# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12745.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV56230.1  [L=264]
Description: elen0 ACV56230.1 GIB01015CH01 "FeS assembly ATPase SufC"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.4e-07   33.8   0.0    3.5e-07   33.2   0.0    1.3  1  PF00005  ABC transporter
    1.3e-05   27.2   0.2     0.0014   20.6   0.1    2.2  1  PF02463  RecF/RecN/SMC N terminal domain
  ------ inclusion threshold ------
      0.085   14.7   0.0       0.16   13.8   0.0    1.4  1  PF03193  Protein of unknown function, DUF258
       0.45   12.6   0.0       0.83   11.8   0.0    1.4  1  PF01580  FtsK/SpoIIIE family
        2.7   10.0   0.0        4.3    9.3   0.0    1.2  1  PF00488  MutS domain V
        6.1    9.7   0.0         12    8.8   0.0    1.5  1  PF00004  ATPase family associated with various cellular acti
        9.3    8.0   0.0         15    7.2   0.0    1.3  1  PF06414  Zeta toxin
        9.4    8.3   0.0         18    7.4   0.0    1.4  1  PF01695  IstB-like ATP binding protein
         16    8.3   0.0         27    7.6   0.0    1.3  1  PF00910  RNA helicase
         17    7.6   0.0         27    7.0   0.0    1.3  1  PF05729  NACHT domain
         18    7.1   0.0         27    6.5   0.0    1.3  1  PF02457  DisA bacterial checkpoint controller nucleotide-bin
         19    6.1   0.9         31    5.4   0.6    1.3  1  PF10712  NAD-specific glutamate dehydrogenase
         25    7.3   0.1    3.6e+02    3.5   0.0    2.2  2  PF03205  Molybdopterin guanine dinucleotide synthesis protei
         25    7.7   0.0         58    6.5   0.0    1.6  1  PF08110  Ocellatin family
         25    6.9   0.0         44    6.1   0.0    1.4  1  PF00625  Guanylate kinase
         26    5.2   0.0         50    4.3   0.0    1.4  1  PF05879  Root hair defective 3 GTP-binding protein (RHD3)
         39    5.9   0.0         61    5.2   0.0    1.2  1  PF05496  Holliday junction DNA helicase ruvB N-terminus
         39    6.2   0.0         78    5.3   0.0    1.4  1  PF00009  Elongation factor Tu GTP binding domain
         43    6.2   0.0         67    5.5   0.0    1.2  1  PF00006  ATP synthase alpha/beta family, nucleotide-binding 
         45    5.7   0.0         69    5.1   0.0    1.3  1  PF04548  AIG1 family
         45    6.3   0.0         79    5.5   0.0    1.3  1  PF01637  Archaeal ATPase
         46    6.0   0.0         88    5.1   0.0    1.5  1  PF02492  CobW/HypB/UreG, nucleotide-binding domain
         54    5.5   0.0         95    4.7   0.0    1.3  1  PF04670  Gtr1/RagA G protein conserved region
         62    5.9   0.4    1.9e+02    4.3   0.0    2.0  1  PF03266  Protein of unknown function, DUF265
         63    5.2   0.0    1.1e+02    4.4   0.0    1.3  1  PF01992  ATP synthase (C/AC39) subunit
         70    6.3   0.0    1.6e+02    5.2   0.0    1.5  1  PF11159  Protein of unknown function (DUF2939)
         81    4.9   0.1    1.3e+02    4.3   0.0    1.3  1  PF02581  Thiamine monophosphate synthase/TENI
         92    5.1   0.1    1.3e+02    4.6   0.0    1.2  1  PF03053  ORF3b coronavirus protein
      1e+02    5.1   0.0    1.8e+02    4.2   0.0    1.4  1  PF01350  Flavivirus non-structural protein NS4A
      1e+02    5.4   0.2    3.9e+02    3.5   0.0    1.9  1  PF01202  Shikimate kinase
    1.1e+02    5.9   0.0    2.8e+02    4.6   0.0    1.6  1  PF08477  Miro-like protein
    1.4e+02    4.6   0.1    2.2e+02    3.9   0.0    1.3  1  PF03029  Conserved hypothetical ATP binding protein
    1.5e+02    5.0   0.0    3.2e+02    3.9   0.0    1.5  1  PF00165  Bacterial regulatory helix-turn-helix proteins, Ara
      2e+02    4.8   0.0    4.4e+02    3.7   0.0    1.5  1  PF03704  Bacterial transcriptional activator domain
    2.2e+02    4.4   0.0    4.5e+02    3.4   0.0    1.4  1  PF08104  Ponericin L family
    2.4e+02    4.5   0.6    4.7e+02    3.6   0.4    1.4  1  PF00280  Potato inhibitor I family
    2.9e+02    2.5   0.0    4.4e+02    1.9   0.0    1.2  1  PF02456  Adenovirus IVa2 protein
      3e+02    3.6   0.1    6.8e+02    2.5   0.1    1.5  1  PF06543  Lactococcus bacteriophage repressor
      3e+02    2.8   0.0    7.8e+02    1.5   0.0    1.5  1  PF10236  Mitochondrial ribosomal death-associated protein 3
    3.4e+02    3.2   0.0    8.5e+02    2.0   0.0    1.6  1  PF02776  Thiamine pyrophosphate enzyme, N-terminal TPP bindi
    3.7e+02    2.3   0.0    5.4e+02    1.8   0.0    1.1  1  PF03215  Rad17 cell cycle checkpoint protein
    4.5e+02    1.7   0.0    6.6e+02    1.2   0.0    1.1  1  PF10443  RNA12 protein
    4.8e+02    3.4   0.9      1e+03    2.4   0.2    1.8  1  PF11613  Agonist of corticotropin releasing factor R2, Uroco
    4.9e+02    2.6   0.0      9e+02    1.8   0.0    1.4  1  PF02223  Thymidylate kinase
    5.1e+02    3.2   0.1    1.6e+03    1.6   0.1    1.8  1  PF01225  Mur ligase family, catalytic domain
    6.3e+02    1.5   0.0    9.9e+02    0.9   0.0    1.2  1  PF03237  Terminase-like family
    7.4e+02    2.5   0.2    1.5e+03    1.5   0.1    1.5  1  PF05688  Salmonella repeat of unknown function (DUF824)
      1e+03    1.5   0.0    1.6e+03    0.9   0.0    1.2  1  PF11359  Glycoprotein UL132
    1.8e+03    1.1   0.5    3.8e+03    0.0   0.3    1.4  1  PF05382  Bacteriophage peptidoglycan hydrolase
    3.1e+03    0.3   2.1    6.5e+03   -0.7   1.5    1.4  1  PF08047  Histidine operon leader peptide


