# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12738.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV55525.1  [L=948]
Description: elen0 ACV55525.1 GIB01015CH01 "isoleucyl-tRNA synthetase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   1.8e-200  669.6   0.0   2.2e-200  669.4   0.0    1.1  1  PF00133  tRNA synthetases class I (I, L, M and V)
    6.4e-30  106.6   0.0    1.4e-29  105.5   0.0    1.6  1  PF08264  Anticodon-binding domain
      6e-23   83.8   1.0    8.8e-09   37.2   0.0    3.9  3  PF09334  tRNA synthetases class I (M)
    1.8e-06   30.0   0.0    1.2e-05   27.3   0.0    2.0  1  PF01406  tRNA synthetases class I (C) catalytic domain
    0.00015   23.3   0.0     0.0039   18.6   0.0    2.3  2  PF01921  tRNA synthetases class I (K)
     0.0012   21.0   4.2     0.0012   21.0   2.9    4.1  2  PF06827  Zinc finger found in FPG and IleRS
  ------ inclusion threshold ------
        1.1   12.0   0.0        2.1   11.0   0.0    1.4  1  PF00622  SPRY domain
        1.8   10.9   0.0        4.4    9.7   0.0    1.5  1  PF01359  Transposase
        3.8   10.1   0.0          8    9.0   0.0    1.5  1  PF00482  Bacterial type II secretion system protein F domain
        7.4    8.8   7.1         51    6.1   0.0    3.4  3  PF01667  Ribosomal protein S27
        8.1    9.3   0.3         21    8.0   0.2    1.6  1  PF07949  YbbR-like protein
        8.8    8.3   6.0          7    8.6   0.3    3.1  2  PF08271  TFIIB zinc-binding
         12    8.2   5.5         82    5.6   0.2    3.0  2  PF01155  Hydrogenase expression/synthesis hypA family
         20    8.0   0.0         56    6.6   0.0    1.7  1  PF11332  Protein of unknown function (DUF3134)
         45    6.6   0.6    1.2e+02    5.3   0.4    1.6  1  PF06265  Protein of unknown function (DUF1027)
         66    5.5   0.0    4.3e+02    2.9   0.0    2.1  1  PF00994  Probable molybdopterin binding domain
         74    5.9   0.0    1.4e+02    5.0   0.0    1.5  1  PF03004  Plant transposase (Ptta/En/Spm family)
    1.2e+02    3.9   0.0    2.4e+02    2.9   0.0    1.4  1  PF09814  Uncharacterized conserved protein (DUF2351)
    1.2e+02    5.3   0.0    5.7e+02    3.1   0.0    1.9  1  PF03800  Nuf2 family
    1.5e+02    4.7   1.6    1.8e+02    4.4   0.1    1.8  1  PF07610  Protein of unknown function (DUF1573)
    1.6e+02    4.8   0.3    4.2e+02    3.5   0.2    1.6  1  PF06712  Protein of unknown function (DUF1199)
    2.1e+02    3.3   0.0    2.1e+03    0.1   0.0    2.0  1  PF06061  Baculoviridae ME53
    3.6e+02    2.6   0.0    6.2e+02    1.8   0.0    1.2  1  PF02126  Phosphotriesterase family
      4e+02    2.1   0.1    8.7e+02    1.0   0.1    1.4  1  PF00749  tRNA synthetases class I (E and Q), catalytic domai
    4.7e+02    3.5   0.3    2.3e+03    1.3   0.1    2.1  1  PF09943  Uncharacterized protein conserved in archaea (DUF21
    6.8e+02    3.0   0.0    1.5e+03    1.9   0.0    1.4  1  PF01741  Large-conductance mechanosensitive channel, MscL
    8.5e+02    1.5   0.1    1.4e+03    0.7   0.1    1.2  1  PF05460  Origin recognition complex subunit 6 (ORC6)
    9.3e+02    0.9   0.0    1.4e+03    0.3   0.0    1.1  1  PF00580  UvrD/REP helicase
      1e+03    2.6   0.6    3.3e+03    1.1   0.4    1.8  1  PF02757  YLP motif
    1.1e+03    2.4   0.5      3e+03    1.1   0.4    1.7  1  PF04728  Repeated sequence found in lipoprotein LPP
    2.1e+03    1.5   2.2    2.4e+03    1.3   0.1    2.2  1  PF12390  Selenocysteine synthase N terminal
      3e+03    0.6   0.1    5.5e+03   -0.2   0.0    1.2  1  PF09849  Uncharacterized protein conserved in bacteria (DUF2
    3.1e+03    0.6   5.3    5.2e+02    3.0   0.6    2.0  1  PF11575  FhuF 2Fe-2S C-terminal domain


