RDE +AA      
Sbjct: 177 FPKTREEENEVMARLDELVATEYPVLLATSRKRYIKEMMNQDSSPSDRDEATAATTAYGI 236

Query: 248 ELGASVVRAHNV 259
             G   VR HNV
Sbjct: 237 MKGVRGVRVHNV 248


>DHPS_BACSU RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 285

 Score =  165 bits (418), Expect = 6e-43
 Identities = 97/246 (39%), Positives = 139/246 (56%), Gaps = 10/246 (4%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           +VMGILNVTPDSFSDGG++D  D AL HA+ M            ESTRPGA  VS DEE+
Sbjct: 26  LVMGILNVTPDSFSDGGKYDSLDKALLHAKEMXXXXXXXXXXXXESTRPGAECVSEDEEM 85

Query: 76  ARVLPVV-RALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDC 133
           +RV+PV+ R   +  V +S+DT  A VA   ++AGA+I+ND+ G + DP M     + + 
Sbjct: 86  SRVIPVIERITKELGVPISVDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNV 145

Query: 134 GLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTP 193
            +V+MH + +        +Y+D++ D+   L +       AGV    I +DPG GF KT 
Sbjct: 146 PIVLMHNRPE-------RNYNDLLPDMLSDLMESVKIAVEAGVDEKNIILDPGIGFAKTY 198

Query: 194 SQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASV 253
              L ++   + F  LGYPV++A SRK F+G    +  P  R E + A   +  + G  +
Sbjct: 199 HDNLAVMNKLEIFSGLGYPVLLATSRKRFIGRVLDL-PPEERAEGTGATVCLGIQKGCDI 257

Query: 254 VRAHNV 259
           VR H+V
Sbjct: 258 VRVHDV 263


>FOL1_PNECA RecName: Full=Folic acid synthesis protein
           fol1;Includes:  RecName: Full=Dihydroneopterin aldolase;
                     Short=DHNA;
          Length = 740

 Score =  164 bits (414), Expect = 2e-42
 Identities = 95/251 (37%), Positives = 143/251 (56%), Gaps = 9/251 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +M ILN+TPDSF DGG H  +D+ L   E+    GA IID+GG+STRPG+  + ++EE+ 
Sbjct: 473 IMAILNLTPDSFFDGGIHS-YDSVLIDVEKFINAGATIIDIGGQSTRPGSYIIPLEEEIF 531

Query: 77  RVLPVVRALAQR--DVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDC 133
           RV+P ++ L +   D+ +SIDT  +EVA   ++AGA++VND+SG R DP M + V     
Sbjct: 532 RVIPAIKYLQKTYPDILISIDTFRSEVAEQAVKAGASLVNDISGGRYDPKMFNTVARLKV 591

Query: 134 GLVVMHMQGDPSTMQNAPSY-DDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKT 192
            + +MHM+G+   M N   Y  D++  +   L     + E +G+    I +DPG GF KT
Sbjct: 592 PICIMHMRGNFLNMDNLTDYGTDIIEQITIELEKLLNSAEKSGIPRWNIILDPGLGFSKT 651

Query: 193 PSQTLELVRNFQEFVRL----GYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
             Q +EL+R F E        G P ++  SRK F G+  G + P  R   + A  + +  
Sbjct: 652 LHQNIELLRRFNELKSKNCFNGLPWLLGPSRKRFTGFITGDNMPKDRIWGTVAAVVASIS 711

Query: 249 LGASVVRAHNV 259
            G  ++R H+V
Sbjct: 712 GGCDIIRVHDV 722



 Score = 99.0 bits (245), Expect = 7e-23
 Identities = 50/131 (38%), Positives = 82/131 (62%), Gaps = 1/131 (0%)

Query: 280 NVPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVL 339
           N  +  S G     +I  +  AI ++ S+   +++  S  YES+P Y+ DQ +F NAV  
Sbjct: 293 NEAVYISLGSNLGNRIKFILDAIEKM-SIKGIKVLKTSMLYESKPMYFKDQPAFYNAVCK 351

Query: 340 LRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLE 399
           ++T + P++LL  L  +E  LGRV+ +  GPR  DLDI+ Y   +++++ L +PHPR+LE
Sbjct: 352 VQTSLHPEQLLFELQLIEKELGRVKVIDKGPRCIDLDIVFYGRKIINSESLIIPHPRVLE 411

Query: 400 RDFVVQPLLEL 410
           R FV++PLL++
Sbjct: 412 RSFVLKPLLDI 422


>FOL1_SCHPO RecName: Full=Folic acid synthesis protein
           fol1;Includes:  RecName: Full=Dihydroneopterin aldolase;
                     Short=DHNA;
          Length = 686

 Score =  159 bits (403), Expect = 3e-41
 Identities = 100/251 (39%), Positives = 142/251 (56%), Gaps = 9/251 (3%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           + MGILNVTPDSFSDGG+    +  L  A+ M  +GA I+D+GG+ST+PGA PVSV+EEL
Sbjct: 419 LTMGILNVTPDSFSDGGKVSQ-NNILEKAKSMVGDGASILDIGGQSTKPGADPVSVEEEL 477

Query: 76  ARVLPVVRALAQRDVCV--SIDTRHAEVARACLEAGAAIVNDVS-GFRDPAMVDAVRDSD 132
            RV+P++  L    + V  SIDT +++VA+  +EAGA I+NDV+ G  D  M+       
Sbjct: 478 RRVIPMISLLRSSGITVPISIDTYYSKVAKLAIEAGANIINDVTGGMGDEKMLPLAASLQ 537

Query: 133 CGLVVMHMQGDPSTMQNAPSYD-DVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGK 191
             + +MHM+G P TM+    Y+ D+V +V   L  R  A   +GV    I +DPG GF K
Sbjct: 538 VPICIMHMRGTPETMKALSIYEKDIVEEVAVELSSRVEAAVQSGVHRYNIILDPGFGFAK 597

Query: 192 TPSQTLELVRNFQEFVR----LGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMAC 247
           TP Q+  L+    E ++         +   SRK F G+  G   P  R   ++A    + 
Sbjct: 598 TPKQSAGLLGRLHELMKKPQFKDMHWLSGPSRKGFTGYFTGDASPKDRIWGTSACVTASV 657

Query: 248 ELGASVVRAHN 258
             G S+VR H+
Sbjct: 658 LQGVSIVRVHD 668



 Score =  105 bits (261), Expect = 1e-24
 Identities = 72/236 (30%), Positives = 117/236 (49%), Gaps = 13/236 (5%)

Query: 180 RICIDPGPGFGKTPSQTLELVRNFQEFVRLGYPVMV---AVSRKSFLGWAYGIDEPSARD 236
           R+C++    F  T  + LE+ R   E+V     + +    V+   +L +   +D+ S + 
Sbjct: 155 RVCLNIS--FANTEVEALEIARAIAEYVEQSAFLTIEALVVNLSKYLCFTKNLDDISIKA 212

Query: 237 EVSAAEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCNVPLVASPGEEREGKIA 296
           E  +A         AS V+ +   +     E L  Y       N     S G     K  
Sbjct: 213 EKPSAITFA----NASAVQIYRTRSYFLQ-ESLHKYESTK---NKIAYLSFGSNIGDKFE 264

Query: 297 MLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAV 356
            +  A++ L  +   +++D+S  YE+EP YY DQ SF+N V  + T + P  LL    ++
Sbjct: 265 QIQTALSMLHKIEGIRVLDVSPLYETEPMYYKDQPSFLNGVCKIETRMSPINLLRACQSI 324

Query: 357 ENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLP 412
           E  +GR++ +  GPR  DLDI+ Y+  V +++VLT+PH  L ER+FV++PLL L P
Sbjct: 325 EQEMGRIKTILKGPRCIDLDIVLYEDCVYESEVLTIPHLGLQEREFVLRPLLALSP 380


>DHP2_SHIFL RecName: Full=Dihydropteroate synthase type-2;       
           EC=2.5.1.15;AltName: Full=Dihydropteroate synthase type
           II;         Short=DHPS;
          Length = 271