Domain and alignment annotation for each model:
>> PF00005  ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.2   0.0   1.8e-10   3.5e-07      11     116 ..      61     176 ..      49     178 .. 0.81

  Alignments for each domain:
  == domain 1    score: 33.2 bits;  conditional E-value: 1.8e-10
                 S------EEE-...--BGGGB-HHHHHEEEE-------....--BHHHHHH----S--.....-HHHHHHHHHH---HH.HH------------HHHHH CS
                 xxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxx RF
     PF00005  11 lkptegeievd.ndrkdlesdkleklrigyipqdpllf...peltvrenldmakeekk.....tdkrieevlekvglde.lldksrvstLSgGqkqrva 99 
                 ++ + g++e+d +d++dl++dk+++  +   +q p +    p  +  +   ++++ k+      +k ++ +++++ +d   ld++ + ++SgG+k++++
  ACV56230.1  61 YRMDGGSVEFDgRDITDLSPDKRSRAGLFLSFQAPVEIpgvPLSSFLRATVAGRDGKElkgkqFKKHVRTLADELDMDPsYLDRELGVGFSGGEKKKLE 159
                 336699*****66***********999**********9444444444444444444448888899**************9******************* PP

                 HHHHHTT--SEEEEEST CS
                 xxxxxxxxxxxxxxxxx RF
     PF00005 100 lArallkkpklllLDEP 116
                   ++ll +pkl +LDE 
  ACV56230.1 160 MLQLLLLEPKLAILDET 176
                 ****************5 PP

>> PF02463  RecF/RecN/SMC N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   20.6   0.1   6.8e-07    0.0014      26     207 ..      37     218 ..      26     231 .. 0.73

