BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACV56973.1 elen0 ACV56973.1 GIB01015CH01 "4Fe-4S ferredoxin
iron-sulfur binding domain pro.."
         (219 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PHSB_SALTY RecName: Full=Thiosulfate reductase electron transpor...   140   1e-35
PHSB_SALTI RecName: Full=Thiosulfate reductase electron transpor...   140   1e-35
NRFC_HAEIN RecName: Full=Protein nrfC homolog;Flags: Precursor;       130   8e-33
DMSB_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase ...   127   1e-31
YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide r...   125   3e-31
YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide r...   125   3e-31
DMSB_SHIFL RecName: Full=Anaerobic dimethyl sulfoxide reductase ...   125   5e-31
NRFC_SHIFL RecName: Full=Protein nrfC;Flags: Precursor;               124   1e-30
NRFC_ECOLI RecName: Full=Protein nrfC;Flags: Precursor;               124   1e-30
NRFC_ECO57 RecName: Full=Protein nrfC;Flags: Precursor;               124   1e-30
YDHX_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein...   121   7e-30
YDHX_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein...   119   2e-29
PSRB_WOLSU RecName: Full=Polysulfide reductase chain B;AltName: ...   119   2e-29
SERB_THASE RecName: Full=Selenate reductase subunit beta;       ...   118   4e-29
CLRB_IDEDE RecName: Full=Chlorate reductase subunit beta;AltName...   116   2e-28
DMSB_HAEIN RecName: Full=Anaerobic dimethyl sulfoxide reductase ...   113   2e-27
HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase iron...   105   3e-25
HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC oper...   100   1e-23
FDNH_SHIFL RecName: Full=Formate dehydrogenase, nitrate-inducibl...    98   8e-23
FDNH_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducibl...    98   8e-23
FDOH_SHIFL RecName: Full=Formate dehydrogenase-O iron-sulfur sub...    95   5e-22
FDOH_ECOLI RecName: Full=Formate dehydrogenase-O iron-sulfur sub...    95   5e-22
FDOH_ECOL6 RecName: Full=Formate dehydrogenase-O iron-sulfur sub...    95   5e-22
DDHB_RHOSU RecName: Full=Dimethylsulfide dehydrogenase subunit b...    95   5e-22
FDXH_HAEIN RecName: Full=Formate dehydrogenase iron-sulfur subun...    93   2e-21
FDHB_WOLSU RecName: Full=Formate dehydrogenase iron-sulfur subunit;    92   3e-21
NARY_ECOLI RecName: Full=Respiratory nitrate reductase 2 beta ch...    91   7e-21
HYBA_SHIFL RecName: Full=Hydrogenase-2 operon protein hybA;Flags...    91   7e-21
HYBA_ECOLI RecName: Full=Hydrogenase-2 operon protein hybA;Flags...    91   7e-21
HYBA_ECO57 RecName: Full=Hydrogenase-2 operon protein hybA;Flags...    91   7e-21
YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;                 90   2e-20
NARH_BACSU RecName: Full=Nitrate reductase beta chain;         E...    89   5e-20
NARH_SHIFL RecName: Full=Respiratory nitrate reductase 1 beta ch...    87   1e-19
NARH_ECOLI RecName: Full=Respiratory nitrate reductase 1 beta ch...    87   1e-19
PGTS_PELAC RecName: Full=Pyrogallol hydroxytransferase small sub...    84   1e-18
FER8_METJA RecName: Full=Uncharacterized ferredoxin MJ0155;            80   2e-17
COOF_RHORU RecName: Full=Iron-sulfur protein;                          77   2e-16
HYDN_ECOLI RecName: Full=Electron transport protein hydN;              75   5e-16
HYDN_ECOL6 RecName: Full=Electron transport protein hydN;              75   5e-16
HYDN_ECO57 RecName: Full=Electron transport protein hydN;              75   5e-16
YDHY_SHIFL RecName: Full=Uncharacterized ferredoxin-like protein...    74   9e-16
YDHY_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein...    74   9e-16
YDHY_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein...    74   9e-16
YGFS_ECOLI RecName: Full=Putative electron transport protein ygfS;     74   1e-15
FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;            74   2e-15
HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;         EC=1...    73   2e-15
YSAA_ECOLI RecName: Full=Putative electron transport protein ysaA;     72   5e-15
FDHB_DESGI RecName: Full=Formate dehydrogenase subunit beta;    ...    72   6e-15
AEGA_ECOLI RecName: Full=Protein aegA;                                 70   1e-14
HYCB_SHIFL RecName: Full=Formate hydrogenlyase subunit 2;       ...    64   1e-12
HYCB_ECOLI RecName: Full=Formate hydrogenlyase subunit 2;       ...    64   1e-12
HYCB_ECOL6 RecName: Full=Formate hydrogenlyase subunit 2;       ...    64   1e-12
Y264_METJA RecName: Full=Uncharacterized protein MJ0264;               64   1e-12
NARH_BRASZ RecName: Full=Respiratory nitrate reductase beta chai...    62   5e-12
YFRA_PROVU RecName: Full=Frd operon probable iron-sulfur subunit...    60   2e-11
VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;                  49   3e-08
VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit ...    45   6e-07
VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit ...    45   6e-07
FER2_THEAC RecName: Full=Probable ferredoxin TA0517;                   44   2e-06
VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit ...    43   2e-06
FER_METTE RecName: Full=Probable ferredoxin;                           43   2e-06
FER1_DESVM RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I...    43   2e-06
RNFB_PSEU5 RecName: Full=Electron transport complex protein rnfB...    43   3e-06
FER3_DESAF RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;    42   4e-06
FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;     42   4e-06
MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;                  42   5e-06
VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;                  42   7e-06
Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like pro...    41   9e-06
Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like pr...    41   9e-06
FER_RICCN RecName: Full=Ferredoxin;                                    41   9e-06
RNFB_PSEMY RecName: Full=Electron transport complex protein rnfB;      40   1e-05
NUOI_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit I; ...    40   1e-05
MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;                  40   2e-05
VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;                  40   3e-05
FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;            40   3e-05
NUOI_VESOH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   3e-05
NUOI_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   3e-05
NUOI_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   4e-05
NUOI_THICR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   6e-05
NUOI_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   6e-05
NUOI_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   6e-05
FER_BACSC RecName: Full=Ferredoxin 7Fe;AltName: Full=Seven-iron ...    39   6e-05
NUOI_RALME RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   7e-05
NUOI_METPP RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   7e-05
NUOI_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   7e-05
NUOI_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   7e-05
NUOI_DINSH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   7e-05
FER2_RHOCA RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin I...    38   7e-05
Y1684_METTH RecName: Full=Uncharacterized protein MTH_1684;            38   1e-04
PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:...    38   1e-04
NUOI_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   1e-04
NUOI_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   1e-04
NUOI_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   1e-04
NUOI_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   1e-04
FER_METTL RecName: Full=Ferredoxin;                                    38   1e-04
NUOI_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   1e-04
NUOI_COXBU RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   1e-04
NUOI_COXBR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   1e-04
NUOI_COXBN RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   1e-04
FER_RICTY RecName: Full=Ferredoxin;                                    37   1e-04
FER_ALIAC RecName: Full=Ferredoxin;                                    37   1e-04
NUOI_SILST RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_PARDP RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI1_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit I ...    37   2e-04
NUOI1_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit I ...    37   2e-04
NQO9_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 9; ...    37   2e-04
NDUS8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    37   2e-04
FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;                  37   2e-04
FER_RICPR RecName: Full=Ferredoxin;                                    37   2e-04
FER_RICBR RecName: Full=Ferredoxin;                                    37   2e-04
NUOI_SILPO RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_JANSC RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI1_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit I ...    37   2e-04
NDUS8_TOBAC RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    37   2e-04
NDUS8_SOLTU RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    37   2e-04
FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;            37   2e-04
FER2_RHORU RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin I...    37   2e-04
FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I...    37   2e-04
Y208_METJA RecName: Full=Uncharacterized protein MJ0208;               36   3e-04
RNFB_SODGM RecName: Full=Electron transport complex protein rnfB;      36   3e-04
NUOI_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_RICTY RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_RHILW RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_RHILO RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_POLNA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_PELPD RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_METSB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_MESSB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_HALHL RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUME RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BART1 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BARHE RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_BARBK RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   3e-04
NUOI1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit I ...    36   3e-04
NUOI1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit I ...    36   3e-04
FER_THET8 RecName: Full=Ferredoxin;                                    36   3e-04
FER4_METJA RecName: Full=Uncharacterized ferredoxin MJ0199;            36   3e-04
FER1_AFIFE RecName: Full=Ferredoxin-1;Flags: Fragment;                 36   3e-04
RNFB_AERHH RecName: Full=Electron transport complex protein rnfB;      36   4e-04
NUOI_RICPR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   4e-04
NUOI_HERAR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   4e-04
NUOI_DECAR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   4e-04
NUOI_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   4e-04
NUOI_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   4e-04
NUOI_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   4e-04
NUOI2_NITMU RecName: Full=NADH-quinone oxidoreductase subunit I ...    36   4e-04
HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase iron...    36   4e-04
HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase iron...    36   4e-04
HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1 ir...    36   4e-04
FER_RICFE RecName: Full=Ferredoxin;                                    36   4e-04
Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;              35   5e-04
PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large subu...    35   5e-04
NUOI_RICFE RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   5e-04
NUOI_RHORT RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   5e-04
NUOI_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   5e-04
NUOI_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   5e-04
NUOI_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   5e-04
NDUS8_MACFA RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   5e-04
NDUS8_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   5e-04
FER_CLOTS RecName: Full=Ferredoxin;                                    35   5e-04
FER_CHRVI RecName: Full=Ferredoxin;                                    35   5e-04
Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like pro...    35   6e-04
RNFB_THIDA RecName: Full=Electron transport complex protein rnfB;      35   6e-04
PORD_METBF RecName: Full=Pyruvate synthase subunit porD;AltName:...    35   6e-04
NUOI_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   6e-04
NUOI_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   6e-04
NUOI_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   6e-04
NDUS8_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit...    35   6e-04
NDUS8_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   6e-04
NDUS8_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   6e-04
NDUS8_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   6e-04
NDUS8_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   6e-04
NDUS8_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   6e-04
HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1 ir...    35   6e-04
GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;      35   6e-04
Y870_METJA RecName: Full=Uncharacterized protein MJ0870;               35   8e-04
RNFB_YERPN RecName: Full=Electron transport complex protein rnfB;      35   8e-04
RNFB_YERPG RecName: Full=Electron transport complex protein rnfB;      35   8e-04
RNFB_YERPE RecName: Full=Electron transport complex protein rnfB;      35   8e-04
RNFB_YERPA RecName: Full=Electron transport complex protein rnfB;      35   8e-04
RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;      35   8e-04
RNFB_AERS4 RecName: Full=Electron transport complex protein rnfB;      35   8e-04
NUOI_VEREI RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI_MARMM RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit i...    35   8e-04

>PHSB_SALTY RecName: Full=Thiosulfate reductase electron transport
           protein phsB;
          Length = 192

 Score =  140 bits (353), Expect = 1e-35
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 6/153 (3%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           Y ++ D  RC GC ACTVACK +N V  G   ++     P         F      F+ V
Sbjct: 8   YVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQ-----FVRV 62

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEK 123
            CQHCEN  CV VCPT AS+  ++G VQ+DKS+CIGC +C  ACP+ VRYLN +  V +K
Sbjct: 63  SCQHCENAPCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADK 122

Query: 124 CTLC-EQRISQGELPQCVAQCGARARFFGDLDQ 155
           C  C + R++ G+ P CV+ C   A  FG LD+
Sbjct: 123 CNFCADTRLAAGQSPACVSVCPTDALKFGRLDE 155


>PHSB_SALTI RecName: Full=Thiosulfate reductase electron transport
           protein phsB;
          Length = 192

 Score =  140 bits (353), Expect = 1e-35
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 6/153 (3%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           Y ++ D  RC GC ACTVACK +N V  G   ++     P         F      F+ V
Sbjct: 8   YVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQ-----FVRV 62

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEK 123
            CQHCEN  CV VCPT AS+  ++G VQ+DKS+CIGC +C  ACP+ VRYLN +  V +K
Sbjct: 63  SCQHCENAPCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADK 122

Query: 124 CTLC-EQRISQGELPQCVAQCGARARFFGDLDQ 155
           C  C + R++ G+ P CV+ C   A  FG LD+
Sbjct: 123 CNFCADTRLAAGQSPACVSVCPTDALKFGRLDE 155


>NRFC_HAEIN RecName: Full=Protein nrfC homolog;Flags: Precursor;
          Length = 225

 Score =  130 bits (328), Expect = 8e-33
 Identities = 71/205 (34%), Positives = 107/205 (52%), Gaps = 21/205 (10%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           YA++ D N C GC AC  +C+ +N V  G   ++ LR  P+      G FP+ E  F   
Sbjct: 39  YAMIHDENACIGCTACMDSCRDVNQVPEGVSRLEILRSEPY------GEFPNQEYEFFRQ 92

Query: 64  QCQHCENPECVKVCPTEASHI-RDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
            CQHC N  CV VCPT AS I ++ G V + K  CIGCQ+C   CPY VR+++   R  +
Sbjct: 93  SCQHCTNAPCVAVCPTGASFIDKETGIVDVHKDLCIGCQYCIAVCPYRVRFIHPIHRTAD 152

Query: 123 KCTLC-EQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTRV 181
           KC  C +  ++ G+ P CV  C  +A  FGD++        P    S   + + + +T+V
Sbjct: 153 KCNFCRDTNLANGKQPACVEACPTKALTFGDMND-------PTSAVSRKVKEKPVYRTKV 205

Query: 182 KLKDYVEPYTENDIHHLADVGNEPK 206
           +L       T+ +++H+     EP+
Sbjct: 206 ELG------TQPNLYHIPFQHGEPR 224


>DMSB_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase
           chain B;AltName: Full=DMSO reductase iron-sulfur
           subunit;
          Length = 205

 Score =  127 bits (318), Expect = 1e-31
 Identities = 58/153 (37%), Positives = 85/153 (55%), Gaps = 1/153 (0%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTF-PDVEMYFLP 62
           Y    D +RCTGC  C +ACK    +     + +         +  +G +  +V  Y+L 
Sbjct: 5   YGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLS 64

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
           + C HCE+P C KVCP+ A H R+DG V +D+  CIGC++C MACPYG    N+ +  + 
Sbjct: 65  ISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETKGHMT 124