 Score =  151 bits (381), Expect = 1e-38
 Identities = 85/211 (40%), Positives = 121/211 (57%), Gaps = 3/211 (1%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           I+ GI+N+T DSFSDGG++   DAA+A A ++  EGA +ID+G  S+ P AAPVS D E+
Sbjct: 6   IIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEI 65

Query: 76  ARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGL 135
           AR+ PV+ AL    + VS+D+         L  G A +ND+ GF D A    +  S   L
Sbjct: 66  ARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKL 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF--GKTP 193
           VVMH   D    +      D++  +  +   R AAL  AG+  +R+ +DPG GF  G  P
Sbjct: 126 VVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAP 185

Query: 194 SQTLELVRNFQEF-VRLGYPVMVAVSRKSFL 223
             +L ++  F E  +R   PV+++VSRKSFL
Sbjct: 186 ETSLSVLARFDELRLRFDLPVLLSVSRKSFL 216


>DHP2_ECOLX RecName: Full=Dihydropteroate synthase type-2;       
           EC=2.5.1.15;AltName: Full=Dihydropteroate synthase type
           II;         Short=DHPS;
          Length = 271

 Score =  151 bits (381), Expect = 1e-38
 Identities = 85/211 (40%), Positives = 121/211 (57%), Gaps = 3/211 (1%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           I+ GI+N+T DSFSDGG++   DAA+A A ++  EGA +ID+G  S+ P AAPVS D E+
Sbjct: 6   IIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEI 65

Query: 76  ARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGL 135
           AR+ PV+ AL    + VS+D+         L  G A +ND+ GF D A    +  S   L
Sbjct: 66  ARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKL 125

Query: 136 VVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF--GKTP 193
           VVMH   D    +      D++  +  +   R AAL  AG+  +R+ +DPG GF  G  P
Sbjct: 126 VVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAP 185

Query: 194 SQTLELVRNFQEF-VRLGYPVMVAVSRKSFL 223
             +L ++  F E  +R   PV+++VSRKSFL
Sbjct: 186 ETSLSVLARFDELRLRFDLPVLLSVSRKSFL 216


>DHPS1_MYCTU RecName: Full=Dihydropteroate synthase 1;       
           Short=DHPS 1;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase 1;
          Length = 280

 Score =  148 bits (373), Expect = 1e-37
 Identities = 100/258 (38%), Positives = 134/258 (51%), Gaps = 7/258 (2%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           VMG+LNVT DSFSDGG +   D                     ES+RPGA  V    E +
Sbjct: 8   VMGVLNVTDDSFSDGGCYLDLDDXXXXXXXXXXXXXXXXXXXXESSRPGATRVDPAVETS 67

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDCGL 135
           RV+PVV+ LA + + VSIDT  A+VARA L+ GA +VNDVSG R DPAM   + ++D   
Sbjct: 68  RVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPW 127

Query: 136 VVMHMQGDPSTMQNAP-SYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           V+MH +   +   + P  Y +VVA+VR                  R+ +DPG GF KT  
Sbjct: 128 VLMHWRAVSADTPHVPVRYGNVVAEVRXXXXXXXXXXXXXXXXXXRLVLDPGLGFAKTAQ 187

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAY----GIDEPS-ARDEVSAAEALMACEL 249
               ++    E V  G PV+V  SRK FLG       G+  P+  RD  +A  + +A   
Sbjct: 188 HNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAALH 247

Query: 250 GASVVRAHNVAATVAALE 267
           GA  VR H+V A+V A++
Sbjct: 248 GAWGVRVHDVRASVDAIK 265


>DHPS1_MYCBO RecName: Full=Dihydropteroate synthase 1;       
           Short=DHPS 1;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase 1;
          Length = 280

 Score =  148 bits (373), Expect = 1e-37
 Identities = 100/258 (38%), Positives = 134/258 (51%), Gaps = 7/258 (2%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           VMG+LNVT DSFSDGG +   D                     ES+RPGA  V    E +
Sbjct: 8   VMGVLNVTDDSFSDGGCYLDLDDXXXXXXXXXXXXXXXXXXXXESSRPGATRVDPAVETS 67

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDCGL 135
           RV+PVV+ LA + + VSIDT  A+VARA L+ GA +VNDVSG R DPAM   + ++D   
Sbjct: 68  RVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPW 127

Query: 136 VVMHMQGDPSTMQNAP-SYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
           V+MH +   +   + P  Y +VVA+VR                  R+ +DPG GF KT  
Sbjct: 128 VLMHWRAVSADTPHVPVRYGNVVAEVRXXXXXXXXXXXXXXXXXXRLVLDPGLGFAKTAQ 187

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAY----GIDEPS-ARDEVSAAEALMACEL 249
               ++    E V  G PV+V  SRK FLG       G+  P+  RD  +A  + +A   
Sbjct: 188 HNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAALH 247

Query: 250 GASVVRAHNVAATVAALE 267
           GA  VR H+V A+V A++
Sbjct: 248 GAWGVRVHDVRASVDAIK 265


>DHP1_PSEAE RecName: Full=Dihydropteroate synthase type-1;       
           EC=2.5.1.15;AltName: Full=Dihydropteroate synthase type
           I;         Short=DHPS;
          Length = 279

 Score =  142 bits (359), Expect = 4e-36
 Identities = 92/249 (36%), Positives = 134/249 (53%), Gaps = 6/249 (2%)

Query: 14  MPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDE 73
           M  V GILN+T DSF D  +      A+  A  M   G+ ++DVG  ++ P A PVS  +
Sbjct: 1   MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD 60

Query: 74  ELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDC 133
           E+ R+ P++ AL+ +   VSID+   E  R  L+ G   +ND+ GF DPA+   + ++DC
Sbjct: 61  EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC 120

Query: 134 GLVVMH--MQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF-- 189
            LVVMH   +   +T       +D + ++  +   R +AL  +GVA DR+ +DPG GF  
Sbjct: 121 RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL 180

Query: 190 GKTPSQTLELVRNFQEF-VRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
              P  +L ++ N Q+    LG P++V+VSRKSFLG   G+          AAE L A  
Sbjct: 181 SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIG 239

Query: 249 LGASVVRAH 257
            GA  VR H
Sbjct: 240 NGADYVRTH 248


>DHP1_ECOLX RecName: Full=Dihydropteroate synthase type-1;       
           EC=2.5.1.15;AltName: Full=Dihydropteroate synthase type
           I;         Short=DHPS;
          Length = 279

 Score =  142 bits (359), Expect = 4e-36
 Identities = 92/249 (36%), Positives = 134/249 (53%), Gaps = 6/249 (2%)

Query: 14  MPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDE 73
           M  V GILN+T DSF D  +      A+  A  M   G+ ++DVG  ++ P A PVS  +
Sbjct: 1   MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD 60

Query: 74  ELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDC 133
           E+ R+ P++ AL+ +   VSID+   E  R  L+ G   +ND+ GF DPA+   + ++DC
Sbjct: 61  EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC 120

Query: 134 GLVVMH--MQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF-- 189
            LVVMH   +   +T       +D + ++  +   R +AL  +GVA DR+ +DPG GF  
Sbjct: 121 RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL 180

Query: 190 GKTPSQTLELVRNFQEF-VRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
              P  +L ++ N Q+    LG P++V+VSRKSFLG   G+          AAE L A  
Sbjct: 181 SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIG 239

Query: 249 LGASVVRAH 257
            GA  VR H
Sbjct: 240 NGADYVRTH 248


>DHP1_CORGL RecName: Full=Dihydropteroate synthase type-1;       
           EC=2.5.1.15;AltName: Full=Dihydropteroate synthase type
           I;         Short=DHPS;
          Length = 279

 Score =  142 bits (359), Expect = 4e-36
 Identities = 92/249 (36%), Positives = 134/249 (53%), Gaps = 6/249 (2%)

Query: 14  MPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDE 73
           M  V GILN+T DSF D  +      A+  A  M   G+ ++DVG  ++ P A PVS  +
Sbjct: 1   MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD 60

Query: 74  ELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDC 133
           E+ R+ P++ AL+ +   VSID+   E  R  L+ G   +ND+ GF DPA+   + ++DC
Sbjct: 61  EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC 120

Query: 134 GLVVMH--MQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF-- 189
            LVVMH   +   +T       +D + ++  +   R +AL  +GVA DR+ +DPG GF  
Sbjct: 121 RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL 180