  Alignments for each domain:
  == domain 1    score: 20.6 bits;  conditional E-value: 6.8e-07
                 EEEE--------HHHHHHHHHH------.-------T...TSS----------EEEEEEEEE----E.......EEEEEEEE----EEEEE---EE-HH CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463  26 ftaivGpNGSGKsnvldAilFvLGeksakklrsekls...dlihkskskakvksaeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkk 121
                   +i+GpNG+GKs +   +   +G++++  +   +++   + i+   s +k ++a + + f+   +   +    +s   r+   g+   +++gk+ +k 
  ACV56230.1  37 THVIMGPNGAGKSTLGHVV---MGDAAY-RMDGGSVEfdgRDITD-LSPDKRSRAGLFLSFQAPVEIPGVP---LSSFLRATVAGRDGKELKGKQFKK- 126
                 5689**********99876...998776.6665555422233444.5667778888888888877764444...444444555555555899998865. PP

                 HHHHHHHCTT--TT........G-----H.HHHHHHHHHHHHTSS--SEEEESSTTTT--HHHHHHHHHHHHHH-BT..BEEEEE-S-HHHHTT-SE CS
                 xxxxxxxxxxxxxx........xxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxx RF
     PF02463 122 evaellesagiske........lLSgGek.tLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn..aQfivislreemlekadk 207
                  v+ l  + +++++         +SgGek +L +l Ll+     +p  l +lDe d+ LD      v++ +++ ++     ++vi++++++le++d 
  ACV56230.1 127 HVRTLADELDMDPSyldrelgvGFSGGEKkKLEMLQLLL----LEP-KLAILDETDSGLDVDALGVVSRGIDAYRRAtgGALVVITHNTRILEHVDV 218
                 577888888888877778888889***973699999995....444.489*********************96555423789*********999854 PP

>> PF03193  Protein of unknown function, DUF258
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.8   0.0   7.8e-05      0.16      21      62 ..      20      62 ..       6      80 .. 0.77

  Alignments for each domain:
  == domain 1    score: 13.8 bits;  conditional E-value: 7.8e-05
                HHHTT-HHHHHHCTT.SBEEEE-------HHHHHHH------- CS
     PF03193 21 ktkegleelaellkd.ktsvlvGqSGvGKSsLinallpeldlk 62
                +++  l+++   +   +t v++G+ G+GKS+L  ++++++  +
  ACV56230.1 20 DETPILHDIDLAVGPgETHVIMGPNGAGKSTLGHVVMGDAAYR 62
                555556666666665599**************99888876655 PP

>> PF01580  FtsK/SpoIIIE family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.0   0.00041      0.83      33      73 ..      28      70 ..       6      77 .. 0.83

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00041
                EEGGGS-..SEEEE-----------HHHHHHHHTT--TTTEEE CS
     PF01580 33 adlvkap..hlLiaGatgsGKStflrtLilslaathtPeevql 73
                +dl+  p    +i+G +g+GKSt  ++ + ++a++ +   v +
  ACV56230.1 28 IDLAVGPgeTHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF 70
                4566666776789*********************988777766 PP

>> PF00488  MutS domain V
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0    0.0021       4.3      27      58 ..      20      51 ..      12      56 .. 0.85

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.0021
                TS----EEEEECTTSS.EEEEE--TT---HHH CS
     PF00488 27 eeefvaNdveleeeksrlllitGpNmgGKSty 58
                +e+ +  d++l     + ++i GpN +GKSt+
  ACV56230.1 20 DETPILHDIDLAVGPGETHVIMGPNGAGKSTL 51
                56778889999999999*************96 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.0     0.006        12       3      25 ..      40      62 ..      38      95 .. 0.75

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.006
                EE-------HHHHHHHHHHTTCE CS
     PF00004  3 lyGppGtGKTllakavakelgve 25
                ++Gp G GK++l + v+ ++ ++
  ACV56230.1 40 IMGPNGAGKSTLGHVVMGDAAYR 62
                78***************997543 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0077        15      20      53 ..      39      75 ..      36      86 .. 0.82

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0077
     PF06414 20 llgGqpGAGKtslaellleela...agnivridaDel 53
                ++ G+ GAGK++l + + +++a   +g+ v++d+ ++
  ACV56230.1 39 VIMGPNGAGKSTLGHVVMGDAAyrmDGGSVEFDGRDI 75
                6779************999999888899998887666 PP

