# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12729.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV54634.1  [L=367]
Description: elen0 ACV54634.1 GIB01015CH01 "protein of unknown function DUF917"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   3.8e-114  383.6   0.4   4.3e-114  383.4   0.3    1.0  1  PF06032  Protein of unknown function (DUF917)
  ------ inclusion threshold ------
       0.11   14.6   0.1        0.2   13.8   0.1    1.4  1  PF03743  Bacterial conjugation TrbI-like protein
        1.7    9.9   0.1        2.4    9.4   0.0    1.1  1  PF03302  Giardia variant-specific surface protein
         14    7.8   0.0         28    6.9   0.0    1.5  1  PF08671  Anti-repressor SinI
         27    7.3   0.1         68    6.0   0.1    1.7  1  PF09867  Uncharacterized protein conserved in bacteria (DUF2
         30    6.8   0.0         69    5.7   0.0    1.5  1  PF01248  Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
         35    6.4   0.0         59    5.6   0.0    1.3  1  PF06184  Potexvirus coat protein
         46    6.6   0.0    1.5e+02    5.0   0.0    1.8  1  PF02941  Ferredoxin thioredoxin reductase variable alpha cha
         48    6.0   0.3         84    5.2   0.0    1.5  1  PF02776  Thiamine pyrophosphate enzyme, N-terminal TPP bindi
         53    6.3   0.0    1.1e+02    5.3   0.0    1.4  1  PF08308  PEGA domain
         61    5.6   0.0         97    4.9   0.0    1.2  1  PF06871  TraH_2
         86    5.7   0.1      2e+02    4.5   0.0    1.6  1  PF11693  Protein of unknown function (DUF2990)
         89    5.8   0.0    1.7e+02    4.9   0.0    1.4  1  PF08439  Oligopeptidase F
    1.5e+02    4.6   0.0      3e+02    3.5   0.0    1.5  1  PF12556  Cobaltochelatase CobS subunit N terminal
    1.5e+02    3.7   0.0    2.2e+02    3.1   0.0    1.1  1  PF02646  RmuC family
    1.6e+02    4.7   0.0    3.1e+02    3.8   0.0    1.4  1  PF10709  Protein of unknown function (DUF2511)
    2.2e+02    4.6   0.5    1.3e+03    2.1   0.3    2.1  1  PF08544  GHMP kinases C terminal
    2.4e+02    3.2   0.1    3.8e+02    2.6   0.1    1.2  1  PF05145  Putative ammonia monooxygenase
    3.1e+02    3.8   1.1    7.8e+02    2.5   0.8    1.6  1  PF00899  ThiF family
    3.5e+02    4.2   0.1    1.3e+03    2.5   0.1    1.9  1  PF08251  Mastoparan peptide
    4.3e+02    2.9   0.2    9.5e+02    1.8   0.2    1.5  1  PF08252  arg-2/CPA1 leader peptide
    4.9e+02    2.9   0.1    9.5e+02    2.0   0.1    1.4  1  PF01849  NAC domain
    6.2e+02    3.1   0.0    1.2e+03    2.2   0.0    1.4  1  PF01315  Aldehyde oxidase and xanthine dehydrogenase, a/b ha
    6.3e+02    2.6   2.5    2.8e+03    0.6   1.7    2.1  1  PF10555  Phospho-N-acetylmuramoyl-pentapeptide-transferase s
    1.4e+03    1.6   0.1    2.5e+03    0.8   0.1    1.3  1  PF04624  Dec-1 repeat


Domain and alignment annotation for each model:
>> PF06032  Protein of unknown function (DUF917)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  383.4   0.3  1.1e-117  4.3e-114       4     354 .]       7     359 ..       4     359 .. 0.99

  Alignments for each domain:
  == domain 1    score: 383.4 bits;  conditional E-value: 1.1e-117
                 GGHHHHH-------------HHHHHHHHTT-----S-EEEE-GGG-----.EEEE-----HHHTT-SS----HHHHHHHHHHHH------EEE-S---- CS
     PF06032   4 edleaiatGaavLGtGGGGdpysgkllleealkeggkvevvsvdeladddlvvtvammGaPavsseklpegdealkavealeellgrkldaiislEiGg 102
                 +++e+ia Ga++LG+GGGGdpy+gkl +  a+ke g+ve++ +de++d ++++++a mGaP++  ek    +e++k ++ ++++ g+ ++a++++E+Gg
  ACV54634.1   7 QEIEDIALGATLLGAGGGGDPYIGKLTAIGAVKECGEVELIGIDEVPDGAFIMPAASMGAPTILAEKGVGANEFAKLFDMVSRYYGKPIYATMPIEAGG 105
                 79******************************************************************9999*************************** PP