Domain and alignment annotation for each model:
>> PF00133  tRNA synthetases class I (I, L, M and V)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  669.4   0.0  7.3e-204  2.2e-200       2     601 .]      29     655 ..      28     655 .. 0.96

  Alignments for each domain:
  == domain 1    score: 669.4 bits;  conditional E-value: 7.3e-204
                 HHHHHHHTTHHHHHHHHT----B--EE----B---------HHHHHHHHHHHHHHHT---B-------B----HHHHHHHH-.---ST....TS-HHHH CS
     PF00133   2 ilekWeeedlfkkslekekekekFvlvdgPPnatGslHiGhalaktlkdivirykrmkGkdveyvpGwDhhGlpieakvekklgkkekkereklgrekf 100
                 +l+kWeee ++++ lek+k+ ++F+l+dgPP+a+G +HiGha++k+lkd+v +++ ++G+ ++yvpGwD+hG pie+ vek+lg ++   ++k+ +   
  ACV55525.1  29 RLAKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHAFNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDK---MAKIDQPTL 124
                 6899*******************************************************************************8754...59999**** PP

                 HHHHHHHHHHHHHHHHHHHHT------TTS---TTSHHHHHHHHHH---TTT---EE---EEEEEETTTTEE--GGGEEEEEEEEEEEE--BEE..... CS
     PF00133 101 rekvrewkaeyaeeirkqvkrLGvsvdwdreylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEveykdvkdalihvafpl..... 194
                 r  +rew+++y++ +r+ +krLGv +dw+++ylT+ +++e+  +evf++++ +G +yrg k+++w+ +++tal+e+E+ey d+++++i+v+f++     
  ACV55525.1 125 RRLCREWAEKYVDVQREGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSPSIFVKFKMdimpg 223
                 **********************************************************************************************88888 PP

                 ......-S---..--B--EES-GGGSSG-BEEE--TTS---...------B--TTTTHHHHTTTT--...........-S-------TT--EB-GT.T- CS
     PF00133 195 ......adkke..aklviwTTtPwTllgntavavnpeleyv...vedellilaeallesllkkkkee...........ledergkeLegkkvelpl.ld 270
                       a   +  a+++iwTTtPwTl++ntav++ p+ +yv   +++ ++i+a++l+e++++   +e               +g+e++g++++ p+ +d
  ACV55525.1 224 mfetagA---AgdAYVLIWTTTPWTLPANTAVSLAPDADYVmvqADGSNMIMARELVEQVAEIAGWEsydlvrgedgePVALKGREFTGLTYTCPVrQD 319
                 7776432...1457***************************9988999**************999999999998776656789999********99788 PP

                 -SBEEEE---S----------B------HHHH----SS------------------------SSHHHHTTGGGSST------BEEEEEEEEEETTT--B CS
     PF00133 271 reipiiadeyvdkeaGtGiVkiaPahgedDyevgkkhnlevinvldedGtlneeaeefeglkrfkarkkiveeLkekglllkkekiehsypfcwrsktp 369
                  + +ii +++v+ ++GtG+V++aP+hg+dDy v+ ++++++++++d++G+l++ea  f+gl++++a+  i+e L+e+g+l+ +++i hsyp+cwr+++p
  ACV55525.1 320 LKGTIIYGDHVTLDSGTGAVHTAPGHGQDDYLVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEP 418
                 999************************************************************************************************ PP