Query: 190 GKTPSQTLELVRNFQEF-VRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
              P  +L ++ N Q+    LG P++V+VSRKSFLG   G+          AAE L A  
Sbjct: 181 SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIG 239

Query: 249 LGASVVRAH 257
            GA  VR H
Sbjct: 240 NGADYVRTH 248


>DHPS_CLOB8 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 269

 Score =  142 bits (358), Expect = 5e-36
 Identities = 86/245 (35%), Positives = 125/245 (51%), Gaps = 9/245 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILN TPDSFSDGG+ +  D A+ H + M + GA IIDVGGESTRPG           
Sbjct: 16  IMGILNFTPDSFSDGGKFNDIDVAVKHVKEMIDNGADIIDVGGESTRPGYXXXXXXXXXX 75

Query: 77  RVLPVVRALAQR-DVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDS-DCG 134
                 +A+ +  D+ VSIDT  A+VA   +EAGA ++ND+ GF             +  
Sbjct: 76  XXXXXXKAIKEDFDIPVSIDTYKAKVAEQAIEAGANLINDIWGFXXXXXXXXXXXXYNVP 135

Query: 135 LVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPS 194
             +MH + +         Y +++ D+   L++     + AGV  + I +DPG GFGKT  
Sbjct: 136 CCLMHNRDN-------TEYKNLMEDILNDLKECINIAKDAGVKDENIILDPGIGFGKTYE 188

Query: 195 QTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVV 254
           Q LE + N +    LGYP+++  SRKS +G A  +      +   A   +   +     V
Sbjct: 189 QNLEAMNNLERIKELGYPILLGTSRKSMIGLALNLPVEERIEGTVATTVIGIMKDACDFV 248

Query: 255 RAHNV 259
           R H+V
Sbjct: 249 RVHDV 253


>DHP1_MYCFO RecName: Full=Dihydropteroate synthase type-1;       
           EC=2.5.1.15;AltName: Full=Dihydropteroate synthase type
           I;         Short=DHPS;
          Length = 283

 Score =  142 bits (357), Expect = 7e-36
 Identities = 91/246 (36%), Positives = 133/246 (54%), Gaps = 6/246 (2%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           V GILN+T DSF D  +      A+  A  M   G+ ++DVG  ++ P A PVS  +E+ 
Sbjct: 8   VFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPADEIR 67

Query: 77  RVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLV 136
           R+ P++ AL+ +   VSID+   E  R  L+ G   +ND+ GF DPA+   + ++DC LV
Sbjct: 68  RIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLV 127

Query: 137 VMH--MQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGF--GKT 192
           VMH   +   +T       +D + ++  +   R +AL  +GVA DR+ +DPG GF     
Sbjct: 128 VMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFLSPA 187

Query: 193 PSQTLELVRNFQEF-VRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGA 251
           P  +L ++ N Q+    LG P++V+VSRKSFLG   G+          AAE L A   GA
Sbjct: 188 PETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAE-LHAIGNGA 246

Query: 252 SVVRAH 257
             VR H
Sbjct: 247 DYVRTH 252


>FOLKP_CHLPN RecName: Full=Folate synthesis bifunctional
           protein;Includes:  RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;
          Length = 450

 Score =  131 bits (329), Expect = 1e-32
 Identities = 88/270 (32%), Positives = 142/270 (52%), Gaps = 16/270 (5%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAP-VSVDEE 74
           ++MG++NVT DS SDGG     + A+A AE++  EGA +ID G ++T P     +SVD+E
Sbjct: 182 MLMGVVNVTNDSMSDGGMFLDPEKAVAQAEKLFTEGAAVIDFGAQATNPKVKQFLSVDQE 241

Query: 75  LARVLPVVRALAQ------RDVCVSIDTRHAEVARACLEA-GAAIVNDVSGFRDPAMVDA 127
             R+ PV+R L +      +   +S+DT + E+    ++      +NDVSG    +M + 
Sbjct: 242 WERLEPVLRLLKETWSNRKQYPIISLDTFYPEIILRAMDIYPIQWINDVSG-GSQSMAEV 300

Query: 128 VRDSDCGLVVMHMQGDPSTMQNAPSYDDVVAD-VREWLRDRAAALEAAGVAHDRICIDPG 186
            RD +  LV+ H    P   +N  S+   + + +  W   +       G+  +++  DPG
Sbjct: 301 ARDCELSLVMNHSSSLPVDPKNILSFSVPIGEQLLSWGEKQLKMFSDVGLNANQVIFDPG 360

Query: 187 PGFGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMA 246
            GFGK  +Q+L  +    +F RLG P+++  SRKSFL   +G  +P  RD  +   +++ 
Sbjct: 361 IGFGKGAAQSLATLYEIAKFKRLGCPILIGHSRKSFLS-LFGNHDPKDRDWETVGLSILL 419

Query: 247 CELGASVVRAHNVAA-----TVAALEGLRP 271
            + G   +R HNVAA     +VAA E   P
Sbjct: 420 QQQGVDYLRVHNVAAHQKALSVAACEACAP 449



 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRN-GPRTCDLDILDY--QLYVVDADV 389
           + N+V++  T +  +ELL  +  +E  +GR  E     PRT D+DIL Y  + +  D   
Sbjct: 61  YFNSVLVGETTLSLRELLVTIKQIEKVVGRAEESPPWSPRTIDVDILLYGDESFCCDHTE 120

Query: 390 LTLPHPRLLERDFVVQPLLELLP 412
           +T+P   LL R F++  +  L P
Sbjct: 121 ITIPLSNLLSRPFLIALIASLCP 143


>DHPS2_MYCLE RecName: Full=Dihydropteroate synthase 2;       
           Short=DHPS 2;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase 2;
          Length = 291

 Score =  117 bits (294), Expect = 1e-28
 Identities = 90/269 (33%), Positives = 121/269 (44%), Gaps = 15/269 (5%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           ++M I+N TPDSF D G                      IDVGG    PG   V VD E+
Sbjct: 16  LIMAIVNRTPDSFYDRGATFSXXXXXXXXXXXXXXXXXXIDVGGVKAGPGQG-VDVDTEI 74

Query: 76  ARVLPVVRAL--AQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDC 133
           AR++P +  L  A  D+ +S+DT  AEVAR    AGA ++ND  G  DPAM +   +   
Sbjct: 75  ARLVPFIEWLRSAYTDLLISVDTWRAEVARLACTAGADLINDSWGGADPAMHEVAAELGA 134

Query: 134 GLVVMHMQGD-PSTMQNAPSYD----DVVADVREWLRDRAAALEAAGVAHDRICIDPGPG 188
           GLV  H  G  P T     SY      VV DV                  D + +DP   
Sbjct: 135 GLVCSHTGGALPRTRPFRVSYGTTTRGVVDDVIRQXXXXXXXXXXXXXXXDSVLVDPTHD 194

Query: 189 FGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
           FGK     L L+R+  E V+ G+PV++++S K F+G   G+   + R E           
Sbjct: 195 FGKNTFHGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVG-LTERLEGXXXXXXXXXX 253

Query: 249 LGASVVRAHNVAAT------VAALEGLRP 271
            G  + R H V AT      VA+++G RP
Sbjct: 254 XGVRMFRVHEVVATRRVLEMVASIQGTRP 282


>DHPS_STRR6 RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 314

 Score =  117 bits (292), Expect = 2e-28
 Identities = 89/285 (31%), Positives = 131/285 (45%), Gaps = 34/285 (11%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           ++ GI+NVTPDSFSDGG             ++  EGA ++D+GGESTRPG++ V ++EE+
Sbjct: 11  VICGIINVTPDSFSDGGXXXXXXXXXXXXRKLIAEGASMLDIGGESTRPGSSYVEIEEEI 70

Query: 76  ARVLPVVRAL-AQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDC 133
            RV+PV++A+  + DV +SIDT  ++V          +VND++G   D  M   V ++  
Sbjct: 71  QRVVPVIKAIRKESDVLISIDTWKSQVXXXXXXXXXDLVNDITGLMGDEKMPHVVAEARA 130