>> PF01695  IstB-like ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0    0.0089        18      48      80 ..      36      70 ..      25      77 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0089
     PF01695 48 enlvllGpsGvGKthlA.ialgveavr.aglsvlf 80
                e  v++Gp G+GK+ l  + +g +a r +g sv f
  ACV56230.1 36 ETHVIMGPNGAGKSTLGhVVMGDAAYRmDGGSVEF 70
                6779**********997346788887766766665 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0     0.014        27       2      23 ..      39      60 ..      38      76 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.014
     PF00910  2 wlyGpsgeGKStlakeLakall 23
                ++ Gp+g GKStl + ++ + +
  ACV56230.1 39 VIMGPNGAGKSTLGHVVMGDAA 60
                689**********998776665 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0     0.013        27       2      25 ..      37      60 ..      36      70 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.013
     PF05729  2 tvilqGeaGsGKTtLlqklasawa 25
                t ++ G++G GK+tL + ++ ++a
  ACV56230.1 37 THVIMGPNGAGKSTLGHVVMGDAA 60
                6689***********887776665 PP

>> PF02457  DisA bacterial checkpoint controller nucleotide-binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.014        27       2      30 ..     189     217 ..     188     245 .. 0.75

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.014
                 HHHHHHHHHHT---EEEE--SS--TTT-B CS
     PF02457   2 eeaveglskkkiGaliviedeeeleelse 30 
                 +++++   ++  Gal+vi +++++ e+++
  ACV56230.1 189 SRGIDAYRRATGGALVVITHNTRILEHVD 217
                 578889999999************99987 PP

>> PF10712  NAD-specific glutamate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.6     0.015        31     116     153 ..     191     228 ..     175     232 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.015
     PF10712 116 rrdalqvElaeqlvvlrhlalaLehldrhgrLvVlvgg 153
                 + da  +  +  lvv  h +  Leh+d +++ v ++g+
  ACV56230.1 191 GIDAYRRATGGALVVITHNTRILEHVDVDRVHVMVRGR 228
                 567777778889*******************9999998 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.18   3.6e+02       4      18 ..      39      53 ..      37      62 .. 0.84
   2 ?    1.4   0.0      0.85   1.7e+03      46      72 ..     189     213 ..     164     257 .. 0.74

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.18
                EEE-E-----HHHHH CS
     PF03205  4 lvvGpkdsGKTTlie 18
                ++ Gp + GK+Tl  
  ACV56230.1 39 VIMGPNGAGKSTLGH 53
                589*********965 PP

  == domain 2    score: 1.4 bits;  conditional E-value: 0.85
                 ----CCHHH.H---EEEEEESSCEEEEE CS
     PF03205  46 kpGkDtwrl.kagadlvlvsieeplalv 72 
                   G D +r    ga +v++ +++   + 
  ACV56230.1 189 SRGIDAYRRaTGGALVVITHNTR---IL 213
                 56889999978888888887777...33 PP

>> PF08110  Ocellatin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.029        58       7      17 ..      45      55 ..      44      56 .. 0.94

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.029
     PF08110  7 gAAKdLlAHva 17
                gA+K  l+Hv+
  ACV56230.1 45 GAGKSTLGHVV 55
                9*********8 PP

>> PF00625  Guanylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.022        44       4      23 ..      37      56 ..      35      75 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.022
                -EEEE------HHHHHHHHH CS
     PF00625  4 pivlvGpsgvGkstlkkaLl 23
                + v++Gp+g+Gkstl + ++
  ACV56230.1 37 THVIMGPNGAGKSTLGHVVM 56
                679***********988776 PP

>> PF05879  Root hair defective 3 GTP-binding protein (RHD3)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.025        50     157     203 ..      91     137 ..      86     158 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.025
     PF05879 157 slsKPegleessledfFdvefvaLshkelkeeqFkeevkkLrerfve 203
                 s + P ++   +l+ f   ++++   kelk +qFk++v+ L + + +
  ACV56230.1  91 SFQAPVEIPGVPLSSFLRATVAGRDGKELKGKQFKKHVRTLADELDM 137
                 66778899999******************************998755 PP

>> PF05496  Holliday junction DNA helicase ruvB N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0      0.03        61      52      73 ..      38      58 ..      33      78 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.03
                --EEE-------HHHHHHHHHH CS
     PF05496 52 hvllyGpPGlGkttlakiiake 73
                h +++Gp G Gk tl +++  +
  ACV56230.1 38 H-VIMGPNGAGKSTLGHVVMGD 58
                4.468*************9765 PP