                 ---HHHHHHHHH---EEES--------SSGGGSHHHH------SEEE------BEEE--B---HHHHHHHHHHCTT-------EEEEE-TTT------- CS
     PF06032 103 lnslvallvaaklglpvvDaDgmGRAfPelqmttfavaglsatpavladekgnsvilteaaddarverllRaalvemGgsaalaaypmsgaelkeaail 201
                 +ns+ ++++aa+lg+p+vD+DgmGRAfPelqm+tf++ g satp++ +dekgns il ++ +++++e+++Raa++ mGg  ++a   m +++ k+++++
  ACV54634.1 106 VNSMLPIAAAARLGIPMVDVDGMGRAFPELQMVTFTIGGASATPMAFIDEKGNSGIL-DTITNKWTEDIARAATMTMGGTLTVALFCMDVDTCKQYGVH 203
                 *********************************************************.99*************************************** PP

                 --HHHHHH---TTT-----SH....HHHHHHHHHH---EEEEEEE---------------EEEE-....---EEEEEESSSEEEEEET-SS-SEETTSE CS
     PF06032 202 gtlslaleiGraireareksa....dviealldalggkllfkGkivdveretkgGfdvGkvtiegleedkgrtlkipfqNEnllaeknkgevlatvPDl 296
                 g ++++ e+Grair+a+ ++a    ++ e +l+ +gg+ lfkGki+dv ret+g+f+ G+v++eg+ ed+g++  ++fqNEnl +  + g++ atvPDl
  ACV54634.1 204 GIVTRSEELGRAIRTAKDEAAaaglTPEEFFLKFTGGHKLFKGKISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVDFQNENLSCVVD-GQIKATVPDL 301
                 ****************99998777778899**********************************************************.********** PP

                 EEEEE-----------TT----EEEEEE---GGG--..--HHHHHHC----------- CS
     PF06032 297 ItvldeetgepvtteelryGlkVaVialpaspkwrtekglevvgpaafgydieykple 354
                 I+++d +t +pv t+ l+yG++V  ++l + ++wrt++gl++vgp++fg+d++y+p+e
  ACV54634.1 302 ICLVDPDTFTPVPTDALKYGKRVLAVGLECFHLWRTQAGLDLVGPRYFGIDTDYIPVE 359
                 ********************************************************97 PP

>> PF03743  Bacterial conjugation TrbI-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.8   0.1   5.1e-05       0.2      83     123 ..     149     189 ..     126     229 .. 0.72

  Alignments for each domain:
  == domain 1    score: 13.8 bits;  conditional E-value: 5.1e-05
     PF03743  83 gspgaDelGkaGirGrvdnhfgqrfggalllsllsgaaqaa 123
                  ++++De+G +Gi +++ n++ + +++a+ +++ + ++ a+
  ACV54634.1 149 PMAFIDEKGNSGILDTITNKWTEDIARAATMTMGGTLTVAL 189
                 57899**************************9988776666 PP

>> PF03302  Giardia variant-specific surface protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.4   0.0   0.00059       2.4     137     220 ..     157     240 ..     142     246 .. 0.83

  Alignments for each domain:
  == domain 1    score: 9.4 bits;  conditional E-value: 0.00059
     PF03302 137 gndgtkgtcGegcatgtgaGacktcGltidGasycsecateteypqnGvcas..kaaratatckdssvadGvcsscadgylkmnGG 220
                 gn g   t  ++ +++ +  a  t G t+  a +c + +t ++y   G+ +   +  ra+ t kd ++a G+     + +lk  GG
  ACV54634.1 157 GNSGILDTITNKWTEDIARAATMTMGGTLTVALFCMDVDTCKQYGVHGIVTRseELGRAIRTAKDEAAAAGLT--PEEFFLKFTGG 240
                 77777788889999999999*****************************98512568*********9999985..34556666665 PP

>> PF08671  Anti-repressor SinI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.007        28      11      22 ..     222     233 ..     221     242 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.007
                 HHHHTT--HHHH CS
     PF08671  11 EAmeaGiskEei 22 
                 EA  aG+++Ee+
  ACV54634.1 222 EAAAAGLTPEEF 233
                 999********8 PP

