# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12744.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV56092.1  [L=166]
Description: elen0 ACV56092.1 GIB01015CH01 "ribosomal protein L11"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    9.6e-30  104.4   0.6      2e-29  103.4   0.4    1.6  1  PF03946  Ribosomal protein L11, N-terminal domain
    2.5e-26   94.2   0.2    4.3e-26   93.4   0.2    1.4  1  PF00298  Ribosomal protein L11, RNA binding domain
  ------ inclusion threshold ------
        2.4    9.7   0.0        2.7    9.5   0.0    1.1  1  PF09692  Argonaute siRNA chaperone (ARC) complex subunit Arb
        2.7   10.3   0.0         26    7.1   0.0    2.4  1  PF03460  Nitrite/Sulfite reductase ferredoxin-like half doma
        4.6    9.7   0.1         15    8.0   0.0    1.9  1  PF10369  Small subunit of acetolactate synthase
         20    7.4   0.0         41    6.4   0.0    1.5  1  PF07873  YabP family
         24    7.6   0.0         58    6.4   0.0    1.6  1  PF01466  Skp1 family, dimerisation domain
         26    7.1   0.0         60    5.9   0.0    1.7  1  PF03625  Domain of unknown function DUF302
         30    6.7   0.3    1.4e+02    4.5   0.0    1.9  1  PF12508  Protein of unknown function (DUF3714)
         33    6.1   0.0         41    5.8   0.0    1.1  1  PF01808  AICARFT/IMPCHase bienzyme
         34    7.5   0.0      2e+02    5.0   0.0    2.0  1  PF08288  PIGA (GPI anchor biosynthesis)
         35    6.8   0.6    1.2e+02    5.0   0.3    1.9  1  PF11148  Protein of unknown function (DUF2922)
         64    6.2   0.2    1.3e+02    5.2   0.2    1.4  1  PF07440  Caerin 1 protein
         76    5.8   0.0    1.1e+02    5.3   0.0    1.2  1  PF09644  Mg296 protein
         79    5.8   0.0    1.1e+02    5.3   0.0    1.2  1  PF11764  COMPASS (Complex proteins associated with Set1p) co
         94    5.7   0.0    5.2e+02    3.4   0.0    1.9  2  PF11513  Thermoplasma acidophilum protein TA0956
         98    5.0   0.5    1.9e+02    4.1   0.4    1.4  1  PF08515  Transforming growth factor beta type I GS-motif
      1e+02    5.6   2.1    1.5e+02    5.1   0.2    2.1  1  PF08262  Leucophaea maderae tachykinin-related peptide
    1.1e+02    5.0   0.0    1.6e+02    4.4   0.0    1.2  1  PF10726  Protein of function (DUF2518)
    1.7e+02    5.1   0.0    3.2e+02    4.2   0.0    1.4  1  PF03714  Bacterial pullanase-associated domain
    1.8e+02    4.2   0.0    2.9e+02    3.5   0.0    1.3  1  PF08412  Ion transport protein N-terminal
      2e+02    4.1   0.1    4.2e+02    3.1   0.1    1.4  1  PF02197  Regulatory subunit of type II PKA R-subunit
    2.1e+02    2.6   0.0      3e+02    2.1   0.0    1.1  1  PF04738  Lantibiotic dehydratase, C terminus
    2.4e+02    4.3   0.1    4.6e+02    3.4   0.1    1.5  1  PF10431  C-terminal, D2-small domain, of ClpB protein
    2.5e+02    4.6   0.2    4.7e+02    3.8   0.1    1.4  1  PF12360  Paired box protein 7
    3.2e+02    3.5   0.0    6.2e+02    2.5   0.0    1.5  1  PF03047  COMC family
    3.5e+02    3.9   0.0    6.6e+02    3.0   0.0    1.4  1  PF09943  Uncharacterized protein conserved in archaea (DUF21
    8.3e+02    1.9   1.2    2.1e+03    0.6   0.8    1.6  1  PF08046  IlvGEDA operon leader peptide


Domain and alignment annotation for each model:
>> PF03946  Ribosomal protein L11, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.4   0.4   5.7e-33     2e-29       1      60 []       9      67 ..       9      67 .. 0.97