Query: 123 KCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           KC  C  R+++G+ P CV  C  RA  FG +D+
Sbjct: 125 KCDGCYDRVAEGKKPICVESCPLRALDFGPIDE 157


>YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide
           reductase chain ynfG;AltName: Full=DMSO reductase
           iron-sulfur subunit ynfG;
          Length = 205

 Score =  125 bits (315), Expect = 3e-31
 Identities = 57/153 (37%), Positives = 85/153 (55%), Gaps = 1/153 (0%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTF-PDVEMYFLP 62
           Y    D +RCTGC  C +ACK    +     + +         +  +G +  +V  Y+L 
Sbjct: 5   YGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLS 64

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
           + C HC++P C KVCP+ A H R+DG V +D+  CIGC++C MACPYG    N E+  + 
Sbjct: 65  ISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMT 124

Query: 123 KCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           KC  C  R+++G+ P CV  C  RA  FG +++
Sbjct: 125 KCDGCYSRVAEGKQPICVESCPLRALEFGPIEE 157


>YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide
           reductase chain ynfG;AltName: Full=DMSO reductase
           iron-sulfur subunit ynfG;
          Length = 205

 Score =  125 bits (315), Expect = 3e-31
 Identities = 57/153 (37%), Positives = 85/153 (55%), Gaps = 1/153 (0%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTF-PDVEMYFLP 62
           Y    D +RCTGC  C +ACK    +     + +         +  +G +  +V  Y+L 
Sbjct: 5   YGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLS 64

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
           + C HC++P C KVCP+ A H R+DG V +D+  CIGC++C MACPYG    N E+  + 
Sbjct: 65  ISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMT 124

Query: 123 KCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           KC  C  R+++G+ P CV  C  RA  FG +++
Sbjct: 125 KCDGCYSRVAEGKQPICVESCPLRALEFGPIEE 157


>DMSB_SHIFL RecName: Full=Anaerobic dimethyl sulfoxide reductase
           chain B;AltName: Full=DMSO reductase iron-sulfur
           subunit;
          Length = 205

 Score =  125 bits (313), Expect = 5e-31
 Identities = 57/153 (37%), Positives = 84/153 (54%), Gaps = 1/153 (0%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTF-PDVEMYFLP 62
           Y    D +RC GC  C +ACK    +     + +         +  +G +  +V  Y+L 
Sbjct: 5   YGFFIDSSRCAGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLS 64

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
           + C HCE+P C KVCP+ A H R+DG V +D+  CIGC++C MACPYG    N+ +  + 
Sbjct: 65  ISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETKGHMT 124

Query: 123 KCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           KC  C  R+++G+ P CV  C  RA  FG +D+
Sbjct: 125 KCDGCYDRVAEGKKPICVESCPLRALDFGPIDE 157


>NRFC_SHIFL RecName: Full=Protein nrfC;Flags: Precursor;
          Length = 223

 Score =  124 bits (310), Expect = 1e-30
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 10/154 (6%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           Y +V D + C GC AC  AC+ +N V  G   +  +R  P       G FPDV+  F   
Sbjct: 37  YGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQ------GEFPDVKYRFFRK 90

Query: 64  QCQHCENPECVKVCPTEASHIRD--DGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
            CQHC++  CV VCPT AS  RD   G V ++   C+GCQ+C  ACPY VR+++   +  
Sbjct: 91  SCQHCDHAPCVDVCPTGAS-FRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTA 149

Query: 122 EKCTLCEQ-RISQGELPQCVAQCGARARFFGDLD 154
           +KC  C +  +  G+LP CV  C  +A  FG+LD
Sbjct: 150 DKCDFCRKTNLQAGKLPACVEACPTKALTFGNLD 183


>NRFC_ECOLI RecName: Full=Protein nrfC;Flags: Precursor;
          Length = 223

 Score =  124 bits (310), Expect = 1e-30
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 10/154 (6%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           Y +V D + C GC AC  AC+ +N V  G   +  +R  P       G FPDV+  F   
Sbjct: 37  YGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQ------GEFPDVKYRFFRK 90

Query: 64  QCQHCENPECVKVCPTEASHIRD--DGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
            CQHC++  CV VCPT AS  RD   G V ++   C+GCQ+C  ACPY VR+++   +  
Sbjct: 91  SCQHCDHAPCVDVCPTGAS-FRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTA 149

Query: 122 EKCTLCEQ-RISQGELPQCVAQCGARARFFGDLD 154
           +KC  C +  +  G+LP CV  C  +A  FG+LD
Sbjct: 150 DKCDFCRKTNLQAGKLPACVEACPTKALTFGNLD 183


>NRFC_ECO57 RecName: Full=Protein nrfC;Flags: Precursor;
          Length = 223

 Score =  124 bits (310), Expect = 1e-30
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 10/154 (6%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           Y +V D + C GC AC  AC+ +N V  G   +  +R  P       G FPDV+  F   
Sbjct: 37  YGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQ------GEFPDVKYRFFRK 90

Query: 64  QCQHCENPECVKVCPTEASHIRD--DGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
            CQHC++  CV VCPT AS  RD   G V ++   C+GCQ+C  ACPY VR+++   +  
Sbjct: 91  SCQHCDHAPCVDVCPTGAS-FRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTA 149

Query: 122 EKCTLCEQ-RISQGELPQCVAQCGARARFFGDLD 154
           +KC  C +  +  G+LP CV  C  +A  FG+LD
Sbjct: 150 DKCDFCRKTNLQAGKLPACVEACPTKALTFGNLD 183


>YDHX_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
           ydhX;
          Length = 239

 Score =  121 bits (303), Expect = 7e-30
 Identities = 60/152 (39%), Positives = 83/152 (54%), Gaps = 7/152 (4%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           YA++ D +RC GC  C  AC+  N V         L +   P+        + + +F   
Sbjct: 54  YAMIHDESRCNGCNICARACRKTNHVPAQG---SRLSIAHIPVTDNDN---ETQYHFFRQ 107

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEK 123
            CQHCE+  C+ VCPT AS   + G V+++KS+CIGC +C  ACPY VRYLN   +V +K
Sbjct: 108 SCQHCEDAPCIDVCPTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADK 167

Query: 124 CTLC-EQRISQGELPQCVAQCGARARFFGDLD 154
           C  C E R+++G  P CV+ C   A  FG  D
Sbjct: 168 CDFCAESRLAKGFPPICVSACPEHALIFGRED 199


>YDHX_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
           ydhX;
          Length = 239

 Score =  119 bits (299), Expect = 2e-29
 Identities = 59/152 (38%), Positives = 82/152 (53%), Gaps = 7/152 (4%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           YA++ D +RC GC  C  AC+  N           L +   P+        + + +F   
Sbjct: 54  YAMIHDESRCNGCNICARACRKTNHAPAQG---SRLSIAHIPVTDNDN---ETQYHFFRQ 107

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEK 123
            CQHCE+  C+ VCPT AS   + G V+++KS+CIGC +C  ACPY VRYLN   +V +K
Sbjct: 108 SCQHCEDAPCIDVCPTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADK 167

Query: 124 CTLC-EQRISQGELPQCVAQCGARARFFGDLD 154
           C  C E R+++G  P CV+ C   A  FG  D
Sbjct: 168 CDFCAESRLAKGFPPICVSACPEHALIFGRED 199


>PSRB_WOLSU RecName: Full=Polysulfide reductase chain B;AltName:
           Full=Sulfur reductase chain B;
          Length = 191

 Score =  119 bits (299), Expect = 2e-29
 Identities = 54/151 (35%), Positives = 84/151 (55%), Gaps = 6/151 (3%)

Query: 4   YAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV 63
           Y ++ D N C GC AC +AC++ N +    + ++    GP  +  G+ +F      +   
Sbjct: 5   YGMIHDENLCIGCQACNIACRSENKIPDSVYRLQVWVQGPKKLPDGTLSFN-----YHRQ 59

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEK 123
            C  CEN  CV VCPT+AS++ +DG V ++   C+GC +C  ACPY  RY++   +  +K
Sbjct: 60  SCVQCENTPCVSVCPTKASYVNEDGIVSVNVDLCVGCLYCIAACPYQARYVDPVTKAPDK 119

Query: 124 CTLC-EQRISQGELPQCVAQCGARARFFGDL 153
           C  C + R+++GE P CV  C   A  FGD+
Sbjct: 120 CNFCKDTRLARGEEPACVTVCPTDALTFGDM 150


>SERB_THASE RecName: Full=Selenate reductase subunit beta;       
           EC=1.97.1.9;AltName: Full=Selenate reductase iron-sulfur
           subunit;
          Length = 327

 Score =  118 bits (296), Expect = 4e-29
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 13/158 (8%)

Query: 49  GSGTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIRD-DGTVQIDKSKCIGCQFCAMAC 107
           G G FP+   ++LP  C HC NP C+  CPT+A + R+ DG V +D+S+C G ++C  AC
Sbjct: 117 GKGEFPNNHYFYLPRICNHCSNPACLAACPTKAIYKREEDGLVVVDQSRCKGYRYCVKAC 176

Query: 108 PYGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPD 167
           PYG  Y N ++   EKC  C  R+ +GE P CV QC  R RF+G  D            D
Sbjct: 177 PYGKMYFNLQKGTSEKCIGCYPRVEKGEAPACVKQCSGRIRFWGYRD------------D 224

Query: 168 SPGCQYEEMTQTRVKLKDYVEPYTENDIHHLADVGNEP 205
             G  Y+ + Q +V L  + E  TE ++ ++  +   P
Sbjct: 225 KDGPIYKLVDQWKVALPLHAEYGTEPNVFYVPPMNTTP 262


>CLRB_IDEDE RecName: Full=Chlorate reductase subunit beta;AltName:
           Full=Chlorate reductase iron-sulfur subunit;
          Length = 328

 Score =  116 bits (290), Expect = 2e-28
 Identities = 58/158 (36%), Positives = 85/158 (53%), Gaps = 13/158 (8%)

Query: 49  GSGTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMAC 107
           G G FP+   ++LP  C HC NP C+  CPT+A + R +DG V +D+++C G ++C  AC
Sbjct: 118 GKGEFPNNHSFYLPRICNHCSNPACLAACPTKAIYKRPEDGIVVVDQTRCRGYRYCVKAC 177

Query: 108 PYGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPD 167
           PYG  Y N ++   EKC  C  R+ +GE P CV QC  R RF+G  D            D
Sbjct: 178 PYGKMYFNLQKGKSEKCIGCYPRVEKGEAPACVKQCSGRIRFWGYRD------------D 225

Query: 168 SPGCQYEEMTQTRVKLKDYVEPYTENDIHHLADVGNEP 205
             G  Y+ + Q +V L  + E  TE ++ ++  +   P
Sbjct: 226 KNGPIYKLVEQWKVALPLHAEYGTEPNVFYVPPMNTTP 263


>DMSB_HAEIN RecName: Full=Anaerobic dimethyl sulfoxide reductase
           chain B;AltName: Full=DMSO reductase iron-sulfur
           subunit;
          Length = 205

 Score =  113 bits (282), Expect = 2e-27
 Identities = 55/157 (35%), Positives = 77/157 (49%), Gaps = 2/157 (1%)

Query: 1   MANYAIVTDLNRCTGCLACTVACKAIN--GVDVGSFWIKTLRVGPHPIEGGSGTFPDVEM 58
           M  Y    D  RCTGC  C +ACK     G +V    I     G    +       ++  
Sbjct: 1   MEQYGFYFDSERCTGCKTCELACKDYKDLGTEVNFRRIYEYTGGQWNQQADGCWHQNIFA 60

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEE 118
           Y++ + C HC +P C KVCPT A H   DG V +++  CIGC++C MACPY     + ++
Sbjct: 61  YYMSISCNHCADPACTKVCPTGAMHKNADGFVIVNEEICIGCRYCHMACPYDAPQYDAQK 120

Query: 119 RVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
             + KC  C  R+  G+ P CV  C  RA  F  +D+
Sbjct: 121 GHMTKCDGCYSRVKSGQKPICVDACPLRALDFAPIDE 157


>HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase
           iron-sulfur subunit 1;         Short=Hme subunit
           A;Flags: Precursor;
          Length = 269

 Score =  105 bits (263), Expect = 3e-25
 Identities = 68/195 (34%), Positives = 96/195 (49%), Gaps = 50/195 (25%)

Query: 4   YAIVTDLNRCTGCLA--------------CTVACKAINGV---DVGSFWIKTLRVGPHPI 46
           +A+  D+ RCT C+               C VAC   N V   +   F  + +R+    +
Sbjct: 43  WAMAVDVERCTQCMEELIAKTGDEKIKPPCVVACDKENNVPEFEEERFDPQWMRIAKLKL 102

Query: 47  EGGSGTFPDV--EMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCA 104
           +      P+V  + Y++P+ C HCE+P CV+VC T+AS  R DG V+ID  +CIGC++C 
Sbjct: 103 DK-----PEVNPKEYYIPLLCNHCEHPPCVQVCLTKASFKRPDGIVEIDMHRCIGCRYCM 157

Query: 105 MACPYGVRYLN-----------------QEERVVEKCTLCEQRISQ----GE--LPQCVA 141
           +ACPYG R  N                 + E VVEKCT C  RI +    GE  +P CV 
Sbjct: 158 IACPYGARCFNFIDPREGLKEVNPNVQMRTEGVVEKCTFCVHRIDEAVKKGEEPIPACVE 217

Query: 142 QC---GARARFFGDL 153
            C   G  A  FG++
Sbjct: 218 ACHKYGKGALVFGNI 232


>HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC operon
           ORF 2;
          Length = 370

 Score =  100 bits (249), Expect = 1e-23
 Identities = 51/161 (31%), Positives = 76/161 (47%), Gaps = 12/161 (7%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMY--- 59
           +Y ++ D  RC GC  C  AC  +N +         L V        + ++  V  Y   
Sbjct: 39  SYGVLHDTTRCIGCRKCEQACNEVNKLPAPKAKFDDLTVLEKTRRTDADSWTVVNRYNAA 98

Query: 60  ------FLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGV-- 111
                 F   QC HC  P C   C  +A     DG+V  D S C+GC++C +ACP+ V  
Sbjct: 99  GLDHPVFRKQQCNHCLEPACASACFVKAFTKNPDGSVTYDGSLCVGCRYCMVACPFNVPA 158

Query: 112 -RYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFG 151
            +Y    + +++KCT+C  R+++G+LP CV  C   A  FG
Sbjct: 159 FQYAEAFDPLIQKCTMCHPRLAEGKLPGCVEICPKEALTFG 199