                 -EEEEE---EE-HHH..HHHHHHHHHH.TSEESS----HHHHHHHHH---EE-EES-----B---EE-----EE-SHH.HHHHHHHHHHH---HHHHHS CS
     PF00133 370 iiyrateqWfvkvke..laeaalkave.kvkfvpkskekrykswleniqdWcisRqrwWGtripvwvsketeevvvreelkelvakrleeeaeekalek 465
                 +i+rat+qWfv++++  l+e+alka+e +v+++p ++ +r+ s++++++dWcisRqr WG++ipv+ +++++ +v++e++ + v + + +e++++++++
  ACV55525.1 419 VIFRATDQWFVSMDKnsLRENALKAIEnDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCGSTVANEQTFDAVIDLFYREGADAWFTR 517
                 **************999**********99********************************************************************** PP

                 -HHHHS.......-------EE---EE-HHHH---TT---TT....TSTTS-..SSBSEEEE--GGG---HHHHHHHHHHH----SBSEEEE---EE-- CS
     PF00133 466 eakdkl.......kkekgklekdedvlDvWFdSgstpfsvlgypeentkefkkffpadllleGlDqirgWvarlillslaltgkepykevlvhglvlde 557
                 e  + l       +++  +l+ ++d+lDvW++Sg  + svl+  +++++ ++  fpad++leG+Dq+rgW+++++l+s+   g  pyk v+  g+++d 
  ACV55525.1 518 EPSEYLprgvkceTCGCTELTPEKDILDVWWESGVSHTSVLK--HREAEGLR--FPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDG 612
                 *********988878889************************..45457777..********************************************* PP

                 ------ST------HHHHHHH---HHHHHHHH.TS-TTS-EE-- CS
     PF00133 558 eGrKMSKslgNvidpldvikkygadalRltliassdvgrdinls 601
                 eGrKMSKslgN +dp +v+ k gad+lRl+++ s d+++d+++s
  ACV55525.1 613 EGRKMSKSLGNGVDPAEVMAKSGADVLRLWVA-SVDYSQDVSIS 655
                 ********************************.99****99875 PP

>> PF08264  Anticodon-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.5   0.0   4.6e-33   1.4e-29       1     151 [.     700     865 ..     700     866 .. 0.88

  Alignments for each domain:
  == domain 1    score: 105.5 bits;  conditional E-value: 4.6e-33
                 HHHHHHHHH---HHHHHHHCTT-HHHHHHHHHHHHHHIIICCHHHHHHHHHH---HHHH......HHHHHHHHHHHHHHTTTSHHHHHHHHHHH...-- CS
     PF08264   1 drwilselnelikevteayeeyrfnkavsalyeffwndlcdwylelvkprlysesaeds.rr.aqyvllevletllrllaPimPfltEelwqrl...ee 94 
                 d+w   ++ +l+ +v++ay+ y+f+ +++a+y+ ++ndl+ +y++++k+rlyse+++++ rr +q+vl  +le l+r+laP++ f+t+e+w+++     
  ACV55525.1 700 DQWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPrRRaVQTVLMNILEVLVRVLAPVLSFTTDEVWEHYpqaMR 798
                 89*****************************************************9888988899**************************99999955 PP

                 ......--GGGS---...........----.....HHHHHHHHHHHHHHHHHHHH----TTS-EEEE CS
     PF08264  95 eklgkeesimlaewpedseel.....ekea.....eeevellkeivkairklrkelkikpseevkvv 151
                 e+ g+++ + la wp++s+++     ++e+        + +++ + ka++++r+++ +++s+e+ vv
  ACV55525.1 799 ERAGRPTNVQLAGWPKASDFApaipaDGERvsedfGVIMGVREVVTKALEDARGQKVVNKSQEAAVV 865
                 5779***********765555665543333654444477777789******************9887 PP

>> PF09334  tRNA synthetases class I (M)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.2   0.0   2.9e-12   8.8e-09       8     136 ..      59     203 ..      56     215 .. 0.78
   2 !   18.7   0.0   1.2e-06    0.0037     166     239 ..     409     483 ..     393     492 .. 0.81
   3 !   23.5   0.0   4.1e-08   0.00012     307     374 ..     595     662 ..     583     670 .. 0.82

