# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12727.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV54358.1  [L=589]
Description: elen0 ACV54358.1 GIB01015CH01 "fumarate reductase/succinate dehydrogenase flavo.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-35  126.0   0.1    1.6e-35  125.4   0.0    1.2  1  PF00890  FAD binding domain
    1.6e-05   26.8   0.1    3.1e-05   25.9   0.1    1.4  1  PF01946  Thi4 family
    4.4e-05   25.2   4.2    0.00017   23.3   2.9    1.9  1  PF01266  FAD dependent oxidoreductase
    0.00011   23.9   0.3     0.0017   20.0   0.2    2.6  2  PF01134  Glucose inhibited division protein A
    0.00023   23.4   1.6    0.00091   21.5   1.1    2.1  1  PF07992  Pyridine nucleotide-disulphide oxidoreductase
    0.00048   23.1   0.2     0.0018   21.2   0.0    2.1  1  PF00070  Pyridine nucleotide-disulphide oxidoreductase
     0.0013   19.9   2.5     0.0031   18.7   0.9    1.9  1  PF03486  HI0933-like protein
  ------ inclusion threshold ------
      0.032   16.8   5.1      0.032   16.8   3.5    3.1  1  PF10518  TAT (twin-arginine translocation) pathway signal se
       0.39   12.3   0.1       0.58   11.7   0.1    1.2  1  PF05834  Lycopene cyclase protein
        1.1   11.6   0.2        2.1   10.6   0.1    1.4  1  PF02737  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
        1.4   11.1   0.1        3.1   10.0   0.1    1.5  1  PF01262  Alanine dehydrogenase/PNT, C-terminal domain
        1.6   11.3   0.0        2.9   10.4   0.0    1.4  1  PF05800  Gas vesicle synthesis protein GvpO
        1.9   11.1   0.3        8.7    8.9   0.0    2.2  1  PF10531  SLBB domain
          7    9.0   0.4         14    8.0   0.3    1.5  1  PF01210  NAD-dependent glycerol-3-phosphate dehydrogenase N-
        7.8    8.6   0.1         18    7.4   0.1    1.6  1  PF02558  Ketopantoate reductase PanE/ApbA
          8    9.0   0.0         16    8.0   0.0    1.4  1  PF11698  V-ATPase subunit H
          9    7.9   0.3         14    7.3   0.2    1.2  1  PF01494  FAD binding domain
        9.9    7.9   0.0         18    7.1   0.0    1.3  1  PF05139  Erythromycin esterase
         12    6.6   1.4         11    6.8   0.1    1.5  1  PF00743  Flavin-binding monooxygenase-like
         18    8.0   0.0         42    6.8   0.0    1.6  1  PF06714  Gp5 N-terminal OB domain
         19    8.5   0.0         36    7.6   0.0    1.4  1  PF03037  Kinetoplastid membrane protein 11
         19    7.6   0.0         35    6.8   0.0    1.3  1  PF05099  Tellurite resistance protein TerB
         32    6.5   0.1         53    5.8   0.1    1.3  1  PF03721  UDP-glucose/GDP-mannose dehydrogenase family, NAD b
         34    6.4   0.1         66    5.5   0.1    1.4  1  PF05580  SpoIVB peptidase S55
         39    6.7   0.1    2.1e+02    4.3   0.0    2.2  1  PF11512  Agrobacterium tumefaciens protein Atu4866
         43    6.9   0.0         84    6.0   0.0    1.5  1  PF00582  Universal stress protein family
         47    7.0   0.0         85    6.1   0.0    1.4  1  PF10909  Protein of unknown function (DUF2682)
         52    5.9   0.1         98    5.0   0.1    1.4  1  PF07812  TfuA-like protein
         53    5.6   0.1    1.2e+02    4.5   0.1    1.5  1  PF01884  PcrB family
         56    6.7   0.1    1.9e+02    5.0   0.1    1.9  1  PF00127  Copper binding proteins, plastocyanin/azurin family
         63    4.4   0.0         99    3.8   0.0    1.2  1  PF12236  Bacteriophage head to tail connecting protein
         78    4.8   0.0    1.4e+02    4.0   0.0    1.3  1  PF05023  Phytochelatin synthase
         89    5.2   0.9    1.4e+02    4.6   0.0    1.8  1  PF04127  DNA / pantothenate metabolism flavoprotein
      1e+02    5.9   0.6    3.3e+02    4.2   0.4    1.9  1  PF00954  S-locus glycoprotein family
    1.3e+02    4.7   0.0    4.7e+02    2.9   0.0    1.8  1  PF00965  Tissue inhibitor of metalloproteinase
    1.4e+02    3.3   0.0      2e+02    2.7   0.0    1.1  1  PF05095  Protein of unknown function (DUF687)
    1.4e+02    4.9   0.0    1.1e+03    2.0   0.0    2.3  1  PF12202  Oxidative-stress-responsive kinase 1 C terminal
    1.5e+02    5.2   0.0      3e+02    4.2   0.0    1.5  1  PF01498  Transposase
    1.9e+02    4.7   4.7    4.2e+02    3.6   3.2    1.5  1  PF06112  Gammaherpesvirus capsid protein
      2e+02    4.6   0.2    5.5e+02    3.2   0.0    1.8  1  PF02254  TrkA-N domain
    2.1e+02    4.6   0.3    6.6e+02    3.0   0.2    1.9  1  PF08802  Cytochrome B6-F complex Fe-S subunit
    2.1e+02    4.3   0.1    4.7e+02    3.2   0.1    1.5  1  PF00670  S-adenosyl-L-homocysteine hydrolase, NAD binding do
    3.1e+02    4.0   0.0    6.7e+02    2.9   0.0    1.5  1  PF04472  Protein of unknown function (DUF552)
    3.4e+02    4.3   4.2    7.5e+02    3.2   2.9    1.6  1  PF08139  Prokaryotic membrane lipoprotein lipid attachment s
    3.7e+02    3.6   0.2    8.5e+02    2.4   0.1    1.5  1  PF02310  B12 binding domain
    7.3e+02    2.9   0.0    2.2e+03    1.4   0.0    1.7  1  PF07649  C1-like domain
      1e+03    2.0   2.3      8e+02    2.3   0.3    1.9  1  PF08055  Tryptophan leader peptide
    1.5e+03    2.3   2.5    2.7e+03    1.5   1.2    1.8  1  PF10471  Anaphase-promoting complex APC subunit