>FDNH_SHIFL RecName: Full=Formate dehydrogenase, nitrate-inducible,
           iron-sulfur subunit;AltName: Full=Formate
           dehydrogenase-N subunit beta;
          Length = 294

 Score = 97.8 bits (242), Expect = 8e-23
 Identities = 54/160 (33%), Positives = 74/160 (46%), Gaps = 10/160 (6%)

Query: 2   ANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFP------- 54
           A  A + D++ C GC AC VAC   N +         +   P  +   S T         
Sbjct: 28  AEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQ 87

Query: 55  --DVEMYFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACPYGV 111
              +E       C HCE+P C+K CP+  + I+  +G V      CIGC +C   CP+ +
Sbjct: 88  NGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNI 147

Query: 112 RYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFG 151
             LN+E+  V KCTLC  R+S G+ P CV  C   A  FG
Sbjct: 148 PRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFG 187


>FDNH_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducible,
           iron-sulfur subunit;AltName: Full=Formate
           dehydrogenase-N subunit beta;
          Length = 294

 Score = 97.8 bits (242), Expect = 8e-23
 Identities = 54/160 (33%), Positives = 74/160 (46%), Gaps = 10/160 (6%)

Query: 2   ANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFP------- 54
           A  A + D++ C GC AC VAC   N +         +   P  +   S T         
Sbjct: 28  AEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQ 87

Query: 55  --DVEMYFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACPYGV 111
              +E       C HCE+P C+K CP+  + I+  +G V      CIGC +C   CP+ +
Sbjct: 88  NGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNI 147

Query: 112 RYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFG 151
             LN+E+  V KCTLC  R+S G+ P CV  C   A  FG
Sbjct: 148 PRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFG 187


>FDOH_SHIFL RecName: Full=Formate dehydrogenase-O iron-sulfur
           subunit;AltName: Full=Formate dehydrogenase-O subunit
           beta;AltName: Full=FDH-Z subunit beta;
          Length = 300

 Score = 95.1 bits (235), Expect = 5e-22
 Identities = 56/163 (34%), Positives = 76/163 (46%), Gaps = 22/163 (13%)

Query: 5   AIVTDLNRCTGCLACTVACKAIN------GVDVGSFWIKTLRVGPHPIEGGSGT---FPD 55
           A + D+  C GC AC VAC   N      G ++G +        P+ +   S T   F +
Sbjct: 31  AKLIDVTTCIGCKACQVACSEWNDIRDTVGNNIGVY------DNPNDLSAKSWTVMRFSE 84

Query: 56  VEM------YFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACP 108
           VE             C HC +P C+K CP E + I+  +G V     +CIGC +C   CP
Sbjct: 85  VEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCIAGCP 144

Query: 109 YGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFG 151
           + +  LN E+  V KCTLC  R+  G+ P CV  C   A  FG
Sbjct: 145 FDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCPTGAIHFG 187


>FDOH_ECOLI RecName: Full=Formate dehydrogenase-O iron-sulfur
           subunit;AltName: Full=Formate dehydrogenase-O subunit
           beta;AltName: Full=FDH-Z subunit beta;
          Length = 300

 Score = 95.1 bits (235), Expect = 5e-22
 Identities = 56/163 (34%), Positives = 76/163 (46%), Gaps = 22/163 (13%)

Query: 5   AIVTDLNRCTGCLACTVACKAIN------GVDVGSFWIKTLRVGPHPIEGGSGT---FPD 55
           A + D+  C GC AC VAC   N      G ++G +        P+ +   S T   F +
Sbjct: 31  AKLIDVTTCIGCKACQVACSEWNDIRDTVGNNIGVY------DNPNDLSAKSWTVMRFSE 84

Query: 56  VEM------YFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACP 108
           VE             C HC +P C+K CP E + I+  +G V     +CIGC +C   CP
Sbjct: 85  VEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCIAGCP 144

Query: 109 YGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFG 151
           + +  LN E+  V KCTLC  R+  G+ P CV  C   A  FG
Sbjct: 145 FDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCPTGAIHFG 187


>FDOH_ECOL6 RecName: Full=Formate dehydrogenase-O iron-sulfur
           subunit;AltName: Full=Formate dehydrogenase-O subunit
           beta;AltName: Full=FDH-Z subunit beta;
          Length = 300

 Score = 95.1 bits (235), Expect = 5e-22
 Identities = 56/163 (34%), Positives = 76/163 (46%), Gaps = 22/163 (13%)

Query: 5   AIVTDLNRCTGCLACTVACKAIN------GVDVGSFWIKTLRVGPHPIEGGSGT---FPD 55
           A + D+  C GC AC VAC   N      G ++G +        P+ +   S T   F +
Sbjct: 31  AKLIDVTTCIGCKACQVACSEWNDIRDTVGNNIGVY------DNPNDLSAKSWTVMRFSE 84

Query: 56  VEM------YFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACP 108
           VE             C HC +P C+K CP E + I+  +G V     +CIGC +C   CP
Sbjct: 85  VEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCIAGCP 144

Query: 109 YGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFG 151
           + +  LN E+  V KCTLC  R+  G+ P CV  C   A  FG
Sbjct: 145 FDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCPTGAIHFG 187


>DDHB_RHOSU RecName: Full=Dimethylsulfide dehydrogenase subunit
           beta;         Short=DMS DH subunit beta;AltName:
           Full=Dimethylsulfide iron-sulfur subunit;
          Length = 325

 Score = 95.1 bits (235), Expect = 5e-22
 Identities = 46/118 (38%), Positives = 61/118 (51%), Gaps = 5/118 (4%)

Query: 49  GSGTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMAC 107
           G G +P+   ++LP  C HC NP C+  C   A + R +DG V +D+ +C G ++C  AC
Sbjct: 116 GRGEYPNSYYFYLPRICNHCANPGCLAACARNAIYKRQEDGIVLVDQERCRGYRYCITAC 175

Query: 108 PYGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAH 165
           PY   Y N++    EKC  C  RI +G    C  QC  R RF G LD       GP H
Sbjct: 176 PYKKVYFNEQISKAEKCIFCYPRIEKGLPTACAKQCVGRIRFIGYLDDEA----GPVH 229


>FDXH_HAEIN RecName: Full=Formate dehydrogenase iron-sulfur
           subunit;AltName: Full=Formate dehydrogenase subunit
           beta;         Short=FDH subunit beta;
          Length = 312

 Score = 93.2 bits (230), Expect = 2e-21
 Identities = 53/167 (31%), Positives = 80/167 (47%), Gaps = 21/167 (12%)

Query: 5   AIVTDLNRCTGCLACTVACKAINGV--DVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLP 62
           A + D++ C GC AC V C   N +  D+ +   + + V  +P++  +  +    M F  
Sbjct: 36  AKLIDVSTCIGCKACQVGCSEWNDIRSDINA---QCVGVYDNPVDLDAKAW--TVMRFNE 90

Query: 63  VQ-------------CQHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACP 108
           V+             C HC  P C+K CP   + I+  +G V     KCIGC +C   CP
Sbjct: 91  VEENDRLEWLIRKDGCMHCTEPGCLKACPAPGAIIQYANGIVDFQSDKCIGCGYCIAGCP 150

Query: 109 YGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           + +  +N E+  V KCTLC  R+S G+ P CV  C   A  FG  ++
Sbjct: 151 FNIPRMNPEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIRFGSKEE 197


>FDHB_WOLSU RecName: Full=Formate dehydrogenase iron-sulfur subunit;
          Length = 200

 Score = 92.4 bits (228), Expect = 3e-21
 Identities = 53/168 (31%), Positives = 75/168 (44%), Gaps = 31/168 (18%)

Query: 9   DLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHC 68
           D  RC  C  C VACK  + + VG    + + +     EG  G         L + C HC
Sbjct: 12  DEARCIDCHGCDVACKEAHHLPVGVNRRRVVTLN----EGLVGKEKS-----LSIACMHC 62

Query: 69  ENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQ-----EERVVEK 123
            +  C +VCP +  ++R DG V  DK KCIGC +C  ACP+G     +         ++K
Sbjct: 63  SDAPCAQVCPVDCFYVRADGIVLHDKEKCIGCGYCLYACPFGAPQFPKSGIFGSRGPMDK 122

Query: 124 CTLC-----------------EQRISQGELPQCVAQCGARARFFGDLD 154
           CT C                 + RI++G++P C A C  +A   GD D
Sbjct: 123 CTFCAGGPEETHSEKEYKLYGQNRIAEGKVPVCAAMCSTKALLAGDSD 170


>NARY_ECOLI RecName: Full=Respiratory nitrate reductase 2 beta
           chain;         EC=1.7.99.4;
          Length = 514

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 48/129 (37%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 51  GTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIRD-DGTVQIDKSKCIGCQFCAMACPY 109
           G F +  M +LP  C+HC NP CV  CP+ A + R+ DG V ID+ KC G + C   CPY
Sbjct: 169 GQFENTFMMYLPRLCEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRLCISGCPY 228

Query: 110 GVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPDSP 169
              Y N +    EKC  C  RI  G+   C   C  R R+ G L    D  E  A  +  
Sbjct: 229 KKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEEAASTERE 288

Query: 170 GCQYEEMTQ 178
              YE   +
Sbjct: 289 VDLYERQCE 297


>HYBA_SHIFL RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
           Precursor;
          Length = 328

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 58/169 (34%), Positives = 78/169 (46%), Gaps = 24/169 (14%)

Query: 9   DLNRCTGCLACTVACKAINGVDVG----SFWIKTLRVGPHPIE------GGSGTFPDVE- 57
           D   C GC AC   C+ IN  +        W    ++ P+          G+G   D E 
Sbjct: 43  DSTLCVGCQACVTKCQDINFPERNPQGEQTWSNNDKLSPYTNNIIQVWTSGTGVNKDQEE 102

Query: 58  --MYFLPVQCQHCENPECVKVCPTEASHIRDD---GTVQIDKSKCIGCQFCAMACPYGV- 111
               ++  QC HC +P CV VCP  A  ++ D   G V  DK  C GC++C +ACPY V 
Sbjct: 103 NGYAYIKKQCMHCVDPNCVSVCPVSA--LKKDPKTGIVHYDKDVCTGCRYCMVACPYNVP 160

Query: 112 RY-LNQEERVVEKCTLCEQ----RISQGELPQCVAQCGARARFFGDLDQ 155
           +Y  N     + KC LC Q    R+ +G LP CV  C A A  FG  ++
Sbjct: 161 KYDYNNPFGALHKCELCNQKGVERLDKGGLPGCVEVCPAGAVIFGTREE 209


>HYBA_ECOLI RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
           Precursor;
          Length = 328

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 58/169 (34%), Positives = 78/169 (46%), Gaps = 24/169 (14%)

Query: 9   DLNRCTGCLACTVACKAINGVDVG----SFWIKTLRVGPHPIE------GGSGTFPDVE- 57
           D   C GC AC   C+ IN  +        W    ++ P+          G+G   D E 
Sbjct: 43  DSTLCVGCQACVTKCQDINFPERNPQGEQTWSNNDKLSPYTNNIIQVWTSGTGVNKDQEE 102

Query: 58  --MYFLPVQCQHCENPECVKVCPTEASHIRDD---GTVQIDKSKCIGCQFCAMACPYGV- 111
               ++  QC HC +P CV VCP  A  ++ D   G V  DK  C GC++C +ACPY V 
Sbjct: 103 NGYAYIKKQCMHCVDPNCVSVCPVSA--LKKDPKTGIVHYDKDVCTGCRYCMVACPYNVP 160

Query: 112 RY-LNQEERVVEKCTLCEQ----RISQGELPQCVAQCGARARFFGDLDQ 155
           +Y  N     + KC LC Q    R+ +G LP CV  C A A  FG  ++
Sbjct: 161 KYDYNNPFGALHKCELCNQKGVERLDKGGLPGCVEVCPAGAVIFGTREE 209


>HYBA_ECO57 RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
           Precursor;
          Length = 328

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 58/169 (34%), Positives = 78/169 (46%), Gaps = 24/169 (14%)

Query: 9   DLNRCTGCLACTVACKAINGVDVG----SFWIKTLRVGPHPIE------GGSGTFPDVE- 57
           D   C GC AC   C+ IN  +        W    ++ P+          G+G   D E 
Sbjct: 43  DSTLCVGCQACVTKCQDINFPERNPQGEQTWSNNDKLSPYTNNIIQVWTSGTGVNKDQEE 102

Query: 58  --MYFLPVQCQHCENPECVKVCPTEASHIRDD---GTVQIDKSKCIGCQFCAMACPYGV- 111
               ++  QC HC +P CV VCP  A  ++ D   G V  DK  C GC++C +ACPY V 
Sbjct: 103 NGYAYIKKQCMHCVDPNCVSVCPVSA--LKKDPKTGIVHYDKDVCTGCRYCMVACPYNVP 160

Query: 112 RY-LNQEERVVEKCTLCEQ----RISQGELPQCVAQCGARARFFGDLDQ 155
           +Y  N     + KC LC Q    R+ +G LP CV  C A A  FG  ++
Sbjct: 161 KYDYNNPFGALHKCELCNQKGVERLDKGGLPGCVEVCPAGAVIFGTREE 209


>YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;
          Length = 639

 Score = 90.1 bits (222), Expect = 2e-20
 Identities = 52/159 (32%), Positives = 74/159 (46%), Gaps = 14/159 (8%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLP 62
           N  I  +   C GC AC +AC   +  +         R   H +  G    P        
Sbjct: 2   NKFIAAEAAECIGCHACEIACAVAHNQENWPLSHSDFRPRIHVVGKGQAANP-------- 53

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
           V C HC N  CV  CP  A   + D +VQ+D+ KCIGC+ CA+ACP+GV  +   + + +
Sbjct: 54  VACHHCNNAPCVTACPVNALTFQSD-SVQLDEQKCIGCKRCAIACPFGV--VEMVDTIAQ 110

Query: 123 KCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFE 161
           KC LC QR S  +   C+  C  +A    D D+G+   +
Sbjct: 111 KCDLCNQRSSGTQ--ACIEVCPTQALRLMD-DKGLQQIK 146


>NARH_BACSU RecName: Full=Nitrate reductase beta chain;       
           EC=1.7.99.4;
          Length = 487

 Score = 88.6 bits (218), Expect = 5e-20
 Identities = 44/113 (38%), Positives = 59/113 (52%), Gaps = 1/113 (0%)