Query: 134 GLV-----VMHMQGDPSTMQNAPSYDDVVADVREWLRD----------------RAAALE 172
            +V     VM     PS++   P +    A   E L D                      
Sbjct: 131 QVVIMFNPVMARPQHPSSL-IFPHFGFGQAFTEEELADFETLPIEELMXXXXXXXXXXXX 189

Query: 173 AAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFL-------GW 225
             G+A + I +DPG GFG                   GYP+ + VSRK F+       G+
Sbjct: 190 XXGIAPENILLDPGIGFGXXXXXXXXXXXXXXXXXXXGYPIFLGVSRKRFVINILEENGF 249

Query: 226 AYGIDEPSA---RDEVSAAEALMACELGASVVRAHNVAATVAALE 267
               +       RD  SA    +A   G  VVR H+VA+   A+E
Sbjct: 250 EVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHRMAVE 294


>FOLKP_CHLCV RecName: Full=Folate synthesis bifunctional
           protein;Includes:  RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;
          Length = 447

 Score =  116 bits (291), Expect = 3e-28
 Identities = 80/260 (30%), Positives = 136/260 (52%), Gaps = 11/260 (4%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAP-VSVDEE 74
           ++MG++NVT +S SD G +     A+AHAE++  +GA +ID GG++T P     ++V++E
Sbjct: 180 LLMGVVNVTDNSISDEGLYLEASKAVAHAEKLFAQGASVIDFGGQATNPKVQQLLNVEQE 239

Query: 75  LARVLPVVRALAQRDV------CVSIDTRHAEVARACLEA-GAAIVNDVSGFRDPAMVDA 127
            +R+ PV++ LA++         +S+DT + E+ +  LE      +NDVSG     M + 
Sbjct: 240 WSRLEPVLKLLAEKWAGRRQYPDISLDTFYPEIIKRALEIYPIRWINDVSG-GSKEMAEI 298

Query: 128 VRDSDCGLVVMHMQGDPSTMQNAPSYDDVVAD-VREWLRDRAAALEAAGVAHDRICIDPG 186
            RD++  LV+ H    P       ++    +D +  W   +  A  A G+  D+I  DPG
Sbjct: 299 ARDANLLLVINHSCSLPPRPDKTLAFTTCASDQLLSWGEKQIEAFVALGLRQDQIIFDPG 358

Query: 187 PGFGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMA 246
            GFG T  Q L ++   ++F +LG   +V  SRKS      G  +   RD  + + +++ 
Sbjct: 359 IGFGTTQIQALNVLHKMKKFRKLGCATLVGHSRKSCFS-LLGKYDAKDRDWETVSLSVLL 417

Query: 247 CELGASVVRAHNVAATVAAL 266
            + G + +R H+V A    L
Sbjct: 418 QQQGVNYLRVHDVEANQRVL 437



 Score = 48.9 bits (115), Expect = 8e-08
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGR-VREVRNGPRTCDLDILDYQLYVVDADVLT 391
           F N+V++ +T + PK+LL  +  +E  LGR V  +   PR  D+DIL Y       + + 
Sbjct: 61  FFNSVLIGKTTLSPKQLLSGVKQIERRLGRDVNALPWSPRVLDIDILLYGDENHQQEDVK 120

Query: 392 LPHPRLLERDFVVQPLLELLPGHV 415
           +PH R+ ER F++  +  L P  +
Sbjct: 121 IPHERITERPFLLSLIASLCPTRI 144


>DHPS_STRPN RecName: Full=Dihydropteroate synthase;       
           Short=DHPS;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase;
          Length = 314

 Score =  115 bits (288), Expect = 7e-28
 Identities = 83/284 (29%), Positives = 129/284 (45%), Gaps = 32/284 (11%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           ++ GI+NVTPDSFSDGG             ++  EGA ++D+GGESTRPG++ V ++EE+
Sbjct: 11  VICGIINVTPDSFSDGGXXXXXXXXXXXXRKLIAEGASMLDIGGESTRPGSSYVEIEEEI 70

Query: 76  ARVLPVVRAL-AQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR-DPAMVDAVRDSDC 133
            RV+PV++A+  + DV +SIDT  ++V          +VND++G   D  M   V ++  
Sbjct: 71  QRVVPVIKAIRKESDVLISIDTWKSQVXXXXXXXXXDLVNDITGLMGDEKMAYVVAEARA 130

Query: 134 GLVVMHMQ------------------GDPSTMQNAPSYDDVVAD--VREWLRDRAAALEA 173
            +V+M                     G   T +    ++ +  +  +             
Sbjct: 131 KVVIMFNPVMARPQHPSSLIFPHFGFGQTFTEKELADFETLPIEDLMVXXXXXXXXXXXX 190

Query: 174 AGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFL-------GWA 226
            G+A + I +DPG GFG                   GYP+ + VSRK F+       G+ 
Sbjct: 191 XGIAPENILLDPGIGFGXXXXXXXXXXXXXXXXXXXGYPIFLGVSRKRFVINILEENGFE 250

Query: 227 YGIDEPSA---RDEVSAAEALMACELGASVVRAHNVAATVAALE 267
              +       RD  SA    +A   G  VVR H+VA+   A+E
Sbjct: 251 VNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHRMAVE 294


>FOL1_YEAST RecName: Full=Folic acid synthesis protein
           FOL1;Includes:  RecName: Full=Dihydroneopterin aldolase;
                     Short=DHNA;
          Length = 824

 Score =  114 bits (285), Expect = 2e-27
 Identities = 88/301 (29%), Positives = 137/301 (45%), Gaps = 58/301 (19%)

Query: 17  VMGILNVTPDSFSDGGQHDG-FDAALAHAERMAEEG-----ARIIDVGGESTRPGAAPVS 70
           +M I N TPDSFSDGG+H    ++ L    ++ ++      + IIDVGG STRP +   S
Sbjct: 506 IMAIFNATPDSFSDGGEHFADIESQLNDIIKLCKDALYLHESVIIDVGGCSTRPNSIQAS 565

Query: 71  VDEELARVLPVVRA------LAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSG--FRDP 122
            +EE+ R +P+++A      L Q  V +SIDT  + VA+  ++ G  I+ND+SG  F   
Sbjct: 566 EEEEIRRSIPLIKAIRESTELPQDKVILSIDTYRSNVAKEAIKVGVDIINDISGGLFDSN 625

Query: 123 AMVDAVRDSDCGLVVMHMQGDPSTMQNAPSYDD--------------------------- 155
                  + +   ++ H +GD STM     Y++                           
Sbjct: 626 MFAVIAENPEICYILSHTRGDISTMNRLAHYENFALGDSIQQEFVHNTDIQQLDDLKDKT 685

Query: 156 -VVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVR------------- 201
            ++ +V + + +R       GV   +I IDPG GF KT  Q L+++R             
Sbjct: 686 VLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRHIPILKNYSFTMN 745

Query: 202 --NFQEFVRL-GYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHN 258
             N Q +V L   PV++  SRK F+G      +   RD  + A        G+ +VR H+
Sbjct: 746 SNNSQVYVNLRNMPVLLGPSRKKFIGHITKDVDAKQRDFATGAVVASCIGFGSDMVRVHD 805

Query: 259 V 259
           V
Sbjct: 806 V 806



 Score = 83.6 bits (205), Expect = 3e-18
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 7/108 (6%)

Query: 315 DISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVE-NSLGRVREVRNGPRTC 373
           +ISS +ESEP Y+ DQ  F+N  V + T + P ELL     +E   L RV+   NGPRT 
Sbjct: 332 NISSIFESEPMYFKDQTPFMNGCVEVETLLTPSELLKLCKKIEYEELQRVKHFDNGPRTI 391

Query: 374 DLDILDY-----QLYVVDADVLTLPHPRLLERDFVVQPLLELL-PGHV 415
           DLDI+ +     +  +V+   L +PHPR+LER FV++PL EL+ P H+
Sbjct: 392 DLDIVMFLNSAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHL 439


>FOL1_DICDI RecName: Full=Folic acid synthesis protein
           FOL1;Includes:  RecName: Full=Dihydroneopterin aldolase;
                     Short=DHNA;
          Length = 657