  Alignments for each domain:
  == domain 1    score: 37.2 bits;  conditional E-value: 2.9e-12
                 -BTTS--B---HHHHHHHHHHHHHHHHTT-EEEEEE--B----HHHHHHHH-..........---H....HHHHHHHHHHHHHHHHHCT---S..EE-- CS
     PF09334   8 pYvngkpHlGhlystiaaDvlarykrlrgeevlfvtgtDehGtkielkAeke..........gltp....qelvdkvseefkelfkklnisfD..kfir 90 
                 pY+ng++H+Gh+++ i  D +++ + +rg  + +v g D hG++ie   ek           + t     +e+++k+ + ++e fk+l+++ D  + + 
  ACV55525.1  59 PYANGPIHIGHAFNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTlgpdkmakidQPTLrrlcREWAEKYVDVQREGFKRLGVNADweHPYL 157
                 8********************************************987655321111111113344111145556677778889999998876436677 PP

                 TTSHHHHHHHHHHHHHHHH---EEEEEEEEEEBTTTTB---GGG-- CS
     PF09334  91 TtseehkelvqeffkklkekgliyekeieqlYcvsderflpdryve 136
                 T +++ +    e+fk+++  g +y++     +c ++++ l++ ++e
  ACV55525.1 158 TFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIE 203
                 888888888999**************************99999864 PP

  == domain 2    score: 18.7 bits;  conditional E-value: 1.2e-06
                 S-B-S----B-EEEEEEEEEE-CCC..THHHHHHHHCCSCCCSHHHHHHHHHHHHH-----EE-ECT-----EETT CS
     PF09334 166 npksaisgskpevkeeehyffklsk..feeklkewikenkelpkenvkevlkewlkegLkdlsisrdlkwGipvpe 239
                  p++  + +  +++ ++++f +++k  ++e+ ++ i+++ e+ +  +++ + +++ +   d++isr+ +wG+p+p 
  ACV55525.1 409 YPHCWRCHEPVIFRATDQWFVSMDKnsLRENALKAIENDVEWIPAWASNRIGSMVAD-RPDWCISRQRSWGVPIPV 483
                 489*******************98633788999999999998777777777677754.7***************94 PP

  == domain 3    score: 23.5 bits;  conditional E-value: 4.1e-08
                 B-B---SBEEE---EE.E---B-BTTTTBS-BHHHHCCCS-HHHHHHHHHHTS-SSS-EEE-HHHHHHH CS
     PF09334 307 aglklpkkvvahgylt.vegekmSkSrgnvvdpeelleelgvdalRYyllreapekkDsdfseeelver 374
                  g++ +k+v+  g+ +  eg+kmSkS+gn+vdp e++++ g+d+lR  ++ ++  ++D+++s e l+++
  ACV55525.1 595 YGVPPYKAVMHCGFTVdGEGRKMSKSLGNGVDPAEVMAKSGADVLRLWVA-SVDYSQDVSISDEILQRT 662
                 567777888888886525888*************************8765.688999999998877765 PP

>> PF01406  tRNA synthetases class I (C) catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.3   0.0   3.8e-09   1.2e-05     225     299 ..     587     662 ..     563     664 .. 0.87

  Alignments for each domain:
  == domain 1    score: 27.3 bits;  conditional E-value: 3.8e-09
                 HHHHHHHHH----EEEE-----.EEETTBE--TT-----BHHHHHTTS-HHHHHHHHH---TTS-EEE-HHHHHHH CS
     PF01406 225 elaqseaafdkqlvkywlhngh.lkiegekmsksLknfltikdvlkkfdprqlRllllsahyrsqldfkeelleea 299
                  l  s+ a++ +  k  +h g+ +  eg+kmsksL+n +   +v+ k  + +lRl ++s++y + +  ++e l+++
  ACV55525.1 587 SLLTSMGAYGVPPYKAVMHCGFtVDGEGRKMSKSLGNGVDPAEVMAKSGADVLRLWVASVDYSQDVSISDEILQRT 662
                 56678889999999*******85778999*****************************************999876 PP

>> PF01921  tRNA synthetases class I (K)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.13     4e+02       9      69 ..      40      97 ..      31     163 .. 0.70
   2 !   18.6   0.0   1.3e-06    0.0039     259     341 ..     592     674 ..     571     694 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.13
                HHHHHH----.....SEEEEEE------------HHHHHHHHH---TTTT---EEEEEEEE- CS
     PF01921  9 eklieerkkkkk.ekdevvvesGispSGliHiGnlrevltadlvakalrkrgeevrlilisD 69
                e+++    +k+k +k  ++ +    + G+iHiG + + +  d+v k+  +rg  +  +  +D
  ACV55525.1 40 EQVL----EKNKdGKPFILHDGPPYANGPIHIGHAFNKILKDFVNKSHAQRGFFTPYVPGWD 97
                4444....3333134444444444578*******************9999998777776666 PP