  Alignments for each domain:
  == domain 1    score: 103.4 bits;  conditional E-value: 5.7e-33
                -EEEEE------STTT-----------SHHHHHHHHHHTTT.-----EEEEEEE-STT-E CS
     PF03946  1 viklqveaGkAnpaPplGpaLGplGvnimefckefnaaTkdykkGlpvpVkItvyndksf 60
                +iklq++aG AnpaPp+GpaLG +Gvnim+fc++fna+T+d + G+++pV+Itvy+dksf
  ACV56092.1  9 FIKLQIPAGAANPAPPVGPALGAQGVNIMQFCQAFNAQTQD-QSGTIIPVEITVYEDKSF 67
                69***************************************.66***************8 PP

>> PF00298  Ribosomal protein L11, RNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.4   0.2   1.2e-29   4.3e-26       1      69 []      72     140 ..      72     140 .. 0.99

  Alignments for each domain:
  == domain 1    score: 93.4 bits;  conditional E-value: 1.2e-29
                 ---THHHHTTTT-----------------EETTHHHHHHHHHTTTSSS-SHHHHHHTT---TTT----E CS
     PF00298   1 ktPpasvlLkkaagiekGsgkpgkekvGkitlkqvyeIAkiKksdlnaldleaavksiiGtArsmGikV 69 
                 ktPpa+vl+k+ ++i++Gsg p+ + vG++t +q++eIA+iK++dlna+++eaa+ +i+GtArsmG+++
  ACV56092.1  72 KTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI 140
                 8*****************************************************************986 PP

>> PF09692  Argonaute siRNA chaperone (ARC) complex subunit Arb1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.5   0.0   0.00076       2.7     267     350 ..      57     141 ..      30     158 .. 0.70

  Alignments for each domain:
  == domain 1    score: 9.5 bits;  conditional E-value: 0.00076
     PF09692 267 ikavevededgfevvditlpseevkaeykevkevlkagdlkpvGkllaktlid.pglpeeDlpene.klakeseeeadeeleffle 350
                 ++ +  ed ++f+ v  t+p ++  +e  ++++  ++++++pvG+l+  +l++  +++  Dl +n+ ++a+e  ++ ++++ + +e
  ACV56092.1  57 VEITVYED-KSFTFVCKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREiAEIKMPDLNANTiEAAMEIIAGTARSMGVRIE 141
                 34444455.89999999999999999999999**************9988876245666788888866666666666666666665 PP

>> PF03460  Nitrite/Sulfite reductase ferredoxin-like half domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0    0.0072        26      17      32 ..      97     112 ..      93     113 .. 0.92

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0072
     PF03460  17 pnGritaeqlraladi 32 
                 p G +t +qlr++a+i
  ACV56092.1  97 PVGTLTEDQLREIAEI 112
                 68************98 PP

>> PF10369  Small subunit of acetolactate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.0    0.0041        15      15      51 ..      32      68 ..      27      79 .. 0.86

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0041
     PF10369 15 traeilriaeifrakivdvskdslvieltGdeekida 51
                +  +i++++++f+a+  d s + + +e+t  e+k  +
  ACV56092.1 32 QGVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFT 68
                56789************************88888655 PP

>> PF07873  YabP family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.012        41      36      58 ..     137     161 ..     126     164 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.012
     PF07873  36 kliIkGenLkikklnlee..lvieG 58 
                  ++I+G+++kik+   ++   +++G
  ACV56092.1 137 GVRIEGREMKIKYVPSKKvaAMLQG 161
                 589**********998886666666 PP

>> PF01466  Skp1 family, dimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.016        58      36      49 ..     152     165 ..     146     166 .] 0.89

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.016
     PF01466  36 ckkvAdmikgktpe 49 
                 +kkvA m++gkt+e
  ACV56092.1 152 SKKVAAMLQGKTLE 165
                 89**********98 PP

>> PF03625  Domain of unknown function DUF302
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.017        60      38      55 ..      49      65 ..      44      82 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.017
                TT-----SEEEEEEE.-- CS
     PF03625 38 pdiglllPcrvlvyeded 55
                 + g+ +P+ ++vyed +
  ACV56092.1 49 DQSGTIIPVEITVYED-K 65
                567999*********5.4 PP

>> PF12508  Protein of unknown function (DUF3714)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.038   1.4e+02     112     124 ..      51      63 ..      46      67 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.038
     PF12508 112 ggeiipveLsvYD 124
                  g+iipve++vY+
  ACV56092.1  51 SGTIIPVEITVYE 63 
                 699*********7 PP