 Score =  107 bits (267), Expect = 2e-25
 Identities = 53/114 (46%), Positives = 81/114 (71%), Gaps = 4/114 (3%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEELA 76
           +MGILNVTPDSF DGG+ +  + ++  A  + E+GA IID+GG+ST PGA  +S++EE+ 
Sbjct: 335 IMGILNVTPDSFVDGGKFNTLEKSIQQATALIEQGADIIDIGGQSTYPGAQQISIEEEIN 394

Query: 77  RVLPVVRALAQ---RDVCVSIDTRHAEVARACLEAGAAIVNDVSG-FRDPAMVD 126
           RV+P ++ + +    D+ +SIDT H +VA+  + AG  I+NDVSG FR P +++
Sbjct: 395 RVVPTIKKIREVLGNDIPLSIDTLHHQVAKEAILAGCNIINDVSGEFRVPIILN 448



 Score = 96.7 bits (239), Expect = 3e-22
 Identities = 44/103 (42%), Positives = 62/103 (60%)

Query: 313 IVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRT 372
           I   S  YES P YY +QDSF N    + T + P +LL ++  +EN +GRV   RNGPR 
Sbjct: 176 IQSTSFMYESSPQYYREQDSFYNCACKVSTDLKPHDLLKFIKQIENDMGRVETFRNGPRV 235

Query: 373 CDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHV 415
            D+DI+ Y   ++  D L +PHP + ERDFV+ PL ++ P  +
Sbjct: 236 IDIDIIYYNGLIIKTDDLEIPHPLMWERDFVLLPLSDIAPNFI 278



 Score = 45.8 bits (107), Expect = 7e-07
 Identities = 20/49 (40%), Positives = 34/49 (69%)

Query: 175 GVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFL 223
           G+   +I +DPG GF KT  Q++E+++  +E + LG+PV++  SRK F+
Sbjct: 538 GLFRWQIILDPGLGFYKTYEQSIEILQRGKELMGLGFPVLIGPSRKGFI 586


>FOLKP_CHLMU RecName: Full=Folate synthesis bifunctional
           protein;Includes:  RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;
          Length = 450

 Score =  101 bits (251), Expect = 1e-23
 Identities = 89/256 (34%), Positives = 128/256 (50%), Gaps = 17/256 (6%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPV-SVDEEL 75
           +MGI+NVT DS SD G       A AHAER+  EGA IID+G ++T P    + SV++E 
Sbjct: 182 IMGIVNVTDDSISDTGLFLEAKRAAAHAERLFAEGASIIDLGAQATNPRVRDLGSVEQEW 241

Query: 76  ARVLPVVRALAQ--RDV----CVSIDTRHAEVARACLEA-GAAIVNDVSGFRDPAMVDAV 128
            R+ PV++ LA+  +D      VSIDT   EV R  ++      +NDVSG     M    
Sbjct: 242 ERLEPVLQILAESWKDAKQYPDVSIDTFRPEVIRRAIQVFPIRWINDVSG-GSLEMAHLA 300

Query: 129 RDSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEA-AGVAHD---RICID 184
           +D    L++ H    P       SY++  + V + LR   + LE  A +  D   ++  D
Sbjct: 301 KDLGLRLLINHSCSLPPRPDCVLSYEE--SPVTQMLRWGESQLETFAQIGLDTSWQVVFD 358

Query: 185 PGPGFGKTPSQTLELVRNFQEFVR-LGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEA 243
           PG GFGKTP Q+++L+    +F   L  PV++  SRKS L    G      RD  +   +
Sbjct: 359 PGIGFGKTPVQSMQLMEGVAKFKHILKCPVLIGHSRKSCLS-LLGRFSSQDRDWETIGCS 417

Query: 244 LMACELGASVVRAHNV 259
           +     G   +R H V
Sbjct: 418 VALHNQGVDYLRVHQV 433



 Score = 56.2 bits (134), Expect = 5e-10
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDY--QLYVVDADVL 390
           + N V +  T + P EL+  +  +EN L R   ++ GPR+ D+D+L Y  + Y   ++  
Sbjct: 61  YFNCVAIGETQLSPDELVKEIKMIENRLSRDSSLKWGPRSIDIDVLLYGDESYSCCSERC 120

Query: 391 TLPHPRLLERDFVVQPLLELLP 412
            +PHPRLLER F++  +  L P
Sbjct: 121 IIPHPRLLERPFLLSMMASLCP 142


>HPPK_BACSU RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 167

 Score = 95.9 bits (237), Expect = 6e-22
 Identities = 50/113 (44%), Positives = 68/113 (60%)

Query: 298 LNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVE 357
           L QA+  L       +  +SS YE++P  Y DQ  F+N  V ++T + P ELL     +E
Sbjct: 20  LRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAQFLNMAVEIKTSLNPFELLELTQQIE 79

Query: 358 NSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLEL 410
           N LGR REVR GPRT DLDIL +    ++ + L +PHPR+ ER FV+ PL E+
Sbjct: 80  NELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMYERLFVLAPLAEI 132


>HPPK_ECOLI RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 159

 Score = 91.7 bits (226), Expect = 1e-20
 Identities = 55/141 (39%), Positives = 82/141 (58%), Gaps = 11/141 (7%)

Query: 273 ALIGMGCNVPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDS 332
           A I +G N+   ASP E+       +N A+  L  +P+S I+ +SSFY + P    DQ  
Sbjct: 4   AYIAIGSNL---ASPLEQ-------VNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD 53

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREV-RNGPRTCDLDILDYQLYVVDADVLT 391
           ++NA V L T + P+ELL +   +E   GRVR+  R GPRT DLDI+ +   V++ + LT
Sbjct: 54  YLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLT 113

Query: 392 LPHPRLLERDFVVQPLLELLP 412
           +PH  +  R F++ PL E+ P
Sbjct: 114 VPHYDMKNRGFMLWPLFEIAP 134


>HPPK_HAEIN RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 160

 Score = 90.1 bits (222), Expect = 3e-20
 Identities = 51/131 (38%), Positives = 73/131 (55%)

Query: 288 GEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPK 347
           G      +  L+ A+  +  L ++ +V  SSFY+S+P    DQ  +VNAV  + T + P 
Sbjct: 9   GSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPL 68

Query: 348 ELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPL 407
           +LL  L  +EN  GRVR  R G RT DLDIL Y   ++  + LT+PH  +  R+FV+ PL
Sbjct: 69  KLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPL 128

Query: 408 LELLPGHVLAN 418
            E+    VL N
Sbjct: 129 FEIASDLVLPN 139


>DHPS2_MYCTU RecName: Full=Dihydropteroate synthase 2;       
           Short=DHPS 2;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase 2;
          Length = 318

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 78/269 (28%), Positives = 108/269 (40%), Gaps = 15/269 (5%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           ++M I+N TPDSF D G                      IDVGG    PG   V VD E+
Sbjct: 43  LIMAIVNRTPDSFYDKGATFSXXXXXXXXXXXXXXXXXXIDVGGVKAGPGER-VDVDTEI 101

Query: 76  ARVLPVVRAL--AQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDC 133
            R++P +  L  A  D  +S+DT               ++ND  G  DPAM +   +   
Sbjct: 102 TRLVPFIEWLRGAYPDQLISVDTWRXXXXXXXXXXXXDLINDTWGGVDPAMPEVAAEFGA 161

Query: 134 GLVVMHMQGD-PSTMQNAPSYDD----VVADVREWLRDRAAALEAAGVAHDRICIDPGPG 188
           GLV  H  G  P T     SY      VV  V   +               ++ IDP   
Sbjct: 162 GLVCAHTGGALPRTRPFRVSYGTTTRGVVDAVISQVTXXXXXXXXXXXXXXKVLIDPAHD 221

Query: 189 FGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
           FGK     L L+R+  + V  G+PV++A+S K  +G   G+D                  
Sbjct: 222 FGKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVVGETLGVD-XXXXXXXXXXXXXXXXX 280

Query: 249 LGASVVRAHNVAAT------VAALEGLRP 271
               + R H VAAT      VA+++G+RP
Sbjct: 281 XXXXMFRVHEVAATRRVLEMVASIQGVRP 309