  == domain 2    score: 18.6 bits;  conditional E-value: 1.3e-06
                 HHC------EEEE----------.-----------HHHHHTTS----HHHHHHCS-TTS----------HHHHHHHHHHHHHH- CS
     PF01921 259 eeilggeaPvgvvYelillkgge.kmssSkGnvitvedwlevaepevlrfliarkkPkkakkldldleilklvdeYdrlerkyf 341
                    +g ++ + v+   ++++g++ kms+S Gn++ +++++     +vlr+ +a++  ++ ++++ +  ++++ + Y r+++ + 
  ACV55525.1 592 MGAYGVPPYKAVMHCGFTVDGEGrKMSKSLGNGVDPAEVMAKSGADVLRLWVASVDYSQDVSISDE-ILQRTSEAYRRIRNTFR 674
                 556777766777887888887766***************************************999.99999999*99998775 PP

>> PF06827  Zinc finger found in FPG and IleRS
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.4       1.2   3.6e+03      22      27 ..     188     193 ..     187     195 .. 0.91
   2 !   21.0   2.9     4e-07    0.0012       2      27 ..     911     935 ..     910     937 .. 0.95

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 1.2
     PF06827  22 flCpRC 27 
                 ++C+RC
  ACV55525.1 188 HWCKRC 193
                 79***9 PP

  == domain 2    score: 21.0 bits;  conditional E-value: 4e-07
     PF06827   2 ekCpRCwnyiervgqggrstflCpRC 27 
                 ekCpRCwn+ +  g + ++  +C+RC
  ACV55525.1 911 EKCPRCWNH-RALGGNANHGSVCERC 935
                 8********.789999********** PP

>> PF00622  SPRY domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.0   0.0   0.00071       2.1      52     108 ..     125     181 ..      78     197 .. 0.83

  Alignments for each domain:
  == domain 1    score: 11.0 bits;  conditional E-value: 0.00071
                 TEEEE---S-EEE--SS.-SEEEEEE-S---EEEEE-CTCEE-.EEEEES------EE CS
     PF00622  52 skyhavtseetgeklqeegdviGvllDleggeisFtkngkhlg.iyafrnvefgealf 108
                 ++++  ++e++ +   e  +++Gv  D+e ++++Ft n++  g +  f+ ++ ++ ++
  ACV55525.1 125 RRLCREWAEKYVDVQREGFKRLGVNADWEHPYLTFTPNYEA-GnVEVFKRMYLDGSVY 181
                 5677778899999999999**********************.6688999999998877 PP

>> PF01359  Transposase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   0.0    0.0014       4.4       9      52 ..     520     562 ..     516     563 .. 0.89

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.0014
     PF01359   9 ksWvkpgepakstpkrnlsqkKvMlcvwWdikGvihyelLkpge 52 
                 ++++ +g + +++  ++l+++K  l vwW+ +Gv h+++Lk++e
  ACV55525.1 520 SEYLPRGVKCETCGCTELTPEKDILDVWWE-SGVSHTSVLKHRE 562
                 78999999999999***************8.69*******9986 PP

>> PF00482  Bacterial type II secretion system protein F domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0026         8       4      92 ..     588     671 ..     586     678 .. 0.86

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0026
                 HHHHHHH----HHHHHHHHHHT-S-HHHHHHHHHHHHHHH----HHHH----TTTS-HHHHHHHH-------H...HHHHHHHHHHHHHHHH CS
     PF00482   4 qlasllsaGlpllealellaeekengplaeelkrilerlrnGgslsaalartpsefpdlvaaliaagesgGnl...aevLerladyleerre 92 
                 +l s+ ++G+p+++a+ +++ +        e +++ + l nG ++++ +a+++    d+++ ++a+ + ++++   +e+L+r ++ +++ r 
  ACV55525.1 588 LLTSMGAYGVPPYKAVMHCGFTV-----DGEGRKMSKSLGNGVDPAEVMAKSG---ADVLRLWVASVDYSQDVsisDEILQRTSEAYRRIRN 671
                 5778889*************888.....999*******************988...888888888888888874446999999999999886 PP