Domain and alignment annotation for each model:
>> PF00890  FAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  125.4   0.0   7.8e-39   1.6e-35       1     406 [.      88     554 ..      88     565 .. 0.81

  Alignments for each domain:
  == domain 1    score: 125.4 bits;  conditional E-value: 7.8e-39
                 SEEEE-------HHHHHHHCHTT-EEEEESS-CCGSGGGG-----B---....GGCSC.CHHHHHHHHHHH--........-----HHHHHHHHCCHHH CS
     PF00890   1 DvvViGsGlAGlaAAleaaeaglkvavvekeqetggatawsqGgidavlspeqkkagikdspdlhrtdtlkal........deladqplveafveaape 91 
                 D++V+G+G++Gla+A++a+e+g++v++  + ++     ++ +G+    +++ ++++gi+d      +dt+ +         +++ dq+     +++++ 
  ACV54358.1  88 DIIVVGAGVSGLACAASATEEGADVILFAASSQ----PVARGGSNHGIGTKFHERLGITD----YTKDTIDGFirqelarnGYRVDQKKWYKWINNSAS 178
                 9***************************99985....9***************9999977....33444444444445665555555555555666666 PP

                 HHHHHHC-....-----BGC---B-EE------S-....-EE-.STT-......---HHHHHHHHHHHC-TTEEEEESEEEEE--BG--...BB---EE CS
     PF00890  92 avdeleel....gvpfsrtedgpvdlrelGglsat....rtlhdaadarretlvtghallarllesareagkvdfqerhradeLivedg...rvtGvvv 179
                  +++l +l    g   +     +++ ++  g+       + + + ad ++   +tg  l+ +++e+  + +  +++ ++  + Li+ed+   rv+ +v+
  ACV54358.1 179 TMNWLIDLmeakGYTTTM----EIGYTDTEGVFTAhpgsHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNntgRVSAIVA 273
                 666666665433555555....77777777766666776556778998889999******999998888888**************9777769998888 PP

                 EETTTTCEEEEEES.EEEE-----GG.....................GSSSBSSGT.T------HHHHC----EEE..TT-EEEECEEES....STT-B CS
     PF00890 180 enprsgrevrirakaavvlatgGfgrd......rrallkellg..aaaeaettnap.antGdgialalragaalnddrmeevqfhPtslvpirdgsgiL 269
                 + + +g+ v+++ ++a+vlatg f+++      + +++ +ll+  +++++ +        Gdg+++ l++gaa+++++  + ++  ++ +    ++   
  ACV54358.1 274 K-DPDGNYVKYVGRKAIVLATGDFSANqdmmakYCSWVAPLLQynEVDYDAMFQFGgLGPGDGQKMGLWVGAAWQQTLPNAPMIDAVGPM--PYRQ--- 366
                 7.8899999*********************999888888887533567777777776789*************99944444444444444..3333... PP