>DHPS2_MYCBO RecName: Full=Dihydropteroate synthase 2;       
           Short=DHPS 2;         EC=2.5.1.15;AltName:
           Full=Dihydropteroate pyrophosphorylase 2;
          Length = 318

 Score = 89.7 bits (221), Expect = 4e-20
 Identities = 78/269 (28%), Positives = 108/269 (40%), Gaps = 15/269 (5%)

Query: 16  IVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVSVDEEL 75
           ++M I+N TPDSF D G                      IDVGG    PG   V VD E+
Sbjct: 43  LIMAIVNRTPDSFYDKGATFSXXXXXXXXXXXXXXXXXXIDVGGVKAGPGER-VDVDTEI 101

Query: 76  ARVLPVVRAL--AQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDC 133
            R++P +  L  A  D  +S+DT               ++ND  G  DPAM +   +   
Sbjct: 102 TRLVPFIEWLRGAYPDQLISVDTWRXXXXXXXXXXXXDLINDTWGGVDPAMPEVAAEFGA 161

Query: 134 GLVVMHMQGD-PSTMQNAPSYDD----VVADVREWLRDRAAALEAAGVAHDRICIDPGPG 188
           GLV  H  G  P T     SY      VV  V   +               ++ IDP   
Sbjct: 162 GLVCAHTGGALPRTRPFRVSYGTTTRGVVDAVISQVTXXXXXXXXXXXXXXKVLIDPAHD 221

Query: 189 FGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACE 248
           FGK     L L+R+  + V  G+PV++A+S K  +G   G+D                  
Sbjct: 222 FGKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVVGETLGVD-XXXXXXXXXXXXXXXXX 280

Query: 249 LGASVVRAHNVAAT------VAALEGLRP 271
               + R H VAAT      VA+++G+RP
Sbjct: 281 XXXXMFRVHEVAATRRVLEMVASIQGVRP 309


>HPPK_METEA RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 158

 Score = 87.8 bits (216), Expect = 2e-19
 Identities = 55/147 (37%), Positives = 79/147 (53%), Gaps = 10/147 (6%)

Query: 273 ALIGMGCNVPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDS 332
           A +G+G N+            K AML  A+  L + P  ++V  S+ Y + P    DQD 
Sbjct: 4   AYLGLGSNIG----------DKAAMLAGAVEHLAATPGIRVVARSADYRTPPWGDTDQDW 53

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTL 392
           F+NA V + T + P  LL    ++E +LGRVRE R GPR  D+D+L Y+   V  + L L
Sbjct: 54  FLNAAVAIDTELTPHGLLEVCLSIEAALGRVRERRWGPRVIDIDVLAYEGAQVSDERLVL 113

Query: 393 PHPRLLERDFVVQPLLELLPGHVLAND 419
           PH  + ER FV+ PL E+ P  V+  +
Sbjct: 114 PHRFVRERAFVLVPLAEIAPDLVIGGE 140


>SULD_STRR6 RecName: Full=Bifunctional folate synthesis
           protein;Includes:  RecName: Full=Dihydroneopterin
           aldolase;           Short=DHNA;
          Length = 270

 Score = 85.5 bits (210), Expect = 8e-19
 Identities = 54/125 (43%), Positives = 74/125 (59%), Gaps = 1/125 (0%)

Query: 288 GEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPK 347
           G     K A L QAI +L +     I+  SS   +EP   ++QDSF N VV + T +P +
Sbjct: 127 GSNMGDKQANLKQAIDKLRAR-GIHILKESSVLATEPWGGVEQDSFANQVVEVETWLPAQ 185

Query: 348 ELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPL 407
           +LL  L A+E+ LGRVREV  GPR  DLD+L  +  ++  D L LPHP + ER FV++ L
Sbjct: 186 DLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESL 245

Query: 408 LELLP 412
            E+ P
Sbjct: 246 QEIAP 250


>SULD_STRPN RecName: Full=Bifunctional folate synthesis
           protein;Includes:  RecName: Full=Dihydroneopterin
           aldolase;           Short=DHNA;
          Length = 270

 Score = 85.5 bits (210), Expect = 8e-19
 Identities = 54/125 (43%), Positives = 74/125 (59%), Gaps = 1/125 (0%)

Query: 288 GEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPK 347
           G     K A L QAI +L +     I+  SS   +EP   ++QDSF N VV + T +P +
Sbjct: 127 GSNMGDKQANLKQAIDKLRAR-GIHILKESSVLATEPWGGVEQDSFANQVVEVETWLPAQ 185

Query: 348 ELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPL 407
           +LL  L A+E+ LGRVREV  GPR  DLD+L  +  ++  D L LPHP + ER FV++ L
Sbjct: 186 DLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESL 245

Query: 408 LELLP 412
            E+ P
Sbjct: 246 QEIAP 250


>FOLKE_LACLA RecName: Full=Bifunctional protein folKE;Includes:
           RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;
          Length = 349

 Score = 85.5 bits (210), Expect = 8e-19
 Identities = 45/114 (39%), Positives = 66/114 (57%)

Query: 298 LNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVE 357
           L++AI  L   P   I  +S+FYES P   + QD F N  + + T + P ELL ++H VE
Sbjct: 19  LHEAIRLLGKHPKIMIEKVSNFYESTPVGGVKQDDFTNLALKVATLLEPLELLSFIHEVE 78

Query: 358 NSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELL 411
            SL R R++  GPRT D+DI+ Y    +  + L +PH     R FV++P+ EL+
Sbjct: 79  LSLNRERKIHWGPRTIDIDIIFYDDLEMQVENLVIPHKEAFNRLFVLKPIFELI 132


>FOLKE_LACLM RecName: Full=Bifunctional protein folKE;Includes:
           RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;
          Length = 349

 Score = 85.1 bits (209), Expect = 1e-18
 Identities = 46/114 (40%), Positives = 66/114 (57%)

Query: 298 LNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVE 357
           L++AI  L   P   I  +S+FYES P   + QD F N  + + T + P ELL ++H VE
Sbjct: 19  LHEAIRLLGKHPKIMIEKVSNFYESSPVGGVKQDDFTNLALKVATLLEPLELLDFIHEVE 78

Query: 358 NSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELL 411
            SL R R++  GPRT D+DI+ Y    +  + L +PH     R FV++P+ ELL
Sbjct: 79  LSLNRERKIHWGPRTIDIDIIFYGNSEIQEENLIVPHKEAFNRLFVLKPIFELL 132


>FOLKP_CHLTR RecName: Full=Folate synthesis bifunctional
           protein;Includes:  RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;
          Length = 450

 Score = 84.3 bits (207), Expect = 2e-18
 Identities = 80/256 (31%), Positives = 121/256 (47%), Gaps = 17/256 (6%)

Query: 17  VMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPV-SVDEEL 75
           +MGI+N+T +S SD G                     IID+G ++T P    + SV++E 
Sbjct: 182 IMGIVNITDNSISDTGXXXXXXXXXXXXXXXXXXXXSIIDLGAQATNPRVKDLGSVEQEW 241

Query: 76  ARVLPVVRALAQR----DVC--VSIDTRHAEVARACLEA-GAAIVNDVSGFRDPAMVDAV 128
            R+ PV+R LA+R      C  VSIDT   E+ R  +E      +NDVSG     M    
Sbjct: 242 ERLEPVLRLLAERWGAAQQCPDVSIDTFRPEIIRRAVEVFPIRWINDVSG-GSLEMAHLA 300

Query: 129 RDSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEA-AGVAHD---RICID 184
           ++    L++ H    P       SY++  + + + LR   + LE  A V  D   ++  D
Sbjct: 301 KEFGLRLLINHSCSLPPRPDCVLSYEE--SPIEQMLRWGESQLEQFAQVGLDTSWQVVFD 358

Query: 185 PGPGFGKTPSQTLELVRNFQEFVR-LGYPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEA 243
           PG GFGKTP Q++ L+   ++F R L  PV++  SRKS L    G    + RD  +   +
Sbjct: 359 PGIGFGKTPVQSMLLMDGVKQFKRVLECPVLIGHSRKSCLS-MLGRFNSNDRDWETIGCS 417