>> PF01808  AICARFT/IMPCHase bienzyme
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.012        41      90     155 ..      41     106 ..      32     134 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.012
                 -.EEEE-SSSS...-SEEEEE--.---HHHHHHHHHHHHHHHHHH---EEEEETTEE---B--H.H CS
     PF01808  90 aafyvekelkeasiataeqlqGkelsynnllDadaalelvkefeeepaaaivKHvnPcGvavgksi 155
                  af ++++ + ++i+++e    ++ s+  ++ +  a  l+ke  +  +   + Hv+P G  + +++
  ACV56092.1  41 QAFNAQTQDQSGTIIPVEITVYEDKSFTFVCKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQL 106
                 3577888888889******9999*********************9**************8877544 PP

>> PF08288  PIGA (GPI anchor biosynthesis)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.057     2e+02       6      27 ..     135     156 ..     131     164 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.057
     PF08288   6 rsGvryltnglkvYyvPllvly 27 
                  +Gvr+ ++ +k+ yvP + ++
  ACV56092.1 135 SMGVRIEGREMKIKYVPSKKVA 156
                 57***************98775 PP

>> PF11148  Protein of unknown function (DUF2922)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.3     0.035   1.2e+02      24      40 ..     115     131 ..     108     133 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.035
     PF11148  24 edlteaevkaaMdtiia 40 
                  dl++++++aaM+ i+ 
  ACV56092.1 115 PDLNANTIEAAMEIIAG 131
                 59***********9985 PP

>> PF07440  Caerin 1 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.2     0.036   1.3e+02      14      20 ..      92      98 ..      91      99 .. 0.95

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.036
     PF07440 14 LPHVvPV 20
                LPHV PV
  ACV56092.1 92 LPHVQPV 98
                9*****9 PP

>> PF09644  Mg296 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.032   1.1e+02      16      53 ..      32      69 ..      30      87 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.032
                HTS-HHHHHHHHHHHHHHHHT-SSGGGSS---S-HHHH CS
     PF09644 16 eevdleklrnnfnlilereqdtliiyedddyddqdffl 53
                + v++ ++ + fn   + +  t+i  e   y+d++f +
  ACV56092.1 32 QGVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTF 69
                569999****************************9954 PP

>> PF11764  COMPASS (Complex proteins associated with Set1p) component N
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.031   1.1e+02      75     108 ..     123     155 ..      99     165 .. 0.76

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.031
     PF11764  75 gsllenatGcarseGykkIpdkeKskYLphrkkv 108
                 ++ +e   G ars G++   ++ K+kY p +k v
  ACV56092.1 123 EAAMEIIAGTARSMGVRIEGREMKIKYVPSKK-V 155
                 556677789********999*********984.4 PP

>> PF11513  Thermoplasma acidophilum protein TA0956
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.15   5.2e+02       1      28 [.      37      64 ..      37      82 .. 0.88
   2 ?    0.0   0.0       1.6   5.7e+03      37      60 ..     117     140 ..      90     157 .. 0.57

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.15
                --EEEEEEEE------EEEEEEHHHHHH CS
     PF11513  1 mvlcamynislkeshptticvvldkfld 28
                m++c  +n + +++  t i v +  ++d
  ACV56092.1 37 MQFCQAFNAQTQDQSGTIIPVEITVYED 64
                89*****************999988887 PP

  == domain 2    score: 0.0 bits;  conditional E-value: 1.6
                 TTS--CCHHHHHHHHH---S---T CS
     PF11513  37 veeqdideledfisryartdeimp 60 
                 ++ + i+  +++i   ar+  ++ 
  ACV56092.1 117 LNANTIEAAMEIIAGTARSMGVRI 140
                 333444445555555555444444 PP

>> PF08515  Transforming growth factor beta type I GS-motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.4     0.052   1.9e+02      15      20 ..      88      93 ..      88      94 .. 0.94

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.052
     PF08515 15 SGSGlP 20
                SGSGlP
  ACV56092.1 88 SGSGLP 93
                9****9 PP

>> PF08262  Leucophaea maderae tachykinin-related peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.2     0.041   1.5e+02       1       9 [.      26      34 ..      26      34 .. 0.94