                 --GGG-----EEE-----B-H..............................GGGS-HHHHHHHHH.HHHHH----.-EEEE-TT............... CS
     PF00890 270 itealrgeGgilvdkdGrrFm..............................nelasrdvvsrailekeiaeggseanvyldadh............... 323
                     ++  +g+l++k+G+r+                               n ++ + ++   i+e+e ++  + +  yl   +               
  ACV54358.1 367 ---SIADFSGLLLNKKGERYSnedvifsygtyammmqpdmtrygiwdtayaNWFDTWETFGTTIVENEGKNATT-PEGYLASWDsnvekgtfvkgdtie 461
                 ...347789************99999999999999999999999999999999999999999999999998888.777777766899999999999999 PP

                 ........S-HCCHCCHSHHHHHHHHHT--......--TTTSBEE.......EEEEE...EEE----B-------......S-B--EE----S CS
     PF00890 324 .......gldaealeatleaineeaengldkdfgrgidpadrpipgpfyavkvvpaq...hytmgGvrtdenarvldadgqpipGLYAaGeva 406
                        gld+e+ ++++e++ne +e ++d+df++  +  +    gpfy  k+ ++    ++  gG+rt+en++v d++++pi+GLY  G + 
  ACV54358.1 462 eviaqldGLDPENAKKSVERYNELCEAKYDDDFHKSATLLAPIKEGPFYGCKLEMSPanfLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMV 554
                 99999999**********************999988887776444****988765554589999***********************888666 PP

>> PF01946  Thi4 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.9   0.1   1.5e-08   3.1e-05      11      91 ..      80     163 ..      76     170 .. 0.77

  Alignments for each domain:
  == domain 1    score: 25.9 bits;  conditional E-value: 1.5e-08
                 HHHHCTEECEEEE-------HHHHHHHCCTS-EEEEESS...S---------------.EEEETTTHHHHHHTT---EE-SSEEE CS
     PF01946  11 dllkyaesDvvivGaGssGltaayylakkdlkvailerk...lsiGGGawlGGqlfsk.vvvrkeakelLdelgiryedegdyvv 91 
                 ++ +  e+D+++vGaG sGl++a   ++++  v+++ ++   ++ GG   + G  f++ + + + +k+ +d + ir e  ++++ 
  ACV54358.1  80 EIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASsqpVARGGSNHGIGTKFHErLGITDYTKDTIDGF-IRQELARNGYR 163
                 5677889****************************9765444999*999999999875155666666666665.56665666555 PP

>> PF01266  FAD dependent oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.3   2.9   8.3e-08   0.00017       1     203 [.      88     297 ..      88     311 .. 0.70

  Alignments for each domain:
  == domain 1    score: 23.3 bits;  conditional E-value: 8.3e-08
                 EEEEE-------HHHHHHHHTT-EEEEEESSSTTSSSGGCS-EEE--SSSSHSSHHHHHHHHHHHHHHHHH....HHHTTTTSBBEEECHEEEESSHHH CS
     PF01266   1 dvviiGgGivGlstAyeLarrglkVtllekgdiasgaSgrngglihagllkerdprllrlalesldllrel....aaetgidvdfrrtgvldlasdeee 95 
                 d++++G+G++Gl++A  ++++g++V+l+ +++ + +  g n g+ + +   er    l +  ++ d ++ +    +a+ g  vd  ++ +++   ++++
  ACV54358.1  88 DIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKF--HER----LGITDYTKDTIDGFirqeLARNGYRVD--QKKWYKWINNSAS 178
                 8****************************9955555555688888777..233....445555555555552223666676666..6666666655555 PP

                 HHHHHHHHHHHHHTTT....TEEEESHHHHHHHSTTSTTTTCEEEEETTEEEEEHHHHHHHHHH.HHHH---EEEESEEEEEEEEETTE...EEEEEE. CS
     PF01266  96 leelerlaerarangl....dvellsaeevrerepllspdlkgglfypddgqvdpaklvkalar.aaeelGveiiegtkVtglereggr...vsgvrt. 185
                     + l++ ++a+g     ++ + + e v    p+   +++     +++g +  + lv a+++ +++e+G++i+  t  + l+re++    vs++++ 
  ACV54358.1 179 TM--NWLIDLMEAKGYtttmEIGYTDTEGVFTAHPGSH-NWVEQADGKESGAATGENLVIAMYEeKIKEQGGQIHYSTIGQYLIREDNNtgrVSAIVAk 274
                 55..4488888888888667777777777777776666.477777777888888888888888525888899999997777777777668886555553 PP

                 .EETTEEE....EEEEE----TH CS
     PF01266 186 .edgsira....dkvvlAaGaws 203
                  +dg + +    +++vlA+G +s
  ACV54358.1 275 dPDGNYVKyvgrKAIVLATGDFS 297
                 36665333466699999998555 PP