Query: 53  FPDVEMYFLPVQCQHCENPECVKVCPTEASHIRD-DGTVQIDKSKCIGCQFCAMACPYGV 111
           F DV M +LP  C+HC NP CV  CP+ A + R+ DG V +D++ C   ++C  +CPY  
Sbjct: 169 FDDVFMMYLPRICEHCINPACVSSCPSGAMYKREEDGIVLVDQNACRSWRYCVSSCPYKK 228

Query: 112 RYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPA 164
            Y N +    EKCTLC  R+  G    C   C  R R+ G +    D  E  A
Sbjct: 229 VYFNWQTNKAEKCTLCFPRLEAGLPTICSETCVGRIRYLGVMLYDADKVEEAA 281


>NARH_SHIFL RecName: Full=Respiratory nitrate reductase 1 beta
           chain;         EC=1.7.99.4;
          Length = 512

 Score = 87.4 bits (215), Expect = 1e-19
 Identities = 46/123 (37%), Positives = 60/123 (48%), Gaps = 1/123 (0%)

Query: 53  FPDVEMYFLPVQCQHCENPECVKVCPTEASHIRD-DGTVQIDKSKCIGCQFCAMACPYGV 111
           F +  M +LP  C+HC NP CV  CP+ A + R+ DG V ID+ KC G + C   CPY  
Sbjct: 172 FENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKK 231

Query: 112 RYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPDSPGC 171
            Y N +    EKC  C  RI  G+   C   C  R R+ G L    D  E  A  ++   
Sbjct: 232 IYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKD 291

Query: 172 QYE 174
            Y+
Sbjct: 292 LYQ 294


>NARH_ECOLI RecName: Full=Respiratory nitrate reductase 1 beta
           chain;         EC=1.7.99.4;AltName: Full=Nitrate
           reductase A subunit beta;
          Length = 512

 Score = 87.4 bits (215), Expect = 1e-19
 Identities = 46/123 (37%), Positives = 60/123 (48%), Gaps = 1/123 (0%)

Query: 53  FPDVEMYFLPVQCQHCENPECVKVCPTEASHIRD-DGTVQIDKSKCIGCQFCAMACPYGV 111
           F +  M +LP  C+HC NP CV  CP+ A + R+ DG V ID+ KC G + C   CPY  
Sbjct: 172 FENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKK 231

Query: 112 RYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPDSPGC 171
            Y N +    EKC  C  RI  G+   C   C  R R+ G L    D  E  A  ++   
Sbjct: 232 IYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKD 291

Query: 172 QYE 174
            Y+
Sbjct: 292 LYQ 294


>PGTS_PELAC RecName: Full=Pyrogallol hydroxytransferase small
           subunit;         EC=1.97.1.2;AltName:
           Full=Transhydroxylase subunit beta;
          Length = 274

 Score = 84.0 bits (206), Expect = 1e-18
 Identities = 47/152 (30%), Positives = 74/152 (48%), Gaps = 8/152 (5%)

Query: 1   MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIE---GGSGTFPDVE 57
           M  Y +V D+ +C  C  C + C   + ++    +  +++ G   +       GT+P  +
Sbjct: 1   MEQYYMVIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQRGHRWMNIERRERGTYPRND 60

Query: 58  MYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQE 117
           + + P  C HCEN  CV      A + R+DG V ID  K  G +     CPYGV Y N+E
Sbjct: 61  INYRPTPCMHCENAPCVAK-GNGAVYQREDGIVLIDPEKAKGKKELLDTCPYGVMYWNEE 119

Query: 118 ERVVEKCTLCEQRISQ----GELPQCVAQCGA 145
           E V +KCT+C   +       ++P+C   CG+
Sbjct: 120 ENVAQKCTMCAHLLDDESWAPKMPRCAHNCGS 151


>FER8_METJA RecName: Full=Uncharacterized ferredoxin MJ0155;
          Length = 151

 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 49/144 (34%), Positives = 70/144 (48%), Gaps = 32/144 (22%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQC 65
           IV +  +CT C  C   CK I+G           RV    ++G            +P+ C
Sbjct: 6   IVLNPEKCTKCYDCINICKEIHGES---------RV--RKVDG------------IPIFC 42

Query: 66  QHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCT 125
             CEN  C ++CP +A +++D G   +DK +CI C  CA+ACP G  ++  + RV  KCT
Sbjct: 43  MQCENAPCKEICPVDAIYLKD-GIPIVDKERCIACGMCAIACPIGAIFI--KNRVAHKCT 99

Query: 126 LC--EQRISQGELPQCVAQCGARA 147
           LC    RI+    P CV  C  +A
Sbjct: 100 LCLDVDRIT----PACVEACKDKA 119


>COOF_RHORU RecName: Full=Iron-sulfur protein;
          Length = 190

 Score = 76.6 bits (187), Expect = 2e-16
 Identities = 53/172 (30%), Positives = 73/172 (42%), Gaps = 33/172 (19%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFP-------- 54
           N  I  + + C  C +C +AC   +              G   IE  +   P        
Sbjct: 7   NVIIYANPDHCLSCHSCELACAVAHSG------------GHDMIEAIAANLPLHARNKVV 54

Query: 55  DVEMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYL 114
            V+   +P+QC+ CE+  C   CPT A   + DG VQI +  CIGC+ C M CP+G   +
Sbjct: 55  SVDGTAMPMQCRQCEDAPCTFACPTGACR-QADGQVQIVEQHCIGCKLCVMVCPFGAITV 113

Query: 115 NQE----------ERVVEKCTLC-EQRISQGE-LPQCVAQCGARARFFGDLD 154
             E            V +KC LC + R S G+  P CV  C  +A    DLD
Sbjct: 114 RSETVVEQGACTNRGVAKKCDLCVDWRASTGKTAPACVEACPTKAIRMVDLD 165


>HYDN_ECOLI RecName: Full=Electron transport protein hydN;
          Length = 175

 Score = 75.1 bits (183), Expect = 5e-16
 Identities = 49/162 (30%), Positives = 69/162 (42%), Gaps = 29/162 (17%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAIN--GVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYF 60
           N  I+ D ++C GC  C VAC   +    D  S   +T     H I+G + +   V    
Sbjct: 2   NRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATV---- 57

Query: 61  LPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVR-------- 112
               C+ CE+  C  VCP  A   RD G V + + +CIGC+ C +ACPYG          
Sbjct: 58  ----CRQCEDAPCANVCPNGAIS-RDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVI 112

Query: 113 -------YLNQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
                   +  ++    KC LC  R    + P C+A C   A
Sbjct: 113 RNSGAGLNVRADKAEANKCDLCNHR---EDGPACMAACPTHA 151


>HYDN_ECOL6 RecName: Full=Electron transport protein hydN;
          Length = 175

 Score = 75.1 bits (183), Expect = 5e-16
 Identities = 49/162 (30%), Positives = 69/162 (42%), Gaps = 29/162 (17%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAIN--GVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYF 60
           N  I+ D ++C GC  C VAC   +    D  S   +T     H I+G + +   V    
Sbjct: 2   NRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATV---- 57

Query: 61  LPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVR-------- 112
               C+ CE+  C  VCP  A   RD G V + + +CIGC+ C +ACPYG          
Sbjct: 58  ----CRQCEDAPCANVCPNGAIS-RDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVI 112

Query: 113 -------YLNQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
                   +  ++    KC LC  R    + P C+A C   A
Sbjct: 113 RNSGAGLNVRADKAEANKCDLCNHR---EDGPACMAACPTHA 151


>HYDN_ECO57 RecName: Full=Electron transport protein hydN;
          Length = 175

 Score = 75.1 bits (183), Expect = 5e-16
 Identities = 49/162 (30%), Positives = 69/162 (42%), Gaps = 29/162 (17%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAIN--GVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYF 60
           N  I+ D ++C GC  C VAC   +    D  S   +T     H I+G + +   V    
Sbjct: 2   NRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATV---- 57

Query: 61  LPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVR-------- 112
               C+ CE+  C  VCP  A   RD G V + + +CIGC+ C +ACPYG          
Sbjct: 58  ----CRQCEDAPCANVCPNGAIS-RDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVI 112

Query: 113 -------YLNQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
                   +  ++    KC LC  R    + P C+A C   A
Sbjct: 113 RNSGAGLNVRADKAEANKCDLCNHR---EDGPACMAACPTHA 151


>YDHY_SHIFL RecName: Full=Uncharacterized ferredoxin-like protein
           ydhY;
          Length = 208

 Score = 74.3 bits (181), Expect = 9e-16
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPH------PIEGGSGTFPDVEMY 59
           +VT   RCTGC  C ++C   N   VG+F+    R+  H                     
Sbjct: 61  LVTQRARCTGCHRCEISCTNFNDGSVGTFFS---RIKIHRNYFFXXXXXXXXXXXXXXXX 117

Query: 60  FLPVQCQHCENPECVKVCPTEA-SHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEE 118
                C+ C+ P+C+ VCP  A +  + +G + +D  +CIGC  C  ACP+ +  +N E 
Sbjct: 118 XTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTES 177

Query: 119 RVVEKCTLC 127
           +   KC LC
Sbjct: 178 KKSSKCVLC 186


>YDHY_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
           ydhY;
          Length = 208

 Score = 74.3 bits (181), Expect = 9e-16
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPH------PIEGGSGTFPDVEMY 59
           +VT   RCTGC  C ++C   N   VG+F+    R+  H                     
Sbjct: 61  LVTQRARCTGCHRCEISCTNFNDGSVGTFFS---RIKIHRNYFFXXXXXXXXXXXXXXXX 117

Query: 60  FLPVQCQHCENPECVKVCPTEA-SHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEE 118
                C+ C+ P+C+ VCP  A +  + +G + +D  +CIGC  C  ACP+ +  +N E 
Sbjct: 118 XTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTES 177

Query: 119 RVVEKCTLC 127
           +   KC LC
Sbjct: 178 KKSSKCVLC 186


>YDHY_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
           ydhY;
          Length = 208

 Score = 74.3 bits (181), Expect = 9e-16
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPH------PIEGGSGTFPDVEMY 59
           +VT   RCTGC  C ++C   N   VG+F+    R+  H                     
Sbjct: 61  LVTQRARCTGCHRCEISCTNFNDGSVGTFFS---RIKIHRNYFFXXXXXXXXXXXXXXXX 117

Query: 60  FLPVQCQHCENPECVKVCPTEA-SHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEE 118
                C+ C+ P+C+ VCP  A +  + +G + +D  +CIGC  C  ACP+ +  +N E 
Sbjct: 118 XTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTES 177

Query: 119 RVVEKCTLC 127
           +   KC LC
Sbjct: 178 KKSSKCVLC 186


>YGFS_ECOLI RecName: Full=Putative electron transport protein ygfS;
          Length = 162

 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 50/154 (32%), Positives = 66/154 (42%), Gaps = 33/154 (21%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIE---GGSGTFPDVEMYFL- 61
           I+ +   C GC  C VAC                 V  HP E         P +++  L 
Sbjct: 5   IIVNPADCIGCRTCEVAC-----------------VVAHPSEQELNADVFLPRLKVQRLD 47

Query: 62  ----PVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYL--- 114
               PV C  CEN  CV  CP  A  + +   VQ + ++CIGCQ C  ACP+G+  +   
Sbjct: 48  SISAPVMCHQCENAPCVGACPVGALTMGEQ-VVQTNSARCIGCQSCVSACPFGMITIQSL 106

Query: 115 -NQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
                + + KC LCEQR    E P CV  C  +A
Sbjct: 107 PGDTRQQIVKCDLCEQR---EEGPACVESCPTQA 137


>FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;
          Length = 166

 Score = 73.6 bits (179), Expect = 2e-15
 Identities = 46/150 (30%), Positives = 66/150 (44%), Gaps = 29/150 (19%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQC 65
           I+T+ N C  C  C  AC   N V                   G     + +  ++P+ C
Sbjct: 7   IMTNFN-CDNCGDCVKACMEKNKV-------------------GRIAIMEKDGKYIPIVC 46

Query: 66  QHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCT 125
           QHC +  C +VCP  A   +D G V +++  CIGC  CA+ACP+G   +   E    KC 
Sbjct: 47  QHCASAPCKEVCPVSAIEHKD-GYVYLNEDVCIGCGLCALACPFGAILM---EDKAYKCI 102

Query: 126 LCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           LC      G+ P CV  C  R     D+++
Sbjct: 103 LC-----NGDEPACVKACSKRCLELVDVNE 127


>HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;       
           EC=1.-.-.-;
          Length = 205

 Score = 73.2 bits (178), Expect = 2e-15
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 14/108 (12%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLP 62
           N  +V +   CTGC  C  AC  ++         KT  +  HP    + T         P
Sbjct: 2   NRFVVAEPLWCTGCNTCLAACSDVH---------KTQGLQQHPRLALAKT----STITAP 48

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           V C HCE   C++VCP  A   RDD  +Q+++S CIGC+ CA+ CP+G
Sbjct: 49  VVCHHCEEAPCLQVCPVNAISQRDDA-IQLNESLCIGCKLCAVVCPFG 95


>YSAA_ECOLI RecName: Full=Putative electron transport protein ysaA;
          Length = 157

 Score = 72.0 bits (175), Expect = 5e-15
 Identities = 44/157 (28%), Positives = 68/157 (43%), Gaps = 32/157 (20%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDV------ 56
           N  I+ D  +C GC  C VAC                 V  H  +  +   PD       
Sbjct: 2   NRFIIADATKCIGCRTCEVACA----------------VSHHENQDCAALSPDEFISRIR 45

Query: 57  ----EMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVR 112
                 +   V C  CE+  C  VCP +A   R+ G + +++++CIGC+ C +ACP+G  
Sbjct: 46  VIKDHCWTTAVACHQCEDAPCANVCPVDAIS-REHGHIFVEQTRCIGCKSCMLACPFGAM 104

Query: 113 YL--NQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
            +  ++++    KC LC  R +    P CV  C  +A
Sbjct: 105 EVVSSRKKARAIKCDLCWHRETG---PACVEACPTKA 138


>FDHB_DESGI RecName: Full=Formate dehydrogenase subunit beta;       
            Short=FDH subunit beta;AltName: Full=Formate
           dehydrogenase small subunit;
          Length = 215

 Score = 71.6 bits (174), Expect = 6e-15
 Identities = 52/168 (30%), Positives = 69/168 (41%), Gaps = 27/168 (16%)