>> PF00009  Elongation factor Tu GTP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.039        78       7      52 ..      39      85 ..      36      88 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.039
                EEEESTT---HHHHHHHHHHHHHCCCHCCCC.HC...CCCSCHHHH- CS
     PF00009  7 giighvDhGKtTltdallykagaiskrgeea.eaerlldklkeerer 52
                +i+g   +GK+Tl   ++ +a+   + g+++ +++ ++d  +++r r
  ACV56230.1 39 VIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEfDGRDITDLSPDKRSR 85
                799999***********999998888888886557788888888777 PP

>> PF00006  ATP synthase alpha/beta family, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.034        67      10      32 ..      30      52 ..      25      62 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.034
                xxxxxxxxxxxxxxxxxxxxxxx RF
     PF00006 10 fPivqGqttlipGafgcGktvis 32
                + ++ G+t +i+G+ g+Gk+++ 
  ACV56230.1 30 LAVGPGETHVIMGPNGAGKSTLG 52
                57899***************986 PP

>> PF04548  AIG1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.034        69       4      28 ..      39      63 ..      36      73 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.034
                EEE-------HHHHHHH-----SS- CS
     PF04548  4 vlvGktgnGkSaTgNsilgkkaFes 28
                v++G  g+GkS+ g  ++g+ a++ 
  ACV56230.1 39 VIMGPNGAGKSTLGHVVMGDAAYRM 63
                89*****************999875 PP

>> PF01637  Archaeal ATPase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.039        79      18      36 ..      33      51 ..      29      63 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.039
                ..-SEEEEE--TT---HHH CS
     PF01637 18 epnsiiviyGprrsGKTaL 36
                +p +  vi Gp + GK++L
  ACV56230.1 33 GPGETHVIMGPNGAGKSTL 51
                567889************9 PP

>> PF02492  CobW/HypB/UreG, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.044        88       3      16 ..      38      51 ..      36      64 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.044
                EEEE-------HHH CS
     PF02492  3 tvltGflGsGKTtL 16
                 v++G+ G+GK+tL
  ACV56230.1 38 HVIMGPNGAGKSTL 51
                69***********9 PP

>> PF04670  Gtr1/RagA G protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.048        95       4      20 ..      40      56 ..      38      62 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.048
     PF04670  4 LmGksgsGKtSmrsiiF 20
                +mG++g+GK+++  ++ 
  ACV56230.1 40 IMGPNGAGKSTLGHVVM 56
                8**********998875 PP

>> PF03266  Protein of unknown function, DUF265
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.094   1.9e+02       3      21 ..      39      57 ..      37      69 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.094
                EEE-------HHHHHHHHH CS
     PF03266  3 fiTGppgvGKtTlvkkvle 21
                +i Gp g GK+Tl + v+ 
  ACV56230.1 39 VIMGPNGAGKSTLGHVVMG 57
                588**********998875 PP

>> PF01992  ATP synthase (C/AC39) subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.054   1.1e+02      85     126 ..     211     253 ..     206     262 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.054
                 HHHHHHHHHHHHHHHHHHH----GGGS--------.HHHHHHH CS
     PF01992  85 lllkkydirNiktlirgklanrsaeevlelliplG.evfekmk 126
                 ++l+  d++ +  ++rg+++ +  + ++e++ + G e+fe++ 
  ACV56230.1 211 RILEHVDVDRVHVMVRGRMVAEGDSSLIESINEQGfEQFEQAG 253
                 579999*****************************77777764 PP

>> PF11159  Protein of unknown function (DUF2939)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0      0.08   1.6e+02      31      80 ..     211     260 ..     208     263 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.08
     PF11159  31 alselvDfpalresLkaqltaelakrispeladnplaalgaalaaalidp 80 
                 ++ e+vD +++    + +++ae  + + +++++++++++ +a a+a  +p
  ACV56230.1 211 RILEHVDVDRVHVMVRGRMVAEGDSSLIESINEQGFEQFEQAGAEAAREP 260
                 5779************************************9988776555 PP