>> PF01134  Glucose inhibited division protein A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   20.0   0.2   8.2e-07    0.0017       1      45 [.      88     132 ..      88     158 .. 0.88
   2 ?    0.3   0.0      0.76   1.6e+03     137     160 ..     282     305 ..     248     314 .. 0.74

  Alignments for each domain:
  == domain 1    score: 20.0 bits;  conditional E-value: 8.2e-07
                 CEEEE-------HHHHHHHH----EEEEES-GGGTT--SSSSEE- CS
     PF01134   1 dviViGgGhAGceAAlaaarlGakvlLithkldtiaelsCnpsig 45 
                 d+iV+G+G +G+++A+ a + Ga+v+L++ + + +a+ + n  ig
  ACV54358.1  88 DIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIG 132
                 79**************************99998888776666655 PP

  == domain 2    score: 0.3 bits;  conditional E-value: 0.76
                 -EEEECEEEE-----B---EE--- CS
     PF01134 137 etikakavviatGtflkgkihige 160
                 +++  ka+v+atG f++ + ++ +
  ACV54358.1 282 KYVGRKAIVLATGDFSANQDMMAK 305
                 455677*********988877655 PP

>> PF07992  Pyridine nucleotide-disulphide oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   21.5   1.1   4.4e-07   0.00091       1      81 [.      88     187 ..      88     300 .. 0.65

  Alignments for each domain:
  == domain 1    score: 21.5 bits;  conditional E-value: 4.4e-07
                 EEEEE----HHHHHHHHHHHCTSEEEEESSSGSSSTTTSGGHHHHHHHHHHHHH.....................CCCHHHHHHHHHHHHEEEHCHHEE CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.....................xxxxxxxxxxxxxxxxxxxxxxxx RF
     PF07992   1 dvviIGgGpaGlaaakrlarlglkvalierepggtclnrgcipkkllleaaeee.....................eldlkeleerkdegievllntgvt 78 
                 d++++G+G  Gla+a  ++++g++v+l+ +    ++++rg+ ++ ++ + +e+                          ++++++k  +    +  + +
  ACV54358.1  88 DIIVVGAGVSGLACAASATEEGADVILFAAS--SQPVARGGSNHGIGTKFHERLgitdytkdtidgfirqelarnGYRVDQKKWYKWINNSASTMNWLI 184
                 79**************************777..778888887777777554444666677776655555555555233333333333333333333333 PP

                 EEE CS
                 xxx RF
     PF07992  79 did 81 
                 d++
  ACV54358.1 185 DLM 187
                 333 PP

>> PF00070  Pyridine nucleotide-disulphide oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   21.2   0.0   8.6e-07    0.0018       2      63 ..      89     149 ..      88     163 .. 0.84

  Alignments for each domain:
  == domain 1    score: 21.2 bits;  conditional E-value: 8.6e-07
                 EEEE-E-HHHHHHHHHHHHTTSEEEEEESSSSSS..TTSSHHHHHHHHHHHHHTTEEEEESEEE CS
     PF00070   2 vvvvGgGyiGlElAaalaklgkkVtvierrdrll..raldeeiakilqkklekngievllntkv 63 
                 ++vvG+G++Gl +Aa +++ g++V ++ +++++    + ++ i++ +   +e++gi+ +++ ++
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAASSQPVarGGSNHGIGTKF---HERLGITDYTKDTI 149
                 89********************************9788888888888...55557776666665 PP

>> PF03486  HI0933-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   18.7   0.9   1.5e-06    0.0031       2      34 ..      88     120 ..      87     125 .. 0.91

  Alignments for each domain:
  == domain 1    score: 18.7 bits;  conditional E-value: 1.5e-06
                 SEEEE-------HHHHHHHH----EEEE----- CS
     PF03486   2 dviviGgGaAGlmaAisaakrgakVllldkakk 34 
                 d+iv+G+G +Gl +A+sa ++ga+V+l+ + ++
  ACV54358.1  88 DIIVVGAGVSGLACAASATEEGADVILFAASSQ 120
                 89*************************987766 PP

>> PF10518  TAT (twin-arginine translocation) pathway signal sequence
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   16.8   3.5   1.5e-05     0.032       2      26 .]       8      32 ..       7      32 .. 0.93

  Alignments for each domain:
  == domain 1    score: 16.8 bits;  conditional E-value: 1.5e-05
     PF10518  2 lsRRqfLkggaaaaAaaalggalaa 26
                + RR+fLkg++ a+A++a+ g +++
  ACV54358.1  8 FDRRSFLKGAMLAGAGTAAFGLAGC 32
                78*******************9986 PP