Query: 9   DLNRCTGCLACTVACKAING---------------VDVGSFWIKTLRVGPHPIEGGSGTF 53
           D  RCT C  C VACK  +G                D      K +R+    I+G     
Sbjct: 8   DTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGR---- 63

Query: 54  PDVEMYFLPVQCQHCENPECVKVCPTE--ASHIRDDGTVQI---DKSKCI-GCQFCAMAC 107
             ++  F P QC+HC  P C      E  ++ I DD T  +    K+K +   +    AC
Sbjct: 64  --IDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGCVLFTPKTKDLEDYESVISAC 121

Query: 108 PYGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQ 155
           PY V     E   + KC +C  RI+ G  P CV  C   A  FGDL +
Sbjct: 122 PYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSE 169


>AEGA_ECOLI RecName: Full=Protein aegA;
          Length = 659

 Score = 70.5 bits (171), Expect = 1e-14
 Identities = 46/157 (29%), Positives = 70/157 (44%), Gaps = 29/157 (18%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAING----VDVGSFWIKTLRVGPHPIEGGSGTFPDVEM 58
           N  I+ +  +C GC AC +AC   +     V     +   + V  H  +  +        
Sbjct: 2   NRFIMANSQQCLGCHACEIACVMAHNDEQHVLSQHHFHPRITVIKHQQQRSA-------- 53

Query: 59  YFLPVQCQHCENPECVKVCPTEA-SHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYL--- 114
               V C HCE+  C + CP  A SH+  D ++Q+++ KCIGC+ C +ACP+G   +   
Sbjct: 54  ----VTCHHCEDAPCARSCPNGAISHV--DDSIQVNQQKCIGCKSCVVACPFGTMQIVLT 107

Query: 115 ----NQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
                + +    KC LC  R +    P CV  C A A
Sbjct: 108 PVAAGKVKATAHKCDLCAGRENG---PACVENCPADA 141


>HYCB_SHIFL RecName: Full=Formate hydrogenlyase subunit 2;       
           Short=FHL subunit 2;AltName: Full=Hydrogenase-3
           component B;
          Length = 203

 Score = 64.3 bits (155), Expect = 1e-12
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLP 62
           N  ++ D   C GC  C  AC   +    G   +  LRV  +  E              P
Sbjct: 2   NRFVIADSTLCIGCHTCEAACSETHRQH-GLQSMPRLRVMLNEKESA------------P 48

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
             C HCE+  C  VCP  A   R DG VQ+++S C+ C+ C +ACP+G
Sbjct: 49  QLCHHCEDAPCAVVCPVNAI-TRVDGAVQLNESLCVSCKLCGIACPFG 95


>HYCB_ECOLI RecName: Full=Formate hydrogenlyase subunit 2;       
           Short=FHL subunit 2;AltName: Full=Hydrogenase-3
           component B;
          Length = 203

 Score = 64.3 bits (155), Expect = 1e-12
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLP 62
           N  ++ D   C GC  C  AC   +    G   +  LRV  +  E              P
Sbjct: 2   NRFVIADSTLCIGCHTCEAACSETHRQH-GLQSMPRLRVMLNEKESA------------P 48

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
             C HCE+  C  VCP  A   R DG VQ+++S C+ C+ C +ACP+G
Sbjct: 49  QLCHHCEDAPCAVVCPVNAI-TRVDGAVQLNESLCVSCKLCGIACPFG 95


>HYCB_ECOL6 RecName: Full=Formate hydrogenlyase subunit 2;       
           Short=FHL subunit 2;AltName: Full=Hydrogenase-3
           component B;
          Length = 203

 Score = 64.3 bits (155), Expect = 1e-12
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 3   NYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLP 62
           N  ++ D   C GC  C  AC   +    G   +  LRV  +  E              P
Sbjct: 2   NRFVIADSTLCIGCHTCEAACSETHRQH-GLQSMPRLRVMLNEKESA------------P 48

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
             C HCE+  C  VCP  A   R DG VQ+++S C+ C+ C +ACP+G
Sbjct: 49  QLCHHCEDAPCAVVCPVNAI-TRVDGAVQLNESLCVSCKLCGIACPFG 95


>Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
          Length = 153

 Score = 63.9 bits (154), Expect = 1e-12
 Identities = 36/125 (28%), Positives = 53/125 (42%), Gaps = 32/125 (25%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQC 65
           +V ++  C GC  C  +C  ING+    F                           P++C
Sbjct: 18  VVVNVGSCIGCRRCERSCP-INGITFNEF---------------------------PIKC 49

Query: 66  QHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCT 125
            HC+   C+  CP  A   R +  V + K KC+GC  CA+ACP+G   +   + V  KC 
Sbjct: 50  MHCDRNPCLYACPENAIE-RINNKVVVIKDKCVGCGLCALACPFGAIRI---DGVAIKCN 105

Query: 126 LCEQR 130
            C +R
Sbjct: 106 GCYKR 110


>NARH_BRASZ RecName: Full=Respiratory nitrate reductase beta chain; 
                  EC=1.7.99.4;AltName: Full=Respiratory
           membrane-bound nitrate reductase subunit beta;
          Length = 266

 Score = 62.0 bits (149), Expect = 5e-12
 Identities = 49/160 (30%), Positives = 64/160 (40%), Gaps = 46/160 (28%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQC 65
           +V +L++C GC  C+V CK   G++    W                 F +VE       C
Sbjct: 5   MVLNLDKCIGCHTCSVTCK--EGMEYA--W-----------------FNNVESKL----C 39

Query: 66  QHCENPECVKVCPTEASHIR-DDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKC 124
           +HC NP CV  CP+ A + R +DG V ID+ K      C   CPY             KC
Sbjct: 40  EHCLNPACVATCPSGAIYKREEDGIVLIDQDK-----LCISGCPY-------------KC 81

Query: 125 TLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPA 164
             C  RI  G+   C   C    R+ G L    D  E  A
Sbjct: 82  IFCYPRIESGQPTVCSETC--VGRYLGVLLYDADRIEEAA 119


>YFRA_PROVU RecName: Full=Frd operon probable iron-sulfur subunit
           A;Flags: Fragment;
          Length = 157

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 38/107 (35%), Positives = 46/107 (42%), Gaps = 19/107 (17%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG------------ 110
           V C  CE+  C  VCP  A  I +     +D+ KCIGC+ C +ACPYG            
Sbjct: 32  VVCHQCEDAPCANVCPNGAI-IHNKDYYYVDQDKCIGCKTCVLACPYGTMEVVSRPVMRK 90

Query: 111 VRYLNQEERV---VEKCTLCEQRISQGELPQCVAQCGARARFFGDLD 154
           +  LN  E       KC LC  R    E P CV  C  +A    D D
Sbjct: 91  LTALNTIEAFKAEANKCDLCHHR---AEGPACVEVCPTQALVCIDRD 134



 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 16/78 (20%)

Query: 9   DLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQ---- 64
           D ++C GC  C +AC              T+ V   P+         +E +         
Sbjct: 61  DQDKCIGCKTCVLACP-----------YGTMEVVSRPVMRKLTALNTIEAFKAEANKCDL 109

Query: 65  CQH-CENPECVKVCPTEA 81
           C H  E P CV+VCPT+A
Sbjct: 110 CHHRAEGPACVEVCPTQA 127


>VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
          Length = 398

 Score = 49.3 bits (116), Expect = 3e-08
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 11/84 (13%)

Query: 65  CQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYL-----NQEER 119
           C  C   ECV VCP +A  I D+  V ID  KCI C  CA  CP+   Y+     ++ ++
Sbjct: 132 CVGCS--ECVPVCPVDAISIEDELAV-IDTEKCIYCSVCAQTCPWNAIYVAGKKPSKRQK 188

Query: 120 VVEKCTLCEQRISQGELPQCVAQC 143
            ++  T+ E+ I      +CV  C
Sbjct: 189 EIKSFTVTEECIG---CEKCVEVC 209



 Score = 42.7 bits (99), Expect = 3e-06
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 73  CVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE-KCTLCEQ 129
           C   CPT A  + ++G +  + SKCI C  CA ACP G++ ++      +  C LCE+
Sbjct: 40  CASACPTGAL-VENNGKLIYNSSKCIKCGNCATACPTGIKKVDDRFPYSKGHCVLCEK 96



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 16/80 (20%)

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKS--------KCIGCQFCAMACPYGVRYLN 115
           +C +C    C + CP  A ++      +  K         +CIGC+ C   CP  +   N
Sbjct: 160 KCIYCS--VCAQTCPWNAIYVAGKKPSKRQKEIKSFTVTEECIGCEKCVEVCPGDMITYN 217

Query: 116 QEERVVE------KCTLCEQ 129
           +E+ +V+       C LCEQ
Sbjct: 218 REDLIVKLPEACPACHLCEQ 237



 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 6/100 (6%)

Query: 13  CTGCLACTVACKAINGVDVGSFWIKTLRVG-PHPIEGGSGTFPDVEMYFLPVQCQHCENP 71
           C  C AC+ AC     +++  F   TL          G+    + ++ +   +C  C N 
Sbjct: 11  CLVCNACSKACPT-EAIEIAPFKTCTLCFSCASACPTGALVENNGKLIYNSSKCIKCGN- 68

Query: 72  ECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGV 111
            C   CPT    +  D      K  C+ C+ C  ACP  +
Sbjct: 69  -CATACPTGIKKV--DDRFPYSKGHCVLCEKCVDACPIDI 105


>VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit
           vorD;         Short=VOR;         EC=1.2.7.7;AltName:
           Full=2-oxoisovalerate oxidoreductase delta chain;
          Length = 105

 Score = 45.1 bits (105), Expect = 6e-07
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 60  FLPV----QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLN 115
           F+PV    +C  C    C K CP  A +I++DG V ID   C GC  CA  CP     + 
Sbjct: 44  FMPVIDESKCVKCYI--CWKYCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMV 101

Query: 116 QEER 119
           +EE+
Sbjct: 102 REEK 105


>VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit
           vorD;         Short=VOR;         EC=1.2.7.7;AltName:
           Full=2-oxoisovalerate oxidoreductase delta chain;
          Length = 105

 Score = 45.1 bits (105), Expect = 6e-07
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 60  FLPV----QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLN 115
           F+PV    +C  C    C K CP  A +I++DG V ID   C GC  CA  CP     + 
Sbjct: 44  FMPVIDESKCVKCYI--CWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMV 101

Query: 116 QEER 119
           +EE+
Sbjct: 102 REEK 105


>FER2_THEAC RecName: Full=Probable ferredoxin TA0517;
          Length = 70

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 65  CQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           C +C    CV +CPT+A  + D+  ++I + KCI C FC + CP G
Sbjct: 17  CNYCG--ACVGMCPTDAIWL-DETVIKIHEEKCIECGFCIVGCPTG 59


>VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit
           vorD;         Short=VOR;         EC=1.2.7.7;AltName:
           Full=2-oxoisovalerate oxidoreductase delta chain;
          Length = 105

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 73  CVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEER 119
           C K CP  A +I+ DG V ID   C GC  CA  CP     + +EE+
Sbjct: 59  CWKYCPEPAIYIKPDGYVAIDYDYCKGCGICANECPTKAITMIKEEK 105


>FER_METTE RecName: Full=Probable ferredoxin;
          Length = 58

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 65  CQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           C  C +  CV  CP  A  + DDG   +D+S+C+ C  C  ACP
Sbjct: 10  CTGCGS--CVDECPAAAISLNDDGIATVDESECLDCGSCEDACP 51


>FER1_DESVM RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
                 Short=Fd I;
          Length = 62

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 72  ECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           ECV VCP E   ++D   V +++ +C+GC+ C   C  G
Sbjct: 17  ECVDVCPVEVYELQDGKAVPVNEEECLGCESCVEVCEAG 55


>RNFB_PSEU5 RecName: Full=Electron transport complex protein
           rnfB;AltName: Full=Nitrogen fixation protein rnfB;
          Length = 191

 Score = 42.7 bits (99), Expect = 3e-06
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 39  LRVGPHPIEGGSGTFPDVEMYFLPVQCQHCENPECVKVCPTEA--SHIRDDGTVQIDKSK 96
           L V P P++   G  P +  Y    +C  C   +C++ CP +A     R   TV I  S+
Sbjct: 88  LDVEPEPLDAEGGEKPQMVAYIREAECIGCT--KCIQACPVDAIVGAARQMHTVII--SE 143

Query: 97  CIGCQFCAMACP 108
           C GC  C   CP
Sbjct: 144 CTGCDLCVEPCP 155


>FER3_DESAF RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
          Length = 61

 Score = 42.4 bits (98), Expect = 4e-06
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENP-ECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMAC 107
           Y + +    C    ECV VCP E   ++D   V +++ +C+GC+ C   C
Sbjct: 2   YKITIDTDKCTGDGECVDVCPVEVYELQDGKAVAVNEDECLGCESCVEVC 51


>FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;
          Length = 59

 Score = 42.4 bits (98), Expect = 4e-06
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 72  ECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           ECV VCP E   +++   V +++ +C+GC+ C   CP
Sbjct: 17  ECVDVCPVEVYELQNGKAVPVNEEECLGCESCIEVCP 53


>MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;
          Length = 412

 Score = 42.0 bits (97), Expect = 5e-06
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 73  CVKVCPTEASHIRDDG-TVQIDKSKCIGCQFCAMACPYGVRYLN-----QEERVVEKCTL 126
           CV  CP  A  +   G +++ID+ KCI C  CA  CP+   Y++     +  R +E  TL
Sbjct: 152 CVPECPVNAITLPKYGESIEIDEEKCIKCGICAQTCPWNSVYISGKKPQKSSRTIENFTL 211



 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query: 73  CVKVCPTEASHIRD-----------DGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
           C  VCPT A  + +              +Q + S C  C  C   CPYG+  L  +E++ 
Sbjct: 330 CTTVCPTGALKLVEVSKKVNGETVKRNRIQYNPSLCDKCGNCVDVCPYGILKLTDDEKLP 389

Query: 122 EK--CTLCEQRI 131
            K  C LCE+ I
Sbjct: 390 VKGFCILCEKCI 401



 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 29/99 (29%), Positives = 39/99 (39%), Gaps = 18/99 (18%)

Query: 13  CTGCLACTVACK--AINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN 70
           CT C ACT  C   A+  V+V               +    T     + + P  C  C N
Sbjct: 324 CTTCGACTTVCPTGALKLVEVSK-------------KVNGETVKRNRIQYNPSLCDKCGN 370