>> PF01667  Ribosomal protein S27
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.1      0.13   3.8e+02      20      37 ..     477     494 ..     468     497 .. 0.75
   2 ?    0.8   0.6      0.75   2.3e+03      27      38 ..     527     538 ..     524     540 .. 0.73
   3 ?    6.1   0.0     0.017        51       9      36 ..     912     939 ..     910     941 .. 0.95

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.13
                 ESS-SS-EE-S----EEE CS
     PF01667  20 FshaqtvVkCisCgkvLv 37 
                 ++ +  v kC +Cg++++
  ACV55525.1 477 WGVPIPVFKCAKCGSTVA 494
                 556667889******997 PP

  == domain 2    score: 0.8 bits;  conditional E-value: 0.75
                 EE-S----EEE- CS
     PF01667  27 VkCisCgkvLve 38 
                 VkC++Cg +  +
  ACV55525.1 527 VKCETCGCTELT 538
                 899999977555 PP

  == domain 3    score: 6.1 bits;  conditional E-value: 0.017
                 E-TTT--EEEEESS-SS-EE-S----EE CS
     PF01667   9 kCpdCenetvvFshaqtvVkCisCgkvL 36 
                 kCp C n     + a+    C+ Cg  L
  ACV55525.1 912 KCPRCWNHRALGGNANHGSVCERCGDAL 939
                 9************************876 PP

>> PF07949  YbbR-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.2    0.0068        21      11      47 ..     848     883 ..     839     887 .. 0.84

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0068
     PF07949  11 elaegyvvvsgtpepvtVtvtGpesvldkieevkaev 47 
                 e+a g +vv+ + +++ V vt+p+ vld +e+ +a v
  ACV55525.1 848 EDARGQKVVNKS-QEAAVVVTAPRAVLDAVERYDAAV 883
                 677788788766.9*******************9987 PP

>> PF08271  TFIIB zinc-binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.49   1.5e+03       2      12 ..     485     493 ..     484     502 .. 0.60
   2 ?    8.6   0.3    0.0023         7       2      29 ..     912     939 ..     911     942 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.49
                 E-SSS--EEHH CS
     PF08271   2 kCPnCgstelv 12 
                 kC +Cgst  v
  ACV55525.1 485 KCAKCGST--V 493
                 67777775..3 PP

  == domain 2    score: 8.6 bits;  conditional E-value: 0.0023
                 E-SSS--EE.HHB-S----BB-SSS-B-E CS
     PF08271   2 kCPnCgste.lvfDaerGelvCtdCGlVl 29 
                 kCP C + + l  +a++G  vC++CG  l
  ACV55525.1 912 KCPRCWNHRaLGGNANHGS-VCERCGDAL 939
                 8******998999999999.******865 PP

>> PF01155  Hydrogenase expression/synthesis hypA family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.2     0.027        82      70      99 ..     483     539 ..     479     543 .. 0.90
   2 ?    4.1   0.1     0.079   2.4e+02      51      95 ..     890     938 ..     834     944 .. 0.70

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.027
     PF01155  70 svrCreCgeeveleerale...........................CpkCgsadvei 99 
                  ++C +Cg++v  e++ ++                           C++Cg ++++ 
  ACV55525.1 483 VFKCAKCGSTVANEQTFDAvidlfyregadawftrepseylprgvkCETCGCTELTP 539
                 689*********99999777899****************************998765 PP

  == domain 2    score: 4.1 bits;  conditional E-value: 0.079
     PF01155  51 lkegtvlegaeLeieevpvsv.rCreCgeeveleera...leCpkCgsa 95 
                 +++ +++eg eL  +  + ++ +C +C ++  l  +a     C++Cg a
  ACV55525.1 890 VASVSFAEGEELAATVSKTEAeKCPRCWNHRALGGNAnhgSVCERCGDA 938
                 3445589999998888777763699999999988887434459999975 PP

>> PF11332  Protein of unknown function (DUF3134)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.018        56      21      39 ..     386     404 ..     383     409 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.018
     PF11332  21 essLLdWLeasGRLiaree 39 
                 ++ +++WL++ G L+a++e
  ACV55525.1 386 NPVIIEWLRERGTLVAQKE 404
                 688************9876 PP