>> PF05834  Lycopene cyclase protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.7   0.1   0.00028      0.58       1      37 [.      88     122 ..      88     149 .. 0.83

  Alignments for each domain:
  == domain 1    score: 11.7 bits;  conditional E-value: 0.00028
     PF05834   1 DlvivGaGlAglllAlrlreakpglrvllidagpkll 37 
                 D+++vGaG +gl++A++    + g  v+l  a+++++
  ACV54358.1  88 DIIVVGAGVSGLACAASA--TEEGADVILFAASSQPV 122
                 9*****************..77777888888877774 PP

>> PF02737  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.6   0.1   0.00099       2.1       2      39 ..      89     126 ..      88     151 .. 0.87

  Alignments for each domain:
  == domain 1    score: 10.6 bits;  conditional E-value: 0.00099
                 EEEE---------HHHHHTT.SEEEEE-S-HHHHHHHH CS
     PF02737   2 vaVvGaGtmGagiAavfaragleVvlvdiseealekal 39 
                 + VvGaG+ G   Aa + ++g +V+l+  s + ++++ 
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAASSQPVARGG 126
                 78*************************99998887765 PP

>> PF01262  Alanine dehydrogenase/PNT, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.0   0.1    0.0015       3.1      15      86 ..      81     150 ..      72     159 .. 0.76

  Alignments for each domain:
  == domain 1    score: 10.0 bits;  conditional E-value: 0.0015
                 ---B---EEEEE-------HHHHHHHH---EEEEE-SSTTHHHHHHH----BCSS.TTTTTTTSB-B----- CS
     PF01262  15 aggvkpakvvviGaGvvGlgAievakglgaevvaldkrperleqveslgaefvevdrseeeerkeydkeese 86 
                 + + + a ++v+GaGv Gl+ ++ a + ga+v  +  + +    ++s+ + +++   +e++   +y k + +
  ACV54358.1  81 IAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKF--HERLGITDYTKDTID 150
                 566678999***********************99998888888888877776666..344444446666555 PP

>> PF05800  Gas vesicle synthesis protein GvpO
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.4   0.0    0.0014       2.9      33      94 ..     197     257 ..     174     265 .. 0.87

  Alignments for each domain:
  == domain 1    score: 10.4 bits;  conditional E-value: 0.0014
     PF05800  33 eLlgkeaegvssvertedggwrveveVvEraripdtqdllasYeveLdaegellgYrrvery 94 
                 e+   ++egv +++++   +w+ + +  E+ +    + ++a+Ye ++ ++g  ++Y  +++y
  ACV54358.1 197 EIGYTDTEGVFTAHPGSH-NWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQY 257
                 6666789********888.***************************************9999 PP

>> PF10531  SLBB domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0042       8.7      17      42 ..     455     480 ..     453     484 .. 0.86

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0042
                 ----BHHHHHTTT-----S....... CS
     PF10531  17 piGttlsdlleqAGGltddayrdsin 42 
                   G+t++++++q  Gl+++  ++s++
  ACV54358.1 455 VKGDTIEEVIAQLDGLDPENAKKSVE 480
                 67*****************8888887 PP

>> PF01210  NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.3    0.0066        14       3      34 ..      89     120 ..      87     133 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0066
                 EEEE-------HHHHHHCCTEEEEEEE-S-HH CS
     PF01210   3 vavlGaGswGtalAkvlaenghevrlWvreek 34 
                 + v+GaG  G a A++ +e+g +v+l++ +++
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAASSQ 120
                 88************************998776 PP

>> PF02558  Ketopantoate reductase PanE/ApbA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.1    0.0087        18       1      45 [.      89     135 ..      89     153 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0087
                 EEEE-------HHHHHHTCHHHEEEEE-S-H.HHHH.HHH---EEEE CS
     PF02558   1 iailGaGaiGsllaakLakagadvtlilrsr.rlea.lkknglrlks 45 
                 i ++GaG  G  +aa  ++ gadv+l + s  ++++   ++g+  k+
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAASSqPVARgGSNHGIGTKF 135
                 78*************************99997887766666665555 PP

>> PF11698  V-ATPase subunit H
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.0    0.0079        16      38      89 ..     173     224 ..     165     231 .. 0.91

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0079
     PF11698  38 eedefkllkkLielleksedkttlavacnDigefvrlypegknileklkvke 89 
                  +++ + ++ Li+l+e +  +tt+++   D   ++  +p ++n +e+ + ke
  ACV54358.1 173 INNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAHPGSHNWVEQADGKE 224
                 578899999**************************************99997 PP