Query: 71  PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPY 109
             CV VCP     + DD  + + K  CI C+ C  AC +
Sbjct: 371 --CVDVCPYGILKLTDDEKLPV-KGFCILCEKCIDACRF 406



 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 14/84 (16%)

Query: 63  VQCQHCEN-PECVKVCPTEASHIRD---DGTVQIDK-----SKCIGCQFCAMACPYGVRY 113
           + C  C   P+CV+ CP +A    D   +G ++  K      KC  C  C   CP G+  
Sbjct: 32  IYCDMCGGEPKCVEACPNDALRHEDITLEGGIKKKKITYSPEKCDKCGECVKVCPPGILK 91

Query: 114 LNQEERVVEK-----CTLCEQRIS 132
           L  + +         C LC+Q ++
Sbjct: 92  LVNDGKASRVPLEGFCVLCQQCVN 115



 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 10/107 (9%)

Query: 46  IEGGSGTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQID--KSKCIGCQFC 103
           +EGG       ++ + P +C  C   ECVKVCP     + +DG       +  C+ CQ C
Sbjct: 59  LEGG---IKKKKITYSPEKCDKCG--ECVKVCPPGILKLVNDGKASRVPLEGFCVLCQQC 113

Query: 104 AMACP---YGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQCGARA 147
              CP    G+  + +  RV  K       +       CV +C   A
Sbjct: 114 VNVCPIEVIGIEGVKEPARVEIKIDKPIYIVDCVGCGLCVPECPVNA 160


>VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;
          Length = 394

 Score = 41.6 bits (96), Expect = 7e-06
 Identities = 37/152 (24%), Positives = 55/152 (36%), Gaps = 38/152 (25%)

Query: 6   IVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQC 65
           IV     C  C  C   C       V +  ++     PHPI        + +   L    
Sbjct: 233 IVIPPKSCPACKLCVNICP------VDALDLEVKLSSPHPITDEGLVIVEEDFEVLK--- 283

Query: 66  QHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEE------- 118
                 +C  VCPTEA  + ++   + +   CI C  C +ACP G   L + E       
Sbjct: 284 ------KCASVCPTEAIVVDEE---KKEVRMCIVCGACTVACPTGALKLGKIEHNGKEYN 334

Query: 119 -------------RVVEKCTLCEQRISQGELP 137
                        + VE C +   R+S+G+LP
Sbjct: 335 RIEFSPYLCDKCGKCVEVCPMKTLRLSRGKLP 366



 Score = 41.2 bits (95), Expect = 9e-06
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 73  CVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYL 114
           CV  CP  A  + ++  V IDKSKCI C  CA  CP+   ++
Sbjct: 148 CVPECPVNAITLENNKAV-IDKSKCIYCSICAQTCPWNAIFV 188



 Score = 39.7 bits (91), Expect = 3e-05
 Identities = 36/135 (26%), Positives = 50/135 (37%), Gaps = 39/135 (28%)

Query: 5   AIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQ 64
           +I    + C  C AC   C     +D+ SF +                            
Sbjct: 5   SITIQKDACLVCYACQAECPT-KAIDIDSFKV---------------------------- 35

Query: 65  CQHCENPECVKVCPTEA---SHIRDDGT----VQIDKSKCIGCQFCAMACPYGVRYLNQE 117
           C  C   ECVKVCPT A     I  +G     V     KC  C  CA ACP G++ ++ +
Sbjct: 36  CNLCM--ECVKVCPTGALVEEEIEVNGKKLKRVNYLAHKCEKCGQCAEACPIGIKKVDDD 93

Query: 118 ERVVE-KCTLCEQRI 131
               +  C LC++ I
Sbjct: 94  FPYSKGHCVLCQKCI 108



 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           +C +C   +CV+VCP +   + ++  + I    C  C+ C   CP
Sbjct: 209 KCIYCL--KCVEVCPGDMIKVDEENLIVIPPKSCPACKLCVNICP 251


>Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ0514;
          Length = 250

 Score = 41.2 bits (95), Expect = 9e-06
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 17/106 (16%)

Query: 58  MYFLPVQCQHCENPECVKVCPTEA-SHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQ 116
           +Y    +C  C    C K CP +A    +   + +I + KC+ C+ CA  CP G  Y+ +
Sbjct: 40  LYINETKCIRCNL--CYKECPVDAIEKAKVKKSAKIIEDKCVKCEICAQTCPVGAIYVIE 97

Query: 117 EERVVEKC----TLCEQ-------RISQGELPQ--CVAQCGARARF 149
               +E      T+ E+       R+ + EL +  C+ +CG  ARF
Sbjct: 98  GRAEIEDSEVHYTIKEKSIPHRKIRLKKYELDENTCI-KCGICARF 142



 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 13/66 (19%)

Query: 73  CVKVCPTEASHI-RDDGTV------QIDKSKCIGCQFCAMACPYGVRYLNQEERVV---- 121
           C +VCP +   + R+ G V      ++DK+ C+GC  C   CP  +  ++Q+   V    
Sbjct: 169 CAEVCPKKCIKVERELGEVIKTRDIEVDKNLCVGCLVCIEECP--INAIDQDGDKVKINK 226

Query: 122 EKCTLC 127
           +KC LC
Sbjct: 227 DKCILC 232


>Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ1303;
          Length = 501

 Score = 41.2 bits (95), Expect = 9e-06
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 72  ECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGV 111
           EC + CP +A    + G   +D+ +C GC  CA  CP G+
Sbjct: 55  ECARNCPNKAIKRNEFGGYYVDRRRCNGCGICANVCPIGI 94



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 38/136 (27%), Positives = 56/136 (41%), Gaps = 20/136 (14%)

Query: 9   DLNRCTGCLACTVACKAINGVDVGSFWI------KTLRVGPHPIEGG-------SGT--F 53
           D N+C  CL C   C   + + V +F +      KT +   + I  G       SG   F
Sbjct: 225 DYNKCILCLKCVEICPN-DALKVENFKVIKVKEDKTSQPTSYCINCGLCAEHCPSGALRF 283

Query: 54  PDVEMYFLPVQCQHCENPECVKVCPTEASHIRDD-GTVQIDKSKCIGCQFCAMACPYGVR 112
            +  +Y+ P  C  C   ECVK+CP +   I+ D   + I K   +          Y   
Sbjct: 284 ENGHLYYSPDVCWKCM--ECVKICPNDVRRIKQDFRRLYIHKGNLMPKASMGNNKLYSCE 341

Query: 113 YLNQEERVVEKCTLCE 128
               ++RVV  C+LCE
Sbjct: 342 -SPVDDRVVGGCSLCE 356


>FER_RICCN RecName: Full=Ferredoxin;
          Length = 116

 Score = 41.2 bits (95), Expect = 9e-06
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHI---RDDGTVQIDKSKCIGCQFCAMACPYG 110
           Y +  +C  C+  +CV+VCP +  +     DD  + I+  +CI C  C   CP G
Sbjct: 3   YVVTDECVKCKYTDCVEVCPVDCFYEGEREDDFMLVINPDECIDCGVCVPDCPIG 57


>RNFB_PSEMY RecName: Full=Electron transport complex protein rnfB;
          Length = 191

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 39  LRVGPHPIEGGSGTFPDVEMYFLPVQCQHCENPECVKVCPTEA--SHIRDDGTVQIDKSK 96
           L V P P++   G  P +  +    +C  C   +C++ CP +A     R   TV +  S+
Sbjct: 88  LDVEPEPLDAVEGEKPQMVAFIREAECIGCT--KCIQACPVDAIVGAARQMHTVIV--SE 143

Query: 97  CIGCQFCAMACP 108
           C GC  C   CP
Sbjct: 144 CTGCDLCVEPCP 155


>NUOI_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 31/88 (35%), Positives = 37/88 (42%), Gaps = 24/88 (27%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACPYGVRYLNQ------- 116
           C  VCP  A    S +RDDGT       ID  KCI C FC  ACP       Q       
Sbjct: 70  CEAVCPANAITIESEMRDDGTRRTIVYDIDLFKCIFCGFCEEACPVDAIVETQIFDYAFK 129

Query: 117 --------EERVVEKCTLCEQRISQGEL 136
                   +ER++E  +  EQ I+Q  L
Sbjct: 130 SRQGSIMTKERLLEVGSQNEQAINQARL 157


>MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;
          Length = 412

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 73  CVKVCPTEASHI-RDDGTVQIDKSKCIGCQFCAMACPYGVRYLN 115
           CV  CP +A  + +  G ++ID+  CI C  CA  CP+   Y++
Sbjct: 152 CVPECPVDAITLDKVGGVIEIDEDTCIKCGVCAQTCPWNAVYIS 195



 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 30/100 (30%), Positives = 43/100 (43%), Gaps = 19/100 (19%)

Query: 13  CTGCLACTVACK--AINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN 70
           CT C ACTVAC   A++ VD+              ++G       V+  + P  C  C  
Sbjct: 325 CTRCGACTVACPKGALSLVDMDKV-----------VDGEVVKRKRVQ--YNPALCDQCG- 370

Query: 71  PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
            +C++ CP +   + D+      K  CI C  C  ACP G
Sbjct: 371 -DCIEACPYDMLKLTDEKVPL--KGFCILCDQCIPACPKG 407



 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 21/98 (21%)

Query: 51  GTFPDVEMYFLPVQCQHCE----NPECVKVCPTEASHIRD---------DGTVQIDKSKC 97
           GT P   +   P    +C+     P+CV +CPT A  + D          G +  +  KC
Sbjct: 17  GTCPTAAIEVTPEDVIYCDICGGEPKCVDICPTGALKLEDLVVDEAGNTQGRIVFNPDKC 76

Query: 98  IGCQFCAMACPYGVRYLNQEERVVEK------CTLCEQ 129
             C  C   CP   + L  +E  V+K      C +C++
Sbjct: 77  NECGDCVEVCP--PQILKLDEGKVKKVPLQGFCVMCQK 112



 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 11/134 (8%)

Query: 13  CTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCENPE 72
           CT C  C   C  ++ +D+       + +GP       G   D E       C +    +
Sbjct: 246 CTACGLCEQLCP-VDAIDL------EVELGPAKPASEEGLVWDEEKCDFIGACANICPND 298

Query: 73  CVKVCPTEASHIRDDGTVQIDKS--KCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQR 130
            ++V   E   + D+  V  + S   C  C  C +ACP G   L   ++VV+   +  +R
Sbjct: 299 AIRVVTKEGMKVPDNEKVDEEPSFAMCTRCGACTVACPKGALSLVDMDKVVDGEVVKRKR 358

Query: 131 ISQGELPQCVAQCG 144
           +     P    QCG
Sbjct: 359 VQYN--PALCDQCG 370



 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 60  FLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSK--CIGCQFCAMACPYGV 111
           F P +C  C   +CV+VCP +   + D+G V+    +  C+ CQ C   CP GV
Sbjct: 71  FNPDKCNECG--DCVEVCPPQILKL-DEGKVKKVPLQGFCVMCQKCVDICPVGV 121



 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 15/72 (20%)

Query: 73  CVKVCPTEASHI---------RDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE- 122
           C + CP  A +I         ++    ++D+  CIGC  C  ACP            VE 
Sbjct: 183 CAQTCPWNAVYISGRKPEKRAKEIKKFELDEDACIGCNTCVEACPGDFIVPRTSNLTVEL 242

Query: 123 -----KCTLCEQ 129
                 C LCEQ
Sbjct: 243 PAICTACGLCEQ 254


>VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
          Length = 157

 Score = 39.7 bits (91), Expect = 3e-05
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 73  CVKVCPTEASHI-------RDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCT 125
           CV  CPTEA  +       ++   ++   S C  C  C   CP  V  LN+E ++   C 
Sbjct: 78  CVSACPTEALQMGKIVHNEKEYDRIEFTPSLCDSCGACVEICPQNVLKLNEEYKLKGFCV 137

Query: 126 LC 127
           +C
Sbjct: 138 MC 139


>FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;
          Length = 131

 Score = 39.7 bits (91), Expect = 3e-05
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPY 109
           +C HC    C+  CP    ++ +D  V   +  C+GC+ C  ACP+
Sbjct: 81  KCVHCGC--CITQCPINVIYMDEDYNVVFKEEDCVGCKNCLKACPF 124


>NUOI_VESOH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A    S +RDDGT       ID  KCI C FC  ACP
Sbjct: 70  CEAVCPANAITIESKMRDDGTRRTTQYDIDLFKCIFCGFCEEACP 114


>NUOI_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 165

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S +RDDG+       ID +KCI C FC  ACP
Sbjct: 67  IACKLCE-AVCPALAITIESEVRDDGSRRTSRYDIDLTKCIFCGFCEEACP 116


>NUOI_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A    S  RDDG+       ID +KCI C FC  ACP
Sbjct: 69  CEAVCPAQAITIESEPRDDGSRRTTRYDIDMTKCIYCGFCQEACP 113


>NUOI_THICR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A    S  RDDGT       ID  KCI C FC  ACP
Sbjct: 70  CEAVCPANAITIESEERDDGTRRTTQYDIDMFKCIYCGFCEEACP 114


>NUOI_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    RDDG+       ID +KCI C FC  ACP
Sbjct: 69  CEAVCPAQAITIEAEPRDDGSRRTTRYDIDMTKCIYCGFCQEACP 113


>NUOI_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    RDDG+       ID +KCI C FC  ACP
Sbjct: 71  CEAVCPAQAITIDAEPRDDGSRRTTRYDIDMTKCIYCGFCEEACP 115


>FER_BACSC RecName: Full=Ferredoxin 7Fe;AltName: Full=Seven-iron
           ferredoxin;
          Length = 78

 Score = 38.5 bits (88), Expect = 6e-05
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRY 113
           Y +   C   ++  CV+VCP +  H  +D    ID   CI C  C   CP    Y
Sbjct: 3   YVITEPCIGTKDASCVEVCPVDCIHEGED-QYYIDPDVCIDCGACEAVCPVSAIY 56


>NUOI_RALME RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A    S +R+DGT       ID +KCI C FC  ACP
Sbjct: 70  CEAVCPALAISIESDVRNDGTRRTTRYDIDLTKCIFCGFCEEACP 114


>NUOI_METPP RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 165

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S +RDDG+       ID +KCI C FC  +CP
Sbjct: 67  IACKLCE-AVCPALAITIESEVRDDGSRRTTRYDIDLTKCIFCGFCEESCP 116


>NUOI_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 169

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    RDDG+       ID +KCI C FC  ACP
Sbjct: 76  CEAICPAQAITIEAQERDDGSRRTVRYDIDMTKCIYCGFCQEACP 120