>> PF06265  Protein of unknown function (DUF1027)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.4     0.039   1.2e+02       9      43 ..     709     740 ..     705     750 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.039
     PF06265   9 elvenvrdafdeeklkeryseilekyDyivgDwgy 43 
                 +l+ +v  a+d+ k++  y  +   yDyiv D++ 
  ACV55525.1 709 HLLDDVSAAYDAYKFHYVYRAV---YDYIVNDLSA 740
                 5788999999999999999876...*******985 PP

>> PF00994  Probable molybdopterin binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.14   4.3e+02       7      52 ..     840     885 ..     834     895 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.14
                 HHHHCTCEEB-HHHHHHHHHHHTEEEEEEEEEE-SSHHHHHHHHHH CS
     PF00994   7 dellsgkieDtngpllaellkelgvevskyevvpDdpeeikealaa 52 
                  e++++  eD+ g+ ++++ +e+ v v + + v D  e+  +a+ +
  ACV55525.1 840 REVVTKALEDARGQKVVNKSQEAAVVVTAPRAVLDAVERYDAAVFE 885
                 68999999*******************************9999943 PP

>> PF03004  Plant transposase (Ptta/En/Spm family)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.047   1.4e+02     111     135 ..      29      56 ..       1      59 [. 0.69

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.047
     PF03004 111 r...edkneiflqvvgkdkkgrvyglGs 135
                 r    ++++i++qv +k+k g+++ l+ 
  ACV55525.1  29 RlakWEEEHIYEQVLEKNKDGKPFILHD 56 
                 245567899**************99875 PP

>> PF09814  Uncharacterized conserved protein (DUF2351)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.08   2.4e+02     105     127 ..     483     505 ..     455     505 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.08
     PF09814 105 tlkCrkCgnvllksrslkrvkdL 127
                  +kC+kCg+ + +++ ++ v dL
  ACV55525.1 483 VFKCAKCGSTVANEQTFDAVIDL 505
                 69***************999887 PP

>> PF03800  Nuf2 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.19   5.7e+02      16      55 ..     733     777 ..     724     792 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.19
     PF03800  16 eivecLqeldlaateedlsk.....Ptsqvvqelyeqllellmgi 55 
                  iv+ L+   + at++ l       P    vq++++++le+l+ +
  ACV55525.1 733 YIVNDLSAVYMDATKDRLYSeapdsPRRRAVQTVLMNILEVLVRV 777
                 5888888888888888888778888***************99865 PP

>> PF07610  Protein of unknown function (DUF1573)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.1     0.058   1.8e+02      20      32 ..     531     543 ..     530     547 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.058
     PF07610  20 sCGCttpelskkp 32 
                 +CGCt  +++k+ 
  ACV55525.1 531 TCGCTELTPEKDI 543
                 8*******99986 PP

>> PF06712  Protein of unknown function (DUF1199)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.2      0.14   4.2e+02      38      50 ..     666     678 ..     661     679 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.14
     PF06712  38 srRiRnNFLGLLG 50 
                  rRiRn F  LLG
  ACV55525.1 666 YRRIRNTFRFLLG 678
                 59******99999 PP

>> PF06061  Baculoviridae ME53
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0      0.68   2.1e+03     276     288 ..     482     494 ..     470     509 .. 0.76

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.68
     PF06061 276 pvlyCskCGftdr 288
                 pv  C+kCG t +
  ACV55525.1 482 PVFKCAKCGSTVA 494
                 9999*****8843 PP

>> PF02126  Phosphotriesterase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0       0.2   6.2e+02     163     205 ..     618     660 ..     615     668 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.2
                 CCCGT---HHHHHHHH----GGGEEE-EGGCS--HHHHHHHHH CS
     PF02126 163 aaslraglqqlrilqeeGvdlsrvvigHlddkddlkellelia 205
                 ++sl++g++ + ++++ G+d+ r  ++ +d ++d++   e+ +
  ACV55525.1 618 SKSLGNGVDPAEVMAKSGADVLRLWVASVDYSQDVSISDEILQ 660
                 578999****************************987776666 PP