>> PF01494  FAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.2    0.0067        14       1      35 [.      86     120 ..      86     136 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.0067
                 EECEEE--------HHHHHHHHH.HHEEEEESSSC CS
     PF01494   1 etdVlIVGaGpaGlmlallLseaGvrvvlvekhst 35 
                 e+d+++VGaG +Gl  a   +e G +v+l    s+
  ACV54358.1  86 EADIIVVGAGVSGLACAASATEEGADVILFAASSQ 120
                 5799**********************998766655 PP

>> PF05139  Erythromycin esterase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0    0.0084        18      73     113 ..     458     498 ..     454     513 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0084
                 HHHHHHHHHHHHCHCCCCHHHHHHHTTGGGGSSCHHHHCTS CS
     PF05139  73 asmaavleyLervdpeaaeeareryaclepwgaddpqaygl 113
                 + +++v++ L+  dpe a++  ery++l + + dd   +++
  ACV54358.1 458 DTIEEVIAQLDGLDPENAKKSVERYNELCEAKYDDDFHKSA 498
                 5789************************9997777765544 PP

>> PF00743  Flavin-binding monooxygenase-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1    0.0052        11       4      33 ..      89     118 ..      86     123 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.0052
     PF00743   4 vaviGaGvsGlasikccleegleptcfers 33 
                 + v+GaGvsGla   +  eeg + + f  s
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAAS 118
                 789******************998888765 PP

>> PF06714  Gp5 N-terminal OB domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0      0.02        42      83     107 ..     274     298 ..     224     311 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.02
                 -------SS-----S-TTT---... CS
     PF06714  83 sDPngqyPryvgnDvnvLarggvdi 107
                  DP g+y +yvg  + vLa g+  +
  ACV54358.1 274 KDPDGNYVKYVGRKAIVLATGDFSA 298
                 6********************9654 PP

>> PF03037  Kinetoplastid membrane protein 11
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0     0.017        36       4      37 ..     459     492 ..     456     507 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.017
     PF03037   4 tyeefaakldrldeefakkmeeqnkkffadkpde 37 
                 t+ee  a+ld ld e akk  e+ +++   k d+
  ACV54358.1 459 TIEEVIAQLDGLDPENAKKSVERYNELCEAKYDD 492
                 89*****************999887777666665 PP

>> PF05099  Tellurite resistance protein TerB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0     0.017        35      47      79 ..     459     491 ..     456     503 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.017
     PF05099  47 airellrsrygldpeeakalielfeeaeeeaad 79 
                  i+e++++  gldpe+ak+ +e ++e++e++ d
  ACV54358.1 459 TIEEVIAQLDGLDPENAKKSVERYNELCEAKYD 491
                 6899************************99544 PP

>> PF03721  UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.1     0.026        53       3      37 ..      89     123 ..      87     129 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.026
                 EEEE--------HHHHCCCCSSEEEEE-S-HHHHH CS
     PF03721   3 iaviGlGYvGlptavvlaekghevvgvDineekvd 37 
                 i v+G+G  Gl +a+   e g +v+++  +++ v+
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAASSQPVA 123
                 89***********************9988887765 PP

>> PF05580  SpoIVB peptidase S55
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.1     0.032        66     158     213 ..     229     284 ..     217     288 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.032
     PF05580 158 atkslvikvvdekllektGGivqGmsGsPiiqnnkvvGavthvlvndPekGygvyi 213
                 +  +lvi + +ek+ e+ G i     G  +i+++   G v  ++ +dP+  y  y+
  ACV54358.1 229 TGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNYVKYV 284
                 45789*********************************************999887 PP

>> PF11512  Agrobacterium tumefaciens protein Atu4866
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0       0.1   2.1e+02      12      26 ..     148     162 ..     142     178 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.1
     PF11512  12 taDgrirheLlpngr 26 
                 t Dg+ir+eL  ng 
  ACV54358.1 148 TIDGFIRQELARNGY 162
                 78********99984 PP

>> PF00582  Universal stress protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0      0.04        84      94     116 ..      78      99 ..      58     118 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.04
                 HHHHHHHTTSSEEEEE--EE-S- CS
     PF00582  94 ivevaeeenadliVmGsrgrsgl 116
                   e+a++++ad+iV+G+   sgl
  ACV54358.1  78 DSEIAQAYEADIIVVGAGV-SGL 99 
                 5799************976.555 PP

>> PF10909  Protein of unknown function (DUF2682)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.041        85      49      76 ..     166     192 ..     155     193 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.041
     PF10909  49 kqknlkiLktNiknCinilidLitiKky 76 
                 ++k +k+++ N    +n+lidL+  K y
  ACV54358.1 166 QKKWYKWIN-NSASTMNWLIDLMEAKGY 192
                 678888885.77888*******988877 PP