Query: 244 LMACELGASVVRAHNV 259
           +   + G   +R H V
Sbjct: 418 VSLHDRGVDYLRVHQV 433



 Score = 57.0 bits (136), Expect = 3e-10
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDY--QLYVVDADVL 390
           + N+VV+  T + P EL+  +  +E+  G+   ++ GPR  D+D+L Y  + +   +D  
Sbjct: 61  YFNSVVIGETQLSPDELIEEIKMIESRFGQDASLKWGPRPIDIDVLFYGDEAFSYHSDKC 120

Query: 391 TLPHPRLLERDFVVQPLLELLP 412
           T+PHP++LER F++  +  L P
Sbjct: 121 TIPHPKVLERPFLLSMIASLCP 142


>HPPK_STRP8 RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 166

 Score = 83.6 bits (205), Expect = 3e-18
 Identities = 50/127 (39%), Positives = 68/127 (53%)

Query: 286 SPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIP 345
           S G     + A L +A+  L  LP ++++  SS YE+      DQ  F+N    L T + 
Sbjct: 7   SLGTNMRDRAAYLQKALETLADLPQTRLLAQSSIYETAAWGKTDQADFLNMACQLDTQLT 66

Query: 346 PKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQ 405
             + L    A+E SLGRVR  + G RT D+DIL +   V D   L +PHP + ER FV+ 
Sbjct: 67  AADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLI 126

Query: 406 PLLELLP 412
           PLLEL P
Sbjct: 127 PLLELQP 133


>HPPK_STRP3 RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 162

 Score = 81.3 bits (199), Expect = 1e-17
 Identities = 53/146 (36%), Positives = 73/146 (50%), Gaps = 6/146 (4%)

Query: 286 SPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIP 345
           S G     + A L +A+  L  LP ++++  SS YE+       Q  F+N    L T + 
Sbjct: 7   SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTSQADFLNMAYQLDTQLT 66

Query: 346 PKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQ 405
             + L    A+E SLGRVR  + G RT D+DIL +   V D   L +PHP + ER FV+ 
Sbjct: 67  AADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLI 126

Query: 406 PLLELL------PGHVLANDVPVSVD 425
           PLLEL       P H L  D   ++D
Sbjct: 127 PLLELQPDLKLPPNHKLLRDYLAALD 152


>HPPK_SYNY3 RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 195

 Score = 80.1 bits (196), Expect = 3e-17
 Identities = 51/143 (35%), Positives = 76/143 (53%), Gaps = 11/143 (7%)

Query: 273 ALIGMGCNVPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDS 332
           A++G+G N+  V          +  L  AI EL  +   ++   SS+Y S  A+   Q  
Sbjct: 16  AVVGLGGNIGPV----------LDNLQGAIAELALVAGIEVERCSSWYRSR-AFGPPQPD 64

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTL 392
           ++N  V LR  + P ELL  L A+E   GR+R  + GPRT DLD++ Y    ++   LT+
Sbjct: 65  YINGCVTLRVSLSPPELLQTLLAIEQKFGRIRLEKWGPRTLDLDLIFYGDRQLEQARLTI 124

Query: 393 PHPRLLERDFVVQPLLELLPGHV 415
           PHP++  R FV+ PL E+ P  V
Sbjct: 125 PHPQMQYRPFVLVPLAEIAPDWV 147


>HPPK_STRPY RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 166

 Score = 80.1 bits (196), Expect = 3e-17
 Identities = 49/127 (38%), Positives = 67/127 (52%)

Query: 286 SPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIP 345
           S G     + A L +A+  L  LP ++++  SS YE+       Q  F+N    L T + 
Sbjct: 7   SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQLDTQLT 66

Query: 346 PKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQ 405
             + L    A+E SLGRVR  + G RT D+DIL +   V D   L +PHP + ER FV+ 
Sbjct: 67  AADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLI 126

Query: 406 PLLELLP 412
           PLLEL P
Sbjct: 127 PLLELQP 133


>HPPK_STRP1 RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 166

 Score = 80.1 bits (196), Expect = 3e-17
 Identities = 49/127 (38%), Positives = 67/127 (52%)

Query: 286 SPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIP 345
           S G     + A L +A+  L  LP ++++  SS YE+       Q  F+N    L T + 
Sbjct: 7   SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQLDTQLT 66

Query: 346 PKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQ 405
             + L    A+E SLGRVR  + G RT D+DIL +   V D   L +PHP + ER FV+ 
Sbjct: 67  AADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLI 126

Query: 406 PLLELLP 412
           PLLEL P
Sbjct: 127 PLLELQP 133


>HPPK_STRP6 RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 166

 Score = 79.3 bits (194), Expect = 6e-17
 Identities = 52/146 (35%), Positives = 72/146 (49%), Gaps = 6/146 (4%)

Query: 286 SPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIP 345
           S G     + A L +A+  L  LP ++++  SS YE+       Q  F+N    L T + 
Sbjct: 7   SLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQLDTQLT 66

Query: 346 PKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQ 405
             + L    A+E SLGRVR  + G RT D+DIL +   V D   L +PHP + ER FV+ 
Sbjct: 67  AADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTERAFVLI 126

Query: 406 PLLELL------PGHVLANDVPVSVD 425
           PLLEL       P H    D   ++D
Sbjct: 127 PLLELQSDLKLPPNHKFLRDYLAALD 152


>HPPK_PORGI RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 147

 Score = 75.1 bits (183), Expect = 1e-15
 Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 298 LNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVE 357
           L  A  E+      +++ +S FYE+EP  +     F+NAVV LR+ + P+++L    A+E
Sbjct: 18  LLSAALEMLQTRVGRLLTLSRFYETEPWGFESPHPFLNAVVALRSELKPQDILHITQAIE 77

Query: 358 NSLGRVREVRNG---PRTCDLDILDYQLY-VVDADVLTLPHPRLLERDFVVQPLLELLP 412
             LGR ++   G    R  D+DIL + +Y  V +  L LPHP++ +RDFV  PL ++ P
Sbjct: 78  RELGRTQKSNGGVYHDRPIDIDILLHSVYPKVQSPELELPHPQMWQRDFVRMPLSDVAP 136


>HPPK_PORG3 RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 147

 Score = 75.1 bits (183), Expect = 1e-15
 Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 298 LNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVE 357
           L  A  E+      +++ +S FYE+EP  +     F+NAVV LR+ + P+++L    A+E
Sbjct: 18  LLSAALEMLQTRVGRLLTLSRFYETEPWGFESPHPFLNAVVALRSELKPQDILHITQAIE 77

Query: 358 NSLGRVREVRNG---PRTCDLDILDYQLY-VVDADVLTLPHPRLLERDFVVQPLLELLP 412
             LGR ++   G    R  D+DIL + +Y  V +  L LPHP++ +RDFV  PL ++ P
Sbjct: 78  RELGRTQKSNGGVYHDRPIDIDILLHSVYPKVQSPELELPHPQMWQRDFVRMPLSDVAP 136


>HPPK_HELPJ RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 163

 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 317 SSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVENSLGRVR--EVRNGPRTCD 374
           S  Y + P  Y +Q +F NA ++L+T +  +     +  +E   GR R  + ++ PRT D
Sbjct: 59  SPIYINPPFGYTNQPNFYNATIILKTSLGLRHFFALVFYIERRFGRARKRDFKDAPRTLD 118

Query: 375 LDILDYQLYVVDADVLTLPHPRLLERDFVVQPL 407
           +DI+ +   ++  + LTLPHP+  ERD V+ PL
Sbjct: 119 IDIIAFNQVILRQNDLTLPHPKWSERDSVLVPL 151


>HPPK_HELPY RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 163

 Score = 61.6 bits (148), Expect = 1e-11
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 317 SSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVENSLGRVR--EVRNGPRTCD 374
           S  Y + P  Y  Q +F NA ++L+T +  +     +  +E   GR R  + ++ PRT D
Sbjct: 59  SPIYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLD 118

Query: 375 LDILDYQLYVVDADVLTLPHPRLLERDFVVQPL 407
           +DI+ +   ++  + L LPHP+  ERD V+ PL
Sbjct: 119 IDIIAFNQVILRQNDLALPHPKWSERDSVLVPL 151


>HPPK_PSEAE RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 162

 Score = 60.1 bits (144), Expect = 4e-11
 Identities = 41/123 (33%), Positives = 59/123 (47%), Gaps = 4/123 (3%)