>> PF00749  tRNA synthetases class I (E and Q), catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.1      0.29   8.7e+02       7      20 ..      58      71 ..      56      87 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.29
                --------B---HH CS
     PF00749  7 aPsPtGyLHiGhak 20
                +P ++G  HiGha 
  ACV55525.1 58 PPYANGPIHIGHAF 71
                899*********94 PP

>> PF09943  Uncharacterized protein conserved in archaea (DUF2175)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1      0.76   2.3e+03       3      18 ..     484     499 ..     483     511 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.76
     PF09943   3 wkCvvCgkeiiegelF 18 
                 +kC+ Cg ++ +++ F
  ACV55525.1 484 FKCAKCGSTVANEQTF 499
                 89************99 PP

>> PF01741  Large-conductance mechanosensitive channel, MscL
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0       0.5   1.5e+03      22      37 ..      66      81 ..      63      84 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.5
     PF01741 22 viGaafgkivsslved 37
                 iG af+ki++ +v++
  ACV55525.1 66 HIGHAFNKILKDFVNK 81
                59************86 PP

>> PF05460  Origin recognition complex subunit 6 (ORC6)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.1      0.47   1.4e+03     311     352 ..     426     469 ..     423     473 .. 0.76

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 0.47
     PF05460 311 eWfrniekkydyedgaeeeessrkerkak..eglGsMlqdrvdy 352
                 +Wf  + k++  e++ +  e +   + a+   ++GsM +dr d+
  ACV55525.1 426 QWFVSMDKNSLRENALKAIENDVEWIPAWasNRIGSMVADRPDW 469
                 6888888888877777766666665555599**********999 PP

>> PF00580  UvrD/REP helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0      0.47   1.4e+03     216     247 ..     646     677 ..     571     687 .. 0.86

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 0.47
                 EECCHHHHHHHHHHHHSHHHHHHHHHHSSEEE CS
     PF00580 216 lDfddLlhyllelleensellealrerfkeiL 247
                 +D+++ ++   e+l++ se+ +++r+ f+++L
  ACV55525.1 646 VDYSQDVSISDEILQRTSEAYRRIRNTFRFLL 677
                 89999999999******************998 PP

>> PF02757  YLP motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.4       1.1   3.3e+03       2       6 ..     520     524 ..     519     524 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 1.1
     PF02757   2 nEYLP 6  
                 +EYLP
  ACV55525.1 520 SEYLP 524
                 7***9 PP

>> PF04728  Repeated sequence found in lipoprotein LPP
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.4      0.98     3e+03       2       6 ..     117     121 ..     117     121 .. 0.97

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.98
     PF04728   2 AKvDQ 6  
                 AK+DQ
  ACV55525.1 117 AKIDQ 121
                 9**** PP

>> PF12390  Selenocysteine synthase N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.1       0.8   2.4e+03      28      40 .]     839     851 ..     838     851 .. 0.96

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.8
     PF12390  28 vrdavrafLdrcR 40 
                 vr++v  +L+++R
  ACV55525.1 839 VREVVTKALEDAR 851
                 8***********9 PP

>> PF09849  Uncharacterized protein conserved in bacteria (DUF2076)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.0       1.8   5.5e+03      36      49 ..     252     265 ..     249     266 .. 0.84

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 1.8
     PF09849  36 lrrqPdAvYyLvQt 49 
                 +  +PdA Y +vQ+
  ACV55525.1 252 VSLAPDADYVMVQA 265
                 6679*********7 PP

>> PF11575  FhuF 2Fe-2S C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.6      0.17   5.2e+02      10      20 ..     523     533 ..     523     533 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.17
     PF11575  10 lpggeyCgtCP 20 
                 lp g +C+tC+
  ACV55525.1 523 LPRGVKCETCG 533
                 7999******5 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (948 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       352  (0.02955); expected 238.2 (0.02)
Passed bias filter:                      282  (0.0236736); expected 238.2 (0.02)
Passed Vit filter:                        37  (0.00310611); expected 11.9 (0.001)
Passed Fwd filter:                        37  (0.00310611); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              33  [number of targets reported over threshold]
# CPU time: 0.56u 0.04s 00:00:00.60 Elapsed: 00:00:01
# Mc/sec: 3654.71
//