>> PF09867  Uncharacterized protein conserved in bacteria (DUF2094)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.1     0.017        68      64      90 ..     113     139 ..      92     188 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.017
                 ---EEE-EEE--B-----B--EEEEEE CS
     PF09867  64 gqaavaGvllpsvDrvGRafPLtlaaa 90 
                 ++aa +G+ +  vD  GRafP + +++
  ACV54634.1 113 AAAARLGIPMVDVDGMGRAFPELQMVT 139
                 457889***************554444 PP

>> PF01248  Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.017        69      53      87 ..     196     229 ..     193     235 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.017
                 HHHHTTEEEEEESTTTTHHHHHHHTST-SEEEESE CS
     PF01248  53 lckekevpyvkvkskkeLGelvgkkrpvsalaikd 87 
                  ck+++v+ + + s +eLG+++   +  +a+a  +
  ACV54634.1 196 TCKQYGVHGIVTRS-EELGRAIRTAKDEAAAAGLT 229
                 5999****999999.********999955555444 PP

>> PF06184  Potexvirus coat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.015        59      45      68 ..     127     152 ..     114     171 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.015
                 ------E...EEEEEEEE-EESS-EEE CS
     PF06184  45 nmGdraf...qvvaakivvvsaaplly 68 
                 +mG raf   q+v+++i ++sa+p+ +
  ACV54634.1 127 GMG-RAFpelQMVTFTIGGASATPMAF 152
                 666.4443449**************87 PP

>> PF02941  Ferredoxin thioredoxin reductase variable alpha chain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.037   1.5e+02      33      52 ..      83     102 ..      78     104 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.037
                 EEEE-SB----B---SS-EE CS
     PF02941  33 vkqvvaewkGkpisanlPvk 52 
                 + ++v+ + Gkpi a++P+ 
  ACV54634.1  83 LFDMVSRYYGKPIYATMPIE 102
                 6789**************85 PP

>> PF02776  Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.021        84      57      94 ..      86     123 ..      75     178 .. 0.94

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.021
                 H----SS----EE--S--------HHHHHHHH------ CS
     PF02776  57 gyaratgkpgvvlvtsgpGatnaltglaeAyvdriPvl 94 
                  ++r  gkp  +++    G +n +  +a A + +iP++
  ACV54634.1  86 MVSRYYGKPIYATMPIEAGGVNSMLPIAAAARLGIPMV 123
                 578899*******************************8 PP

>> PF08308  PEGA domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.027   1.1e+02      25      53 ..     311     339 ..     304     342 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.027
     PF08308  25 TPvtlsdlpagthtlrlekeGYedysetv 53 
                 TPv +  l+ g++ l + +e ++ ++++ 
  ACV54634.1 311 TPVPTDALKYGKRVLAVGLECFHLWRTQA 339
                 9**9999******************9975 PP

>> PF06871  TraH_2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.024        97      71     120 ..      48      95 ..      39     102 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.024
     PF06871  71 GltqyPaGvGvkdaadlkpdlvdacenlrkGtalfakvyrivvkwyGnpt 120
                 G+   P G  ++ aa + +  + a +    G+  fak++ +v ++yG+p 
  ACV54634.1  48 GIDEVPDGAFIMPAASMGAPTILAEKG--VGANEFAKLFDMVSRYYGKPI 95 
                 566666666666666666555555443..58999*************996 PP

>> PF11693  Protein of unknown function (DUF2990)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.05     2e+02       4      35 ..      59      90 ..      56      97 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.05
     PF11693  4 ltAtslAAPtlfdniYdySddlaeflgrVsky 35
                + A s+ APt++ +    ++++a+ +  Vs+y
  ACV54634.1 59 MPAASMGAPTILAEKGVGANEFAKLFDMVSRY 90
                4599*********9999999999999999998 PP

>> PF08439  Oligopeptidase F
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.043   1.7e+02      45      64 ..      69      88 ..      68      89 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.043
                HH-----TTTHHHHHHHHHH CS
     PF08439 45 lLaalseglgawsrlfdelt 64
                +La+++ g++ + +lfd+ +
  ACV54634.1 69 ILAEKGVGANEFAKLFDMVS 88
                8****************976 PP

>> PF12556  Cobaltochelatase CobS subunit N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.076     3e+02      17      23 ..     348     354 ..     347     355 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.076
     PF12556  17 vFGIDsD 23 
                  FGID+D
  ACV54634.1 348 YFGIDTD 354
                 5*****9 PP