Query: 281 VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLL 340
           V L ++  E RE     +  A+     LP++++V +S  Y S+P    DQ  FVN V   
Sbjct: 7   VALGSNLAEPRE----QIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVXXX 62

Query: 341 RTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLER 400
                          +E   GRVR++R GPRT DLDIL +   ++D   L +PH  +  R
Sbjct: 63  XXXXXXXXXXXXXXXIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQAR 122

Query: 401 DFV 403
            FV
Sbjct: 123 AFV 125


>HPPK_AQUAE RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 160

 Score = 56.2 bits (134), Expect = 5e-10
 Identities = 33/96 (34%), Positives = 50/96 (52%)

Query: 317 SSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLD 376
           S+ YES+   + +Q +F+N V+  +T + P+                     GPR  D+D
Sbjct: 36  STVYESKAWGFENQGNFLNFVLKAKTSLLPQXXXXXXXXXXXXXXXXXXXXWGPREIDID 95

Query: 377 ILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLP 412
           IL Y+  V+   +L +PHP L +RDF V PLLE+ P
Sbjct: 96  ILLYKDEVIRTKLLKVPHPFLEKRDFFVYPLLEIEP 131


>HPPK_MYCTU RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 188

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 13/128 (10%)

Query: 298 LNQAITELCSLPDS---QIVDISSFYESEPAYYLDQDSFVNAVVLLRTGI-PPKELLGYL 353
           L   +  L S+ D     ++  S  YE++P   ++Q  F+NAV++       P+E L   
Sbjct: 12  LGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDPTCEPREWLRRA 71

Query: 354 HAVENSLGRVREVRNGPRTCDLDILD-YQLYVVDADV--------LTLPHPRLLERDFVV 404
              E + GRVR  R GPR  D+D++  YQ    +A V        LTLPHP    R FV+
Sbjct: 72  QEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLPHPLAHLRAFVL 131

Query: 405 QPLLELLP 412
            P + + P
Sbjct: 132 IPWIAVDP 139


>HPPK_MYCBO RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 188

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 13/128 (10%)

Query: 298 LNQAITELCSLPDS---QIVDISSFYESEPAYYLDQDSFVNAVVLLRTGI-PPKELLGYL 353
           L   +  L S+ D     ++  S  YE++P   ++Q  F+NAV++       P+E L   
Sbjct: 12  LGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDPTCEPREWLRRA 71

Query: 354 HAVENSLGRVREVRNGPRTCDLDILD-YQLYVVDADV--------LTLPHPRLLERDFVV 404
              E + GRVR  R GPR  D+D++  YQ    +A V        LTLPHP    R FV+
Sbjct: 72  QEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLPHPLAHLRAFVL 131

Query: 405 QPLLELLP 412
            P + + P
Sbjct: 132 IPWIAVDP 139


>HPPK_CAMJE RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 157

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 41/135 (30%), Positives = 63/135 (46%), Gaps = 10/135 (7%)

Query: 273 ALIGMGCNVPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDS 332
           ALIG+G N+       E  + +  ML + + +       +I+  S    +E   + +Q  
Sbjct: 30  ALIGLGSNI-------EPEKKRFDMLFRVMMDDKRF---KILSTSPMLINEAFGFKEQKD 79

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTL 392
           F NAV+L++T +  + LL  L   E    R R  +N PRT DLD+L +   V       +
Sbjct: 80  FTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKNAPRTLDLDLLYFSQKVKRDKWCEV 139

Query: 393 PHPRLLERDFVVQPL 407
           PH    ER  V+ PL
Sbjct: 140 PHKGAKERVSVILPL 154


>HPPK_MYCLE RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 191

 Score = 46.2 bits (108), Expect = 5e-07
 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 11/103 (10%)

Query: 317 SSFYESEPAYYLDQDSFVNAVVLLR-TGIPPKELLGYLHAVENSLGRVREVRNGPRTCDL 375
           S  Y++ P   ++Q SF+NAVV+        K  L     +E + GRVR  R G RT D+
Sbjct: 34  SPVYDTVPWGAVEQRSFLNAVVIADGPAYDTKAWLCRAQELERNAGRVRGQRWGARTLDV 93

Query: 376 DILD-YQL---------YVVDADVLTLPHPRLLERDFVVQPLL 408
           D++  YQ           +     LTLPHPR   R FV+ P L
Sbjct: 94  DLISCYQTSGATTGAVEVITCESNLTLPHPRAHLRAFVLVPWL 136


>HPPK_PSEPU RecName:
           Full=2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
           pyrophosphokinase;         EC=2.7.6.3;AltName:
           Full=7,
           8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
          Length = 120

 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 273 ALIGMGCNVPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDS 332
           A +G+G N+    SP E+       L  A   L  +  +++V  S+ Y S+ +    Q  
Sbjct: 5   AYVGLGSNLD---SPAEQ-------LRSAFQALDQVEATRLVAASALYTSD-SLLPGQPX 53

Query: 333 FVNAVVLLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTL 392
           + N                    +EN  G VR+ R GPRT DLDIL +   V+D   L +
Sbjct: 54  YTNXXXXXXXXXXXXXXXXXXXXIENDQGXVRKERWGPRTLDLDILLFSDQVLDQPRLKV 113

Query: 393 PH 394
           PH
Sbjct: 114 PH 115


>SPEB_PHOLL RecName: Full=Agmatinase;         EC=3.5.3.11;AltName:
           Full=Agmatine ureohydrolase;         Short=AUH;
          Length = 307

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 48/229 (20%), Positives = 91/229 (39%), Gaps = 36/229 (15%)

Query: 1   MIWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGE 60
           + W    + +D ++   + +++     F+ G   D  D   AHAE++   G R++  GG+
Sbjct: 68  LAWESRRWPWDFKLHNCLKVVDCGDVVFNFGDAQDMSDKLQAHAEKVLASGKRMLSFGGD 127

Query: 61  STRPGAAPVSVDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR 120
                             LP++RA A+    +++   H +        G+   +    + 
Sbjct: 128 H--------------FITLPLLRAHAKHFGKMAL--VHFDAHADTYPNGSQFDHGTMFYH 171

Query: 121 DP--AMVDAVRDSDCGLVVMHMQGDPSTMQNAP-----SYDDVVADVREWLRDRAAALEA 173
            P   ++D       G+   H + +  T+ +A      S DD++A ++E + D    L  
Sbjct: 172 APNEGLIDPHHSVQIGIRTEHGRDNGFTVLDADQVNDRSVDDLLAQIKETVGDMPVYL-- 229

Query: 174 AGVAHDRICIDP--GPGFGK------TPSQTLELVRNFQEFVRLGYPVM 214
                D  C+DP   PG G       T  + L+L+R  Q    +G  V+
Sbjct: 230 ---TFDIDCLDPAFAPGTGTPVIGGLTTDRALKLLRGLQPLNIVGMDVV 275


>Y2857_SHESH RecName: Full=UPF0276 protein Ssed_2857;
          Length = 278

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 34/133 (25%), Positives = 60/133 (45%), Gaps = 16/133 (12%)

Query: 280 NVPLVASPGEEREGKIAMLNQAITEL-CSLPDSQIVDISSFYESEPAYYLDQDSFVNAVV 338
           NV   A+PG E   +   +N  ++E  C L    ++D+++ Y +   ++ D   F+ ++ 
Sbjct: 140 NVSFYAAPGAEMT-EFEFVNAVLSEADCRL----LLDVNNIYVNSVNHHYDASQFLGSM- 193

Query: 339 LLRTGIPPKELLGYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLL 398
                  P E + YLH +        ++       D+    +QL     ++  + HP LL
Sbjct: 194 -------PTERIAYLH-IAGHYEEAEDLIVDTHGADIISPVWQLLRECYEIHGV-HPTLL 244

Query: 399 ERDFVVQPLLELL 411
           ERDF + P  ELL
Sbjct: 245 ERDFNIPPTSELL 257


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.327    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,865,175,910
Number of extensions: 386927880
Number of successful extensions: 998983
Number of sequences better than 1.0e-03: 20076
Number of HSP's gapped: 968439
Number of HSP's successfully gapped: 28210
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)