>> PF02581  Thiamine monophosphate synthase/TENI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.064   1.3e+02      55      78 ..     198     223 ..     163     236 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.064
     PF02581  55 y..gvpliindrvdlalavgadgvHl 78 
                 +  g+ ++i  ++++ + v++d vH+
  ACV56230.1 198 AtgGALVVITHNTRILEHVDVDRVHV 223
                 33589999*****************9 PP

>> PF03053  ORF3b coronavirus protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.067   1.3e+02     152     182 ..     200     231 ..     189     243 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.067
     PF03053 152 GGd.nyltlgdsivsfvstsdlylairGraea 182
                 GG    +t +++i+++v+   +++ +rGr+ a
  ACV56230.1 200 GGAlVVITHNTRILEHVDVDRVHVMVRGRMVA 231
                 55413567899*****************9643 PP

>> PF01350  Flavivirus non-structural protein NS4A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.091   1.8e+02      65      98 ..      36      69 ..      24      72 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.091
     PF01350 65 vlllllarkgigrmslgvvvllvaavllwlggvs 98
                 + +++ ++g g+ +lg vv+  aa+ +  g v+
  ACV56230.1 36 ETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVE 69
                5678999***************999998877765 PP

>> PF01202  Shikimate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0       0.2   3.9e+02       2      11 ..      45      54 ..      44      61 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.2
                T---HHHHHH CS
     PF01202  2 GaGKstvGkl 11
                GaGKst+G+ 
  ACV56230.1 45 GAGKSTLGHV 54
                9*******86 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0      0.14   2.8e+02       3      21 ..      39      57 ..      38      77 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.14
                EEE--TT---HHHHHHHH- CS
     PF08477  3 vvvGdkgvGKssllsqlvg 21
                v++G  g+GKs+l + ++g
  ACV56230.1 39 VIMGPNGAGKSTLGHVVMG 57
                799*********9777766 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.11   2.2e+02       1      14 [.      40      53 ..      40      62 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.11
     PF03029  1 vvGpaGsGKttfvg 14
                ++Gp G+GK+t+ +
  ACV56230.1 40 IMGPNGAGKSTLGH 53
                79*********966 PP

>> PF00165  Bacterial regulatory helix-turn-helix proteins, AraC family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.16   3.2e+02       7      27 ..     124     144 ..     122     146 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.16
                 ..--HHHHHHHHTS-HHHHHH CS
     PF00165   7 tnwsiadiAeevgfSpsyfsr 27 
                  + +++ +A+e+ ++psy+ r
  ACV56230.1 124 FKKHVRTLADELDMDPSYLDR 144
                 67899*************965 PP

>> PF03704  Bacterial transcriptional activator domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.22   4.4e+02     118     135 ..     123     140 ..     121     147 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.22
                 -HHHHHHHHHHH------ CS
     PF03704 118 vYrrlrrrLaeeLGvePs 135
                 ++++  r+La+eL+++Ps
  ACV56230.1 123 QFKKHVRTLADELDMDPS 140
                 678889***********8 PP

>> PF08104  Ponericin L family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.22   4.5e+02      11      19 ..      45      53 ..      44      54 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.22
     PF08104 11 GAGKAVLGK 19
                GAGK  LG 
  ACV56230.1 45 GAGKSTLGH 53
                9******95 PP

>> PF00280  Potato inhibitor I family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.4      0.24   4.7e+02      29      50 ..     204     225 ..     201     232 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.24
                 EEEE-----SSSE-TTEEEEEE CS
     PF00280  29 vvlpegspvtadfrcnRVrvfv 50 
                 vv+++++ + + ++ +RV v+v
  ACV56230.1 204 VVITHNTRILEHVDVDRVHVMV 225
                 79999999************99 PP

>> PF02456  Adenovirus IVa2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.22   4.4e+02      90     109 ..      38      57 ..      24      80 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.22
     PF02456  90 gvvygptgsGksqllrnlls 109
                  v++gp g+Gks l   +++
  ACV56230.1  38 HVIMGPNGAGKSTLGHVVMG 57 
                 689*********99776665 PP

>> PF06543  Lactococcus bacteriophage repressor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.34   6.8e+02      24      33 ..      68      77 ..      66      79 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.34
     PF06543 24 VSFDGrPlsD 33
                V FDGr ++D
  ACV56230.1 68 VEFDGRDITD 77
                78*******9 PP

>> PF10236  Mitