# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12736.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV55249.1  [L=166]
Description: elen0 ACV55249.1 GIB01015CH01 "hydrogenase maturation protease"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      1e-18   69.8   0.0    1.2e-18   69.5   0.0    1.0  1  PF01750  Hydrogenase maturation protease
  ------ inclusion threshold ------
        6.1    9.5   0.0         12    8.5   0.0    1.7  1  PF07785  Protein of unknown function (DUF1623)
         24    6.4   0.0         36    5.9   0.0    1.3  1  PF01234  NNMT/PNMT/TEMT family
         55    5.9   0.0         85    5.3   0.0    1.2  1  PF05148  Hypothetical methyltransferase
         75    5.9   0.1    1.2e+02    5.3   0.0    1.4  1  PF05014  Nucleoside 2-deoxyribosyltransferase
    1.1e+02    4.5   0.0    1.4e+02    4.2   0.0    1.1  1  PF11031  Bacteriophage T holin
    1.3e+02    5.0   0.0      2e+02    4.4   0.0    1.3  1  PF00958  GMP synthase C terminal domain
    1.5e+02    3.6   0.0    2.1e+02    3.1   0.0    1.2  1  PF00266  Aminotransferase class-V
    1.7e+02    3.9   0.0      2e+02    3.7   0.0    1.1  1  PF08433  Chromatin associated protein KTI12
    1.8e+02    4.2   0.0    2.4e+02    3.8   0.0    1.3  1  PF02639  Uncharacterized BCR, YaiI/YqxD family COG1671
    1.8e+02    3.1   0.1    2.2e+02    2.8   0.0    1.1  1  PF02652  L-lactate permease
    2.3e+02    3.9   0.1    4.1e+02    3.1   0.1    1.4  1  PF01744  GLTT repeat (6 copies)
    3.5e+02    3.8   0.0    5.8e+02    3.0   0.0    1.2  1  PF01900  Rpp14/Pop5 family
    4.1e+02    3.4   0.1      7e+02    2.7   0.0    1.3  1  PF11522  Yeast phosphatidylinositol-4-OH kinase Pik1
      5e+02    3.3   0.0      6e+02    3.1   0.0    1.2  1  PF12505  Protein of unknown function (DUF3712)
    5.2e+02    2.6   0.0    1.1e+03    1.5   0.0    1.4  1  PF00117  Glutamine amidotransferase class-I
    2.3e+03    0.8   0.0    3.7e+03    0.1   0.0    1.2  1  PF02550  Acetyl-CoA hydrolase/transferase N-terminal domain


Domain and alignment annotation for each model:
>> PF01750  Hydrogenase maturation protease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   69.5   0.0     2e-22   1.2e-18       2     128 ..      25     152 ..      24     154 .. 0.95

  Alignments for each domain:
  == domain 1    score: 69.5 bits;  conditional E-value: 2e-22
                 HHHHHHHHHEC--TTEEEE-----SGCCHHHHCC-SEEEEEE---S.-S------BEECCHHHHHHTTC.CGTTT-BHHHHHHHHHHH--..SEEEEE- CS
     PF01750   2 rvvekLkkryedeenvelidgGtggldlvelleeadkviivDavdf.glepGtlkileveeipkklkakkmsaHqlplsevlklleekgeipkevillg 99 
                  v+e+L  ry  ++nvel+d G   l+++e+++e+d +i vDavd+ + +pGt+ ++e++   +  +a+  s+H+l l+++ ++++  g +++e + lg
  ACV55249.1  25 AVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVIITVDAVDGtDADPGTVFRFEPDAMARHSGAT-ASLHDLKLVDLFDAAALLG-YEAEGLCLG 121
                 699*******************************************9****************988888.8*****************6.799999999 PP

                 ---S---S...B----HHHHCCHHHHHHHCH CS
     PF01750 100 vqpesled..vgleLseevkkaidkavelil 128
                 +q+e+ +   v+++L+++v +a++ +ve++ 
  ACV55249.1 122 MQVENPSPavVTVGLTPKVDAALPLLVETVA 152
                 99999988899****************9986 PP

>> PF07785  Protein of unknown function (DUF1623)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0     0.002        12       5      45 ..       9      52 ..       6     111 .. 0.86

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.002
     PF07785  5 Vlavsnkldldq...keiYekyLkkfdVvdavmclnGdcLAvvv 45
                V +v nkl ld     ++Ye+ L+++d+ d+v      cL + +
  ACV55249.1  9 VFCVGNKLMLDDgvgPAVYEELLTRYDIPDNVELFDLGCLSLNM 52
                88999999996522258***************999998988755 PP

>> PF01234  NNMT/PNMT/TEMT family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0    0.0061        36      55      76 ..      12      33 ..       4      62 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.0061
                ----EEEEE------GGGTTHH CS
     PF01234 55 kkgdtllDiGaGPTvyqllsar 76
                +  + +lD G GP vy  l  r
  ACV55249.1 12 VGNKLMLDDGVGPAVYEELLTR 33
                344699**********987665 PP

>> PF05148  Hypothetical methyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.015        85      71     102 ..      37      68 ..      26      74 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.015
                 -TTS-EEEE-----HHHHH--S-..EEEEESS CS
     PF05148  71 kdnlvvadlGcGeakiaeavrekekvrsfdlv 102
                 +dn+ ++dlGc    + e+vre + ++++d v
  ACV55249.1  37 PDNVELFDLGCLSLNMIERVREYDVIITVDAV 68 
                 68999******************999999966 PP

>> PF05014  Nucleoside 2-deoxyribosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0      0.02   1.2e+02      56      80 ..      53      79 ..      47     106 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.02
                HHHHHC-SEEEEE..EESSS-----TT CS
     PF05014 56 lellrqadavvan..ldpfraDsGtaf 80
                +e++r+ d+++ +  +d+++aD+Gt+f
  ACV55249.1 53 IERVREYDVIITVdaVDGTDADPGTVF 79
                78889999999877799999*****98 PP

>> PF11031  Bacteriophage T holin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.023   1.4e+02      91     111 ..      71      91 ..      53     107 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.023
     PF11031  91 seaDfsavfsfrPknlnyfvd 111
                 ++aD  +vf+f P+++  ++ 
  ACV55249.1  71 TDADPGTVFRFEPDAMARHSG 91 
                 79*************988765 PP

>> PF00958  GMP synthase C terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.033     2e+02      32      64 ..      56      88 ..      45     103 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.033
                ----EEEEEE--B--SSS-------S-HHHHHH CS
     PF00958 32 kRtysyvvvlRavetsdfmtadvaelplevLee 64
                 R+y++++++ av  +d+  ++v++++ + + +
  ACV55249.1 56 VREYDVIITVDAVDGTDADPGTVFRFEPDAMAR 88
                69****************999999998877765 PP

>> PF00266  Aminotransferase class-V
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0     0.036   2.1e+02     160     191 ..      51      82 ..      49      90 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.036
                 HHHHHHHH---EEEEE-TTTTTTS---HHHHT CS
     PF00266 160 eiaklakeagalvvvDaaqavghipidvkklg 191
                 +++++++e+++++ vDa+ +    p  v +++
  ACV55249.1  51 NMIERVREYDVIITVDAVDGTDADPGTVFRFE 82 
                 5899**************98777666665555 PP

>> PF08433  Chromatin associated protein KTI12
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.034     2e+02     127     165 ..      24      62 ..      13      88 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.034
     PF08433 127 kelleaLiqRfEePdsknrWDsPlftvlsaeeklpldei 165
                 ++++e+L+ R++ Pd+    D   +++   e   ++d i
  ACV55249.1  24 PAVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVI 62 
                 6899************99999988888876666666655 PP

>> PF02639  Uncharacterized BCR, YaiI/YqxD family COG1671
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.04   2.4e+02      45      60 ..      52      67 ..       6      68 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.04
     PF02639 45 IveraeagdlvvTqDi 60
                ++er+++ d+++T D 
  ACV55249.1 52 MIERVREYDVIITVDA 67
                689**********995 PP

>> PF02652  L-lactate permease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.037   2.2e+02     127     162 ..     127     162 ..     113     166 .] 0.85

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.037
     PF02652 127 saalLvglGfkPlyaaglcLIantapvafGavGiPi 162
                 +++  v +G+ P + a+l L+++t++     +G P 
  ACV55249.1 127 PSPAVVTVGLTPKVDAALPLLVETVAGELARLGSPL 162
                 56789********************99888888886 PP

>> PF01744  GLTT repeat (6 copies)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1     0.069   4.1e+02       9      18 ..     128     137 ..     127     139 .. 0.64

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.069
     PF01744   9 TlGLvTmGLt 18 
                 ++ +vT GLt
  ACV55249.1 128 SPAVVTVGLT 137
                 5556676665 PP

>> PF01900  Rpp14/Pop5 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0     0.099   5.8e+02      73      96 ..      48      71 ..      41      73 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.099
                HHHHT--B----BEEEEE---B-- CS
     PF01900 73 aaLtlitsiegkpviirvlkvSGT 96
                 +L++i+++++ +vii v +v GT
  ACV55249.1 48 LSLNMIERVREYDVIITVDAVDGT 71
                689*****************9998 PP

>> PF11522  Yeast phosphatidylinositol-4-OH kinase Pik1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.12     7e+02      34      44 ..     125     135 ..     123     137 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.12
     PF11522  34 ENvsPalvLss 44 
                 EN sPa+v  +
  ACV55249.1 125 ENPSPAVVTVG 135
                 9******9876 PP

>> PF12505  Protein of unknown function (DUF3712)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0       0.1     6e+02      77     118 ..      95     136 ..      60     144 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.1
     PF12505  77 GlnslkgfsIedlqvllpdpedgtnlkatvtlpNpsvvtiel 118
                 +l +lk +++ d+  ll+ +++g  l  +v+ p p+vvt+ l
  ACV55249.1  95 SLHDLKLVDLFDAAALLGYEAEGLCLGMQVENPSPAVVTVGL 136
                 566677777888888889999999999999999999999865 PP

>> PF00117  Glutamine amidotransferase class-I
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.19   1.1e+03      77      84 ..     117     124 ..     110     128 .. 0.93

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.19
                 ------HH CS
     PF00117  77 GICLGmQl 84 
                 G CLGmQ+
  ACV55249.1 117 GLCLGMQV 124
                 89*****7 PP

>> PF02550  Acetyl-CoA hydrolase/transferase N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0      0.63   3.7e+03     170     197 ..      55      82 ..      50      83 .. 0.84

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.63
     PF02550 170 rvngydelialdkvdyivvdpekvvavv 197
                 rv+ yd +i +d vd   +dp  v  ++
  ACV55249.1  55 RVREYDVIITVDAVDGTDADPGTVFRFE 82 
                 7888***********9999998776665 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (166 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       204  (0.0171256); expected 238.2 (0.02)
Passed bias filter:                      202  (0.0169577); expected 238.2 (0.02)
Passed Vit filter:                        17  (0.00142713); expected 11.9 (0.001)
Passed Fwd filter:                        17  (0.00142713); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              17  [number of targets reported over threshold]
# CPU time: 0.16u 0.04s 00:00:00.20 Elapsed: 00:00:00
# Mc/sec: 2239.86
//