>NUOI_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 167

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    RDDG+       ID +KCI C FC  ACP
Sbjct: 74  CEAICPAQAITIEAQERDDGSRRTVRYDIDMTKCIYCGFCQEACP 118


>NUOI_DINSH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    RDDG+       ID +KCI C FC  ACP
Sbjct: 71  CEAICPAQAITIDAEPRDDGSRRTTRYDIDMTKCIYCGFCQEACP 115


>FER2_RHOCA RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II; 
                  Short=FdII;
          Length = 112

 Score = 38.1 bits (87), Expect = 7e-05
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +   C  C+  +CV+VCP +  +   + T+ I   +CI C  C   CP
Sbjct: 3   YVVTDNCIACKYTDCVEVCPVDCFY-EGENTLVIHPDECIDCGVCEPECP 51


>Y1684_METTH RecName: Full=Uncharacterized protein MTH_1684;
          Length = 431

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 6/56 (10%)

Query: 55  DVEMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           DV     P +C  C      + CPT   H  D+G   +D  +C GC  CA +CP G
Sbjct: 335 DVRPVHHPERCTDCAVCLAARRCPT---HAIDNG---LDLDRCFGCGVCAWSCPSG 384


>PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 86

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 2/74 (2%)

Query: 46  IEGGSGTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAM 105
           I+  +GT+          +C  CEN  C   CP  A    ++G  +ID   C GC  C  
Sbjct: 15  IKNKTGTWRTFRPILDNEKCVKCEN--CYIFCPEGAIQEDENGNFKIDYDYCKGCLICMN 72

Query: 106 ACPYGVRYLNQEER 119
            CP       +EE+
Sbjct: 73  ECPVNAITKVREEK 86


>NUOI_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A +I    R+DGT       ID +KCI C FC  ACP
Sbjct: 66  CEAVCPAMAINIESEEREDGTRRTKRYDIDLTKCIFCGFCEEACP 110


>NUOI_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A +I    R+DGT       ID +KCI C FC  ACP
Sbjct: 66  CEAVCPAMAINIESEEREDGTRRTKRYDIDLTKCIFCGFCEEACP 110


>NUOI_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A +I    R+DGT       ID +KCI C FC  ACP
Sbjct: 66  CEAVCPAMAINIESEEREDGTRRTKRYDIDLTKCIFCGFCEEACP 110


>NUOI_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A +I    R+DGT       ID +KCI C FC  ACP
Sbjct: 66  CEAVCPAMAINIESEEREDGTRRTKRYDIDLTKCIFCGFCEEACP 110


>FER_METTL RecName: Full=Ferredoxin;
          Length = 60

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 16/45 (35%), Positives = 20/45 (44%)

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           +C+  E  ECV  CP E   I+ D  V   +  C  C  C   CP
Sbjct: 8   KCKGPECAECVNACPMEVFEIQGDKVVVAKEDDCTFCMVCVDVCP 52


>NUOI_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S +R DGT       ID +KCI C FC  ACP
Sbjct: 65  IACKLCE-AVCPALAITIESDVRADGTRRTTRYDIDLTKCIFCGFCEEACP 114


>NUOI_COXBU RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 63  VQCQHCEN--PEC---VKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQE 117
           + C+ CE   P C   ++  P EA   R      ID  KCI C FC  ACP     L  E
Sbjct: 64  IACKLCEAVCPACAITIEAGPREADGSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTPE 123


>NUOI_COXBR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 63  VQCQHCEN--PEC---VKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQE 117
           + C+ CE   P C   ++  P EA   R      ID  KCI C FC  ACP     L  E
Sbjct: 64  IACKLCEAVCPACAITIEAGPREADGSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTPE 123


>NUOI_COXBN RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 63  VQCQHCEN--PEC---VKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQE 117
           + C+ CE   P C   ++  P EA   R      ID  KCI C FC  ACP     L  E
Sbjct: 64  IACKLCEAVCPACAITIEAGPREADGSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTPE 123


>FER_RICTY RecName: Full=Ferredoxin;
          Length = 110

 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +  +C  C+  +CV+VCP +  +   +  + I+  +CI C  C   CP
Sbjct: 3   YIVTDECVKCKYTDCVEVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP 51


>FER_ALIAC RecName: Full=Ferredoxin;
          Length = 78

 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 72  ECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVE 122
           +CV+ CP +A H   D    ID   CI C  C   CP    Y  QEE V E
Sbjct: 15  DCVETCPVDAIHEGPD-QYYIDPDLCIDCAACEPVCPVNAIY--QEEFVPE 62


>NUOI_SILST RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 71  CEAVCPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACP 115


>NUOI_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    RDDG+       ID +KCI C +C  ACP
Sbjct: 70  CEAICPAQAITIDAEPRDDGSRRTTRYDIDMTKCIYCGYCQEACP 114


>NUOI_PARDP RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 70  CEAVCPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACP 114


>NUOI_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 161

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 68  CEAVCPAQAITIEAEPREDGSRRTTRYDIDMTKCIFCGFCQEACP 112


>NUOI_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A  I    R+DGT       ID +KCI C FC  ACP
Sbjct: 69  CEAVCPAMAISIESEQREDGTRRTSRYDIDLTKCIFCGFCEEACP 113


>NUOI_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE     K    EA   R+DGT       ID  KCI C FC  ACP
Sbjct: 63  IACKLCEAICPAKAITIEAGPRRNDGTRRTTRYDIDMVKCIYCGFCQEACP 113


>NUOI_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 161

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S  RDDG+       ID +KCI C FC  ACP
Sbjct: 63  IACKLCE-AVCPALAITIESEQRDDGSRRTKRYDIDLTKCIFCGFCEEACP 112


>NUOI1_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 167

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 74  CEAVCPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACP 118


>NUOI1_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 167

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 74  CEAVCPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACP 118


>NQO9_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 9;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit 9;AltName: Full=NDH-1 subunit 9;
          Length = 163

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 70  CEAVCPAQAITIDAERREDGSRRTTRYDIDMTKCIYCGFCQEACP 114


>NDUS8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 222

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 129 CEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACP 173


>FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
          Length = 355

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 27/84 (32%)

Query: 73  CVKVCPTEASHIRDDGTV----------QIDKSKCIGCQFCAMACPYGV-------RYLN 115
           C  +CP  A  +   G +           IDK  C+ C  CA ACP+         + + 
Sbjct: 39  CADICPVNAIAMGPLGAIAKGDIIAPKLDIDKDVCVLCGMCASACPFDALDLKINGKSIK 98

Query: 116 QEER----------VVEKCTLCEQ 129
           ++ER            +KC LCEQ
Sbjct: 99  EDERYPKIKRDIKVYQDKCVLCEQ 122



 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 26/81 (32%)

Query: 73  CVKVCPTEASHIRDDGT--------------VQIDKSKCIGCQFCAMACPYGV----RYL 114
           C   CP +A  ++ +G               +++ + KC+ C+ C M CP G     R L
Sbjct: 79  CASACPFDALDLKINGKSIKEDERYPKIKRDIKVYQDKCVLCEQCEMVCPQGAIVVEREL 138

Query: 115 NQEERVV--------EKCTLC 127
            + E+ V        EKC LC
Sbjct: 139 AEREKFVIGEININKEKCVLC 159


>FER_RICPR RecName: Full=Ferredoxin;
          Length = 109

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +  +C  C+  +CV+VCP +  +   +  + I+  +CI C  C   CP
Sbjct: 3   YVVTDECVKCKYTDCVEVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP 51


>FER_RICBR RecName: Full=Ferredoxin;
          Length = 107

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +  +C  C+  +CV+VCP +  +   +  + I+  +CI C  C   CP
Sbjct: 3   YVVTDECVKCKYTDCVEVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP 51


>NUOI_SILPO RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 71  CEAICPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACP 115


>NUOI_JANSC RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 71  CEAICPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACP 115


>NUOI1_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 162

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 21/46 (45%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 68  CEAVCPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 113


>NDUS8_TOBAC RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 230

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 137 CEAICPAQAITIEAEAREDGSRRTTRYDIDMTKCIYCGFCQEACP 181


>NDUS8_SOLTU RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 229

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R+DG+       ID +KCI C FC  ACP
Sbjct: 136 CEAICPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACP 180


>FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;
          Length = 58

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           +C  C N  CV  CP  A  I+  G   +D++KC  C  CA  CP
Sbjct: 8   KCVGCGN--CVVFCPRRA--IKTYGVAIVDENKCSNCGICARYCP 48


>FER2_RHORU RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II; 
                  Short=FdII;
          Length = 106

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +   C  C+  +CV+VCP +  +   +  + I+  +CI C  C   CP
Sbjct: 2   YVVTENCIKCKYQDCVEVCPVDCFY-EGENFLVINPDECIDCGVCNPECP 50


>FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
                 Short=FdI;
          Length = 113

 Score = 36.6 bits (83), Expect = 2e-04
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +   C  C+  +CV+VCP +  +   +  + I+  +CI C  C   CP
Sbjct: 3   YIVTDACVRCKFMDCVEVCPVDCFY-EGENFLVINPDECIDCGVCEPECP 51


>Y208_METJA RecName: Full=Uncharacterized protein MJ0208;
          Length = 246

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 74  VKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPY 109
           + VCP  A  ++ D  V+I  SKC+GC  C   CPY
Sbjct: 166 INVCPNGAI-VKRDNFVEILLSKCLGCGNCKKVCPY 200


>RNFB_SODGM RecName: Full=Electron transport complex protein rnfB;
          Length = 190

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 39  LRVGPHPIEGGSGTFPDVEMYFLPV-QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKC 97
           L V P P++G + + P+  + ++    C  C   +C++ CP +A          +    C
Sbjct: 88  LSVDPQPMDGEASSRPESRVAWIDEGNCIGCT--KCIQACPVDAIVGATRAVHTVVSDLC 145

Query: 98  IGCQFCAMACP 108
            GC  C   CP
Sbjct: 146 TGCDLCVAPCP 156


>NUOI_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 68  CEAICPAQAITIEAGPRRNDGTRRTTRYDIDMVKCIYCGFCQEACP 113


>NUOI_RICTY RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A    S  RDDG+       ID +KCI C  C  ACP
Sbjct: 66  CEAVCPAQAIVIESDERDDGSRRTTRYDIDMTKCIYCGLCQEACP 110


>NUOI_RHILW RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_RHILO RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 70  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 115


>NUOI_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_POLNA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 165

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S +R+DG+       ID +KCI C FC  +CP
Sbjct: 67  IACKLCE-AVCPALAITIESDVREDGSRRTSRYDIDLTKCIFCGFCEESCP 116


>NUOI_PELPD RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 186

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 14/58 (24%)

Query: 63  VQCQHCENPECVKVCPT------------EASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           VQC  C    C  VCP             +  H +     +ID S+CI C FC  ACP
Sbjct: 78  VQCVSCNM--CATVCPAYCIEIQSAADFNDPFHPKSPDRFEIDYSRCIFCGFCVEACP 133


>NUOI_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_METSB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 68  CEAICPAQAITIEAGPRRNDGTRRTTRYDIDMVKCIYCGFCQEACP 113


>NUOI_MESSB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_HALHL RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A    SH R DGT       ID  KCI C FC  +CP
Sbjct: 70  CEAVCPALAITIDSHQRADGTRRTTRYDIDMFKCIYCGFCEESCP 114


>NUOI_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUME RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BART1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BARHE RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_BARBK RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 68  CEAICPAQAITIEAGPRRNDGTRRTTRYDIDMVKCIYCGFCQEACP 113


>NUOI_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>NUOI1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 164

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 70  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 115


>NUOI1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 163

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 73  CVKVCPTEASHI-----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I     R+DGT       ID  KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACP 114


>FER_THET8 RecName: Full=Ferredoxin;
          Length = 79

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 63  VQCQHC---ENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEER 119
           V C+ C   ++  CV+VCP E  +   D    I   +CI C  C  ACP    Y   EE 
Sbjct: 4   VICEPCIGVKDQSCVEVCPVECIYDGGD-QFYIHPEECIDCGACVPACPVNAIY--PEED 60

Query: 120 VVEK 123
           V E+
Sbjct: 61  VPEQ 64


>FER4_METJA RecName: Full=Uncharacterized ferredoxin MJ0199;
          Length = 62

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 17/46 (36%), Positives = 18/46 (39%)

Query: 65  CQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           C+  E  ECV  CP E   I  D  V      C  C  C   CP G
Sbjct: 10  CKGAECAECVNNCPMEVFEIEGDKVVVARPDDCTYCGVCEDVCPTG 55


>FER1_AFIFE RecName: Full=Ferredoxin-1;Flags: Fragment;
          Length = 93

 Score = 36.2 bits (82), Expect = 3e-04
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +   C  C+  +CV+VCP +  +   +  + I   +CI C  C   CP
Sbjct: 3   YVVTENCIKCKYMDCVEVCPVDCFY-EGENMLVIHPDECIDCGVCEPECP 51


>RNFB_AERHH RecName: Full=Electron transport complex protein rnfB;
          Length = 187

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 3/69 (4%)

Query: 41  VGPHPIEGGSGTFPDVEMYFLPV-QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIG 99
           V P P+ G     P  ++ F+   QC  C   +C++ CP +A          +   +C G
Sbjct: 90  VEPQPLGGAEAAAPIKKVAFIHEDQCIGCT--KCIQACPVDAIVGATKAMHTVIADECTG 147

Query: 100 CQFCAMACP 108
           C  C   CP
Sbjct: 148 CDLCVDPCP 156


>NUOI_RICPR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A    S  RDDG+       ID +KCI C  C  ACP
Sbjct: 66  CEAICPAQAIVIESDERDDGSRRTTRYDIDMTKCIYCGLCQEACP 110


>NUOI_HERAR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP  A    S  RDDG+       ID +KCI C FC  +CP
Sbjct: 69  CEAVCPAMAITIESEQRDDGSRRTTRYDIDLTKCIFCGFCEESCP 113


>NUOI_DECAR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP  A  I    RDDG+       ID +KCI C FC  ACP
Sbjct: 69  CEAICPALAITIEAEPRDDGSRRTTRYDIDLTKCIFCGFCEEACP 113


>NUOI_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 183

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 19/73 (26%)

Query: 73  CVKVCP----------TEASHIRDDGTVQIDKSKCIGCQFCAMACP---------YGVRY 113
           C +VCP          TE    R   T +I+  +CI C +C   CP         Y + +
Sbjct: 78  CSRVCPPMAISIQAEETELEQERHPATFEINMLRCIYCGYCEEVCPEEAIVMSDEYDITF 137

Query: 114 LNQEERVVEKCTL 126
            N+E  +++K  L
Sbjct: 138 NNRENAIMDKSKL 150


>NUOI_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 71  CEAICPAQAITIEAEERSDGSRRTTRYDIDMTKCIYCGFCQEACP 115


>NUOI_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 170

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  V  T  S +R DG+       ID +KCI C FC  +CP
Sbjct: 72  IACKLCE-AVCPAVAITIESDVRADGSRRTTRYDIDLTKCIFCGFCEESCP 121


>NUOI2_NITMU RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 162

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S  R+DGT       ID +KCI C FC  +CP
Sbjct: 64  IACKLCE-AVCPALAITIESEQREDGTRRTTRYDIDLTKCIFCGFCEESCP 113


>HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 659

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 65  CQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           C  CE   C+++CP  A  I ++G   ++ + C GC  C  ACP G
Sbjct: 591 CGGCE--VCIELCPFGAISI-EEGHANVNVALCKGCGTCVAACPSG 633


>HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 659

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 65  CQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           C  CE   C+++CP  A  I ++G   ++ + C GC  C  ACP G
Sbjct: 592 CGGCE--VCIELCPFGAISI-EEGHANVNVALCKGCGTCVAACPSG 634


>HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 793

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 62  PVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
           P +C  C    CV+VC      I D   V +D+  C GC  C+ ACP G   +   E   
Sbjct: 577 PDKCIGCRT--CVEVCKFGKISIVDKKAV-VDEVSCYGCGDCSAACPVGAIQMRNFE--- 630

Query: 122 EKCTLCEQRISQGELPQC 139
            +  L + R +     QC
Sbjct: 631 NEQILAQVRAATAHKSQC 648


>FER_RICFE RecName: Full=Ferredoxin;
          Length = 109

 Score = 35.8 bits (81), Expect = 4e-04
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 59  YFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +  +C  C+  +CV VCP +  +   +  + I+  +CI C  C   CP
Sbjct: 3   YVVNDECVKCKYTDCVDVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP 51


>Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;
          Length = 166

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 32/112 (28%), Positives = 43/112 (38%), Gaps = 23/112 (20%)

Query: 13  CTGCLACTVAC----------KAINGVDVGSFWI--KTLRVGP----HP-IEGGSGTFPD 55
           C GC  C  AC          +A   +D     +  K   V P    HP   G +   P 
Sbjct: 53  CNGCGECASACPNGLIQLKQQQATLEIDYAPCDLCGKCAEVCPTNALHPNFPGDTLLRPQ 112

Query: 56  VEMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMAC 107
                L +Q Q C  P+C   CP +A       T++ID  +C GC  C + C
Sbjct: 113 FSSACLILQNQTC--PDCQTACPLQAI----SSTLEIDNERCNGCGECKITC 158


>PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large
           subunit;         EC=1.12.7.2;AltName: Full=Fe
           hydrogenlyase;
          Length = 421

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 13/21 (61%), Positives = 15/21 (71%)

Query: 90  VQIDKSKCIGCQFCAMACPYG 110
           +QID+SKCIGC  C   CP G
Sbjct: 28  IQIDESKCIGCDSCQQYCPTG 48


>NUOI_RICFE RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    RDDG+       ID +KCI C  C  ACP
Sbjct: 66  CEAICPAQAIVIEADERDDGSRRTTRYDIDMTKCIYCGLCQEACP 110


>NUOI_RHORT RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCEEACP 113


>NUOI_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S  R+DGT       ID +KCI C FC  +CP
Sbjct: 64  IACKLCE-AVCPALAITIESDQREDGTRRTTRYDIDLTKCIFCGFCEESCP 113


>NUOI_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 160

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 67  CEAICPAQAITIEAAERGDGSRRTVRYDIDMTKCIYCGFCQEACP 111


>NUOI_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 10/46 (21%)

Query: 73  CVKVCPT-----EASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP      EA    DDGT      +ID  KCI C FC  +CP
Sbjct: 69  CEAVCPALAITIEAGPREDDGTRRTTLYEIDMFKCIYCGFCEESCP 114


>NDUS8_MACFA RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 117 CEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 161


>NDUS8_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 212

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  VCP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 119 CEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 163


>FER_CLOTS RecName: Full=Ferredoxin;
          Length = 55

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%)

Query: 73  CVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYG 110
           C   CP EA H    G  ++D   CI C  C   CP G
Sbjct: 14  CAAECPVEAIH-EGTGKYEVDADTCIDCGACEAVCPTG 50


>FER_CHRVI RecName: Full=Ferredoxin;
          Length = 83

 Score = 35.4 bits (80), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 96  KCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCVAQC 143
           +CI C  C   CP G      E  V+E  +LC + +   E  QCV  C
Sbjct: 8   ECINCDVCEPECPNGAISQGDETYVIEP-SLCTECVGHYETSQCVEVC 54


>Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ0514.2;
          Length = 408

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 30/106 (28%), Positives = 38/106 (35%), Gaps = 19/106 (17%)

Query: 7   VTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPV--- 63
           V D   C  C  C   C    GV         L +  H +E   G F D   Y   +   
Sbjct: 81  VIDEGSCVACANCIEVCPT--GV---------LEMDKHRVET-EGLFFDKPKYSNLIIDE 128

Query: 64  -QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
             C  C N  C + CP      R +G   I+ + CI C+ C   CP
Sbjct: 129 EVCVRCGN--CERACPINVIE-RKEGKYVINMALCISCKECIKVCP 171


>RNFB_THIDA RecName: Full=Electron transport complex protein rnfB;
          Length = 188

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 3/71 (4%)

Query: 39  LRVGPHPIEGGSGTFPDVEMYFLPVQ-CQHCENPECVKVCPTEASHIRDDGTVQIDKSKC 97
           L V P P++   GT     + F+  Q C  C    C++ CP +A          I   +C
Sbjct: 86  LGVEPKPLDEAHGTPKPKSVAFIDEQTCIGCTL--CIQACPVDAISGAAKQMHTIIADEC 143

Query: 98  IGCQFCAMACP 108
            GC+ C   CP
Sbjct: 144 TGCELCLAPCP 154


>PORD_METBF RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 95

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 48  GGSGTFPDVEMYFLPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMAC 107
           GG   F  V +Y    +C  C       VCP  +   R++G  + D   C GC  CA  C
Sbjct: 29  GGWRNFRPVYIYEKCTKCGICHI-----VCPDMSVKPRENGFFEYDYDYCKGCGICANEC 83

Query: 108 PYGVRYLNQEER 119
           P     +  EE+
Sbjct: 84  PADAIEMILEEK 95


>NUOI_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    RDDG+       +D +KCI C  C  ACP
Sbjct: 69  CEAICPAQAITIEPEPRDDGSRRARRYDLDMTKCIYCGLCQEACP 113


>NUOI_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 161

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R+DG        ID  KCI C FC  ACP
Sbjct: 68  CEAICPAQAITIEAEPREDGARRTTRYDIDMVKCIYCGFCQEACP 112


>NUOI_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 161

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP  A    S  R+DG+       ID +KCI C FC  ACP
Sbjct: 68  CEAICPAMAITIESEQREDGSRRTSRYDIDLTKCIFCGFCEEACP 112


>NDUS8_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit 8;
                   EC=1.6.5.3;
          Length = 162

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A    S  R DG+       ID +KCI C FC  ACP
Sbjct: 69  CEAICPAQAITIESEPRIDGSRRTTRYDIDMTKCIYCGFCQEACP 113


>NDUS8_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 117 CEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 161


>NDUS8_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 117 CEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 161


>NDUS8_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 212

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 119 CEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 163


>NDUS8_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 117 CEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 161


>NDUS8_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C FC  ACP
Sbjct: 117 CEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP 161


>HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 793

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 3/80 (3%)

Query: 62  PVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
           P +C  C    CV+VC      I +   V +D+  C GC  C+ ACP G   +   E   
Sbjct: 577 PDKCIGCRT--CVEVCKFGKISIENKKAV-VDEVSCYGCGDCSAACPVGAIQMRNFENEQ 633

Query: 122 EKCTLCEQRISQGELPQCVA 141
               + E    + + P  VA
Sbjct: 634 ILAQVREATAHKSQCPFIVA 653


>GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;
          Length = 510

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 82  SHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCVA 141
           S++     V++D ++C+ C+ C + C +GV Y  + +R++     C      G   +CV 
Sbjct: 4   SYVPPKYKVEVDPNRCMLCERCTIECSWGV-YRREGDRIISYSNRC------GACHRCVV 56

Query: 142 QC 143
            C
Sbjct: 57  MC 58


>Y870_METJA RecName: Full=Uncharacterized protein MJ0870;
          Length = 620

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 64  QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVV 121
           +C  C    C +VC  EA  IR + T   + + C+GC  C   CP   R + +E  +V
Sbjct: 494 KCNGCGR--CAEVCKVEAIDIRGE-TSYTNYNVCVGCGKCIKNCPNEAREVKEEGYLV 548


>RNFB_YERPN RecName: Full=Electron transport complex protein rnfB;
          Length = 188

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 39  LRVGPHPIEGG-SGTFPDVEMYFLP-VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSK 96
           L V P P++G  S   P  ++ F+    C  C   +C++ CP +A          +    
Sbjct: 89  LAVEPQPLDGDESAAHPQRKVAFIDEANCIGCT--KCIQACPVDAIIGATRAMHTVLSDL 146

Query: 97  CIGCQFCAMACP 108
           C GC  C   CP
Sbjct: 147 CTGCDLCVAPCP 158


>RNFB_YERPG RecName: Full=Electron transport complex protein rnfB;
          Length = 188

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 39  LRVGPHPIEGG-SGTFPDVEMYFLP-VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSK 96
           L V P P++G  S   P  ++ F+    C  C   +C++ CP +A          +    
Sbjct: 89  LAVEPQPLDGDESAAHPQRKVAFIDEANCIGCT--KCIQACPVDAIIGATRAMHTVLSDL 146

Query: 97  CIGCQFCAMACP 108
           C GC  C   CP
Sbjct: 147 CTGCDLCVAPCP 158


>RNFB_YERPE RecName: Full=Electron transport complex protein rnfB;
          Length = 188

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 39  LRVGPHPIEGG-SGTFPDVEMYFLP-VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSK 96
           L V P P++G  S   P  ++ F+    C  C   +C++ CP +A          +    
Sbjct: 89  LAVEPQPLDGDESAAHPQRKVAFIDEANCIGCT--KCIQACPVDAIIGATRAMHTVLSDL 146

Query: 97  CIGCQFCAMACP 108
           C GC  C   CP
Sbjct: 147 CTGCDLCVAPCP 158


>RNFB_YERPA RecName: Full=Electron transport complex protein rnfB;
          Length = 188

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 39  LRVGPHPIEGG-SGTFPDVEMYFLP-VQCQHCENPECVKVCPTEASHIRDDGTVQIDKSK 96
           L V P P++G  S   P  ++ F+    C  C   +C++ CP +A          +    
Sbjct: 89  LAVEPQPLDGDESAAHPQRKVAFIDEANCIGCT--KCIQACPVDAIIGATRAMHTVLSDL 146

Query: 97  CIGCQFCAMACP 108
           C GC  C   CP
Sbjct: 147 CTGCDLCVAPCP 158


>RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;
          Length = 169

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 8/57 (14%)

Query: 90  VQIDKSKCIGCQFCAMACPYGV---RYLNQEERVVEKCTLCEQRISQGELPQCVAQC 143
           V+ID++ C+GC  C + CP       Y  +   +++ CT C   I     P C   C
Sbjct: 109 VEIDENNCVGCSKCRLVCPVDAVVGTYNFRHTVLIDSCTGCNLCI-----PLCPTNC 160


>RNFB_AERS4 RecName: Full=Electron transport complex protein rnfB;
          Length = 187

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 3/69 (4%)

Query: 41  VGPHPIEGGSGTFPDVEMYFLPV-QCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIG 99
           V P P+       P  ++ F+   QC  C   +C++ CP +A          +   +C G
Sbjct: 90  VDPQPLGSAEAAIPVKKVAFIHEDQCIGCT--KCIQACPVDAIVGATKAMHTVITDECTG 147

Query: 100 CQFCAMACP 108
           C  C   CP
Sbjct: 148 CDLCVDPCP 156


>NUOI_VEREI RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 169

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S +R DG+       ID +KCI C FC  +CP
Sbjct: 71  IACKLCE-AVCPALAITIESELRADGSRRTTRYDIDLTKCIFCGFCEESCP 120


>NUOI_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 177

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEA----SHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP  A    S +R DG+       ID +KCI C FC  +CP
Sbjct: 84  CEAICPAMAITIESEVRADGSRRTTRYDIDLNKCIFCGFCEESCP 128


>NUOI_MARMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 73  CVKVCPTEASHI----RDDGT-----VQIDKSKCIGCQFCAMACP 108
           C  +CP +A  I    R DG+       ID +KCI C +C  ACP
Sbjct: 69  CEAICPAQAITIEAEPRSDGSRRTTRYDIDMTKCIYCGYCQEACP 113


>NUOI_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 171

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 63  VQCQHCENPECVKVCPTEASHIRDDGT-----VQIDKSKCIGCQFCAMACP 108
           + C+ CE   C  +  T  S +R DG+       ID +KCI C FC  +CP
Sbjct: 73  IACKLCE-AVCPALAITIESDVRADGSRRTTRYDIDLTKCIFCGFCEESCP 122


>IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit
           iorA;         Short=IOR;         EC=1.2.7.8;AltName:
           Full=Indolepyruvate ferredoxin oxidoreductase subunit
           alpha;
          Length = 623

 Score = 34.7 bits (78), Expect = 8e-04
 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 59  YFLPVQCQHCENPECVKV--CPTEASHIRDDGTVQIDKSKCIGCQFCAMACP 108
           Y +   C  C   ECV    CP   + I D   V ID+S C+GC  CA  CP
Sbjct: 567 YKVTEDCTLCM--ECVNTFACP---ALIFDGEKVSIDQSLCVGCAVCAKICP 613


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.323    0.140    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,375,939,729
Number of extensions: 408556573
Number of successful extensions: 1088407
Number of sequences better than 1.0e-03: 20998
Number of HSP's gapped: 1054421
Number of HSP's successfully gapped: 36629
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)