>> PF07812  TfuA-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.047        98       8      41 ..      74     107 ..      68     112 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.047
     PF07812   8 aaVahkEilaalkkgvkvvGaasmGAlRAaElda 41 
                 + Va  Ei +a ++++ vvGa+  G   Aa  ++
  ACV54358.1  74 EPVADSEIAQAYEADIIVVGAGVSGLACAASATE 107
                 5799*****************9999777776555 PP

>> PF01884  PcrB family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.056   1.2e+02     175     209 ..      80     114 ..      62     118 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.056
                 HHHCC-SSSEEEE-----SHHHHHHHCCC.SSEEE CS
     PF01884 175 kvkkvledarlivGGGiksaEkAkelvkaGADviv 209
                 ++ +  e  +++vG G+     A+   ++GADvi+
  ACV54358.1  80 EIAQAYEADIIVVGAGVSGLACAASATEEGADVIL 114
                 566777888999*********************97 PP

>> PF00127  Copper binding proteins, plastocyanin/azurin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.092   1.9e+02      18      53 ..     195     230 ..     179     255 .. 0.73

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.092
                 SEEEETTSEEEEEEESSSSEEEEEECTSSTT--THH CS
     PF00127  18 eitvkkgekvtfvnlavmgHNvvldkdgvpagvdkd 53 
                 ++++  ++++   + +  +HN+v ++dg ++g+++ 
  ACV54358.1 195 TMEIGYTDTEGVFTAHPGSHNWVEQADGKESGAATG 230
                 5666667777777777899*******9999988754 PP

>> PF12236  Bacteriophage head to tail connecting protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.048        99     125     161 ..     236     272 ..     234     287 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.048
     PF12236 125 llyieedekglvrfeavplgsyvvarda.nGnvvdivf 161
                 ++y e+ ++++ +++  ++g+y +++d+  G+ v +++
  ACV54358.1 236 AMYEEKIKEQGGQIHYSTIGQYLIREDNnTGR-VSAIV 272
                 7899999999******************6777.88776 PP

>> PF05023  Phytochelatin synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.066   1.4e+02     138     170 ..     230     262 ..     206     264 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.066
     PF05023 138 dgrfvivnysrkalgqtggGHfsPigaydaesd 170
                  ++ vi+ y+ k+ +q g+ H+s ig y   +d
  ACV54358.1 230 GENLVIAMYEEKIKEQGGQIHYSTIGQYLIRED 262
                 56789999********************98877 PP

>> PF04127  DNA / pantothenate metabolism flavoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.068   1.4e+02      28      54 ..      94     120 ..      89     272 .. 0.66

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.068
                 ------HHHHHHHH---EEEEEE-TTS CS
     PF04127  28 sGkrGaaiaeeflkaGyeVillarets 54 
                 +G  G+a a  + ++G++Vil a++  
  ACV54358.1  94 AGVSGLACAASATEEGADVILFAASSQ 120
                 7999****************9987654 PP

>> PF00954  S-locus glycoprotein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.4      0.16   3.3e+02      81     101 ..     556     576 ..     528     580 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.16
     PF00954  81 dvYkvCGpyglCdsktspkCk 101
                 d Y+ C ++++C ++   +C+
  ACV54358.1 556 DSYANCYNFAICGHNLGMNCN 576
                 89**********999999998 PP

>> PF00965  Tissue inhibitor of metalloproteinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.23   4.7e+02      89     112 ..     291     314 ..     280     324 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.23
                 EEE--B-.---EE--TTSCEEEGG CS
     PF00965  89 liaGklvsdgklhvslCdfvepwe 112
                 l +G ++++  ++ ++C++v+p  
  ACV54358.1 291 LATGDFSANQDMMAKYCSWVAPLL 314
                 6799****************9865 PP

>> PF05095  Protein of unknown function (DUF687)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0     0.098     2e+02      55      83 ..     531     559 ..     527     575 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.098
     PF05095  55 leglhlselrgepVrvlynsGellasslf 83 
                 +e +++++ ++ep+ +lyn G +++ s  
  ACV54358.1 531 NENMQVCDEQNEPIEGLYNLGIMVGDSYA 559
                 899******************76666555 PP

>> PF12202  Oxidative-stress-responsive kinase 1 C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.51   1.1e+03      25      35 ..     578     588 ..     577     589 .] 0.93

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.51
     PF12202  25 FeFdlekDtaE 35 
                 F+++l+kD aE
  ACV54358.1 578 FAYMLGKDLAE 588
                 9*******999 PP

>> PF01498  Transposase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0      0.14     3e+02      21      46 ..     240     265 ..     235     271 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.14
     PF01498  21 nelseegkkvsrsTirrrLrkaglkk 46 
                 ++++e+g +++ sTi ++L ++++++
  ACV54358.1 240 EKIKEQGGQIHYSTIGQYLIREDNNT 265
                 678889*************8887765 PP