>> PF02646  RmuC family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0     0.055   2.2e+02      59      98 ..     247     286 ..     245     307 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.055
     PF02646  59 nLkkiLknkktrGnwGEvqLeriLedsGlregleYetqvs 98 
                 +++++L++++ + n+G v+Le i ed G ++ ++++ +  
  ACV54634.1 247 KISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVDFQNENL 286
                 67889999999999*********************98754 PP

>> PF10709  Protein of unknown function (DUF2511)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.077   3.1e+02      49      76 ..     187     214 ..     168     225 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.077
     PF10709  49 aalfvankktlvqYalngvAesqvksGk 76 
                  alf ++ +t +qY + g+ ++  + G+
  ACV54634.1 187 VALFCMDVDTCKQYGVHGIVTRSEELGR 214
                 579***************9998877776 PP

>> PF08544  GHMP kinases C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.3      0.33   1.3e+03      45      57 ..      13      25 ..       4      25 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.33
     PF08544 45 algaklsGaGgGp 57
                alga l GaGgG+
  ACV54634.1 13 ALGATLLGAGGGG 25
                799********97 PP

>> PF05145  Putative ammonia monooxygenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1     0.095   3.8e+02     269     291 ..     101     123 ..      87     133 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.095
     PF05145 269 taPGgiaemalvAlalqadvalV 291
                 +  Gg+++m  +A+a+ + +++V
  ACV54634.1 101 IEAGGVNSMLPIAAAARLGIPMV 123
                 444*******************9 PP

>> PF00899  ThiF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.8      0.19   7.8e+02       7      37 ..      18      52 ..      14      53 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.19
     PF00899  7 vvGaGglGseaaeaLaraGv....gkltlvDkDtv 37
                ++GaGg G + +  L+++G     g+++l+  D+v
  ACV54634.1 18 LLGAGGGGDPYIGKLTAIGAvkecGEVELIGIDEV 52
                79****************98888899999988876 PP

>> PF08251  Mastoparan peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.33   1.3e+03       4      12 ..     318     326 ..     317     327 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.33
     PF08251   4 LKLGKkVid 12 
                 LK GK V +
  ACV54634.1 318 LKYGKRVLA 326
                 9******88 PP

>> PF08252  arg-2/CPA1 leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.2      0.24   9.5e+02      17      22 ..     333     338 ..     333     339 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.24
     PF08252  17 HiWkAl 22 
                 H+W++ 
  ACV54634.1 333 HLWRTQ 338
                 ****95 PP

>> PF01849  NAC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.1      0.24   9.5e+02       8      19 ..       1      12 [.       1      13 [. 0.94

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.24
                ------EEE--- CS
     PF01849  8 lkklglkeiegv 19
                ++k+g++eie++
  ACV54634.1  1 MRKIGIQEIEDI 12
                89*********9 PP

>> PF01315  Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0       0.3   1.2e+03      19      96 ..     136     213 ..     124     220 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.3
                 EEEE-SSSSEEEEEEE-HHHHH-----EEEEGGGCCSCTEEEE-SSCS.EEEESS-SSEESSTT-EEEEEEESSHHHH CS
     PF01315  19 afvrStkahAkiksidtsealalpGVvavitakdvpeknkeigasaeedeedallakdkvrfvgqivalVvAedeeaA 96 
                 ++v+ t+  A  + + + + +   G+++ it k  ++  ++  +++  + + al++ d+ +++   v  +v ++ee  
  ACV54634.1 136 QMVTFTIGGASATPMAFIDEKGNSGILDTITNKWTEDIARAATMTMGGTLTVALFCMDVDTCKQYGVHGIVTRSEELG 213
                 566667777777777788888889999****99999998888867776767899999999999999999998888765 PP

>> PF10555  Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   1.7      0.71   2.8e+03       6      11 ..     180     185 ..     177     185 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.71
     PF10555   6 TMGGvl 11 
                 TMGG l
  ACV54634.1 180 TMGGTL 185
                 9***86 PP

>> PF04624  Dec-1 repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.1      0.62   2.5e+03      11      18 ..     169     176 ..     168     179 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 0.62
     PF04624  11 WtEeQAKi 18 
                 WtE+ A++
  ACV54634.1 169 WTEDIARA 176
                 ****9997 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (367 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       204  (0.0171256); expected 238.2 (0.02)
Passed bias filter:                      191  (0.0160343); expected 238.2 (0.02)
Passed Vit filter:                        26  (0.00218267); expected 11.9 (0.001)
Passed Fwd filter:                        26  (0.00218267); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              25  [number of targets reported over threshold]
# CPU time: 0.24u 0.04s 00:00:00.27 Elapsed: 00:00:00
# Mc/sec: 3301.32
//