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.041
     PF08262  1 APSMGFhGv 9 
                +P++G +Gv
  ACV56092.1 26 GPALGAQGV 34
                7*******8 PP

>> PF10726  Protein of function (DUF2518)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.046   1.6e+02      89     122 ..     115     148 ..     104     159 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.046
     PF10726  89 aditeealeatleQlasnlrsggrssadekvtir 122
                 +d++++++ea++e +a+  rs+g   + ++++i+
  ACV56092.1 115 PDLNANTIEAAMEIIAGTARSMGVRIEGREMKIK 148
                 799********************99998999987 PP

>> PF03714  Bacterial pullanase-associated domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.088   3.2e+02      34      66 ..      40      72 ..      30      84 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.088
     PF03714 34 akpltftgkddygayadvklkeeeakkvgfivr 66
                 ++++++ +d+ g ++ v+++ +e k++ f+ +
  ACV56092.1 40 CQAFNAQTQDQSGTIIPVEITVYEDKSFTFVCK 72
                56899999******************9999976 PP

>> PF08412  Ion transport protein N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.081   2.9e+02      63      75 ..      54      66 ..      51      68 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.081
     PF08412 63 ilPvgitFfkdet 75
                i+Pv+it ++d++
  ACV56092.1 54 IIPVEITVYEDKS 66
                8********9986 PP

>> PF02197  Regulatory subunit of type II PKA R-subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.12   4.2e+02      21      29 ..      35      43 ..      31      43 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.12
                -HHHHHHHH CS
     PF02197 21 DllqFaadY 29
                +++qF+ ++
  ACV56092.1 35 NIMQFCQAF 43
                89****987 PP

>> PF04738  Lantibiotic dehydratase, C terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0     0.083     3e+02     111     161 ..      99     149 ..      89     152 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.083
     PF04738 111 spLyvDlrldaeevtlgenlaeeiaralelllrlspnpagrqelrdyhekF 161
                 + L +D + + +e++ +   a+ i++a+e++  +++ ++ r e r+++ k+
  ACV56092.1  99 GTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRIEGREMKIKY 149
                 5688999999999*************************9999999999887 PP

>> PF10431  C-terminal, D2-small domain, of ClpB protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.13   4.6e+02       1      21 [.     101     121 ..     101     133 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.13
                 --HHHHHHHHHHHHHHHHHHH CS
     PF10431   1 LskeelkkIvdkalkklekrl 21 
                 L++++l++I+++++ +l+++ 
  ACV56092.1 101 LTEDQLREIAEIKMPDLNANT 121
                 89**********999998765 PP

>> PF12360  Paired box protein 7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1      0.13   4.7e+02      28      45 .]      15      32 ..       8      32 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.13
     PF12360 28 asgpaNhmnPvsNgLSpq 45
                ++g+aN+  Pv+  L  q
  ACV56092.1 15 PAGAANPAPPVGPALGAQ 32
                89*****77799888666 PP

>> PF03047  COMC family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.17   6.2e+02      13      22 ..     100     109 ..      99     110 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.17
     PF03047  13 eLtekeLqeI 22 
                 +Lte +L eI
  ACV56092.1 100 TLTEDQLREI 109
                 8******999 PP

>> PF09943  Uncharacterized protein conserved in archaea (DUF2175)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.19   6.6e+02      11      24 ..      60      73 ..      57      83 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.19
     PF09943 11 eiiegelFTFiskg 24
                +++e++ FTF+ k 
  ACV56092.1 60 TVYEDKSFTFVCKT 73
                699*******9875 PP

>> PF08046  IlvGEDA operon leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.8      0.58   2.1e+03      21      28 ..      23      30 ..      22      32 .. 0.92

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.58
     PF08046 21 PPCGAALG 28
                PP G ALG
  ACV56092.1 23 PPVGPALG 30
                9******9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (166 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       370  (0.0310611); expected 238.2 (0.02)
Passed bias filter:                      341  (0.0286266); expected 238.2 (0.02)
Passed Vit filter:                        28  (0.00235057); expected 11.9 (0.001)
Passed Fwd filter:                        28  (0.00235057); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              28  [number of targets reported over threshold]
# CPU time: 0.17u 0.03s 00:00:00.20 Elapsed: 00:00:01
# Mc/sec: 2108.10
//