>> PF06112  Gammaherpesvirus capsid protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   3.2       0.2   4.2e+02      88     130 ..      15      61 ..       3      81 .. 0.64

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.2
     PF06112  88 igsalsassssasgvpggaa......lSsssvsalsSgpsslssssses 130
                 +g +l ++ ++a+g++g aa       ++ss  ++sSg ++ +s+  e+
  ACV54358.1  15 KGAMLAGAGTAAFGLAGCAAngggasGGASSNASASSGTAGQLSA--EA 61 
                 445678888899999988887777332333334455555544444..33 PP

>> PF02254  TrkA-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.26   5.5e+02       1      34 [.      89     122 ..      89     131 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.26
                 EEEE---HHHHHHHHHHHHTCEEEEEEESSHHHH CS
     PF02254   1 iiiiGlGrvGrslaeeLsegekdvvvidkdeerv 34 
                 ii++G+G  G + a   +e++ dv+++  +++ v
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVILFAASSQPV 122
                 89*****************555799998877665 PP

>> PF08802  Cytochrome B6-F complex Fe-S subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.2      0.32   6.6e+02       7      32 ..       9      34 ..       7      35 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.32
     PF08802  7 srRqllNllllGavalpalgalyPyv 32
                 rR++l   +l++++  a g++++++
  ACV54358.1  9 DRRSFLKGAMLAGAGTAAFGLAGCAA 34
                79*************99999999987 PP

>> PF00670  S-adenosyl-L-homocysteine hydrolase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.23   4.7e+02      26      51 ..      89     114 ..      81     122 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.23
                 EEEE---------HHHH-----EEEE CS
     PF00670  26 avvaGyGdvGkGcaaslkalGarviv 51 
                 ++v+G G  G  caas  + Ga vi+
  ACV54358.1  89 IIVVGAGVSGLACAASATEEGADVIL 114
                 6899******************9986 PP

>> PF04472  Protein of unknown function (DUF552)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.32   6.7e+02      25      50 ..     463     488 ..     460     490 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.32
     PF04472  25 VivnltrlekdeaqRildflagavya 50 
                 Vi+ l +l++++a++ +++ +++++a
  ACV54358.1 463 VIAQLDGLDPENAKKSVERYNELCEA 488
                 9*****************99999887 PP

>> PF08139  Prokaryotic membrane lipoprotein lipid attachment site
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   2.9      0.36   7.5e+02      16      26 .]      24      34 ..      18      34 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.36
     PF08139 16 lallmLaGCas 26
                +a++ LaGCa+
  ACV54358.1 24 TAAFGLAGCAA 34
                79999****96 PP

>> PF02310  B12 binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.41   8.5e+02      24      60 ..      82     118 ..      75     124 .. 0.78

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.41
     PF02310  24 lraaGfeveildanvenedivealaaeepdvvglSal 60 
                 ++a+  ++++++a v+  + ++++ +e +dv+++ a 
  ACV54358.1  82 AQAYEADIIVVGAGVSGLACAASATEEGADVILFAAS 118
                 4444458889999999999999999999999999873 PP

>> PF07649  C1-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0       1.1   2.2e+03       9      18 ..     503     512 ..     503     515 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 1.1
     PF07649   9 pidggpfYsC 18 
                 pi++gpfY C
  ACV54358.1 503 PIKEGPFYGC 512
                 78899***** PP

>> PF08055  Tryptophan leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.3      0.38     8e+02      12      18 .]     208     214 ..     207     214 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.38
     PF08055  12 TAHPAAH 18 
                 TAHP  H
  ACV54358.1 208 TAHPGSH 214
                 9***998 PP

>> PF10471  Anaphase-promoting complex APC subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   1.2       1.3   2.7e+03      39      80 ..      36      77 ..      29      87 .. 0.64

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 1.3
     PF10471 39 vggsegegvaeaaggtsdssaksraelineriGykPhPkPnt 80
                +gg++g + ++a++++ ++   s + +++    ++  P+P +
  ACV54358.1 36 GGGASGGASSNASASSGTAGQLSAEAISKGTWAFEIAPEPVA 77
                556666555666666666655566666666667777777655 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (589 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       394  (0.0330759); expected 238.2 (0.02)
Passed bias filter:                      293  (0.024597); expected 238.2 (0.02)
Passed Vit filter:                        49  (0.0041135); expected 11.9 (0.001)
Passed Fwd filter:                        49  (0.0041135); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              48  [number of targets reported over threshold]
# CPU time: 0.39u 0.06s 00:00:00.45 Elapsed: 00:00:00
# Mc/sec: 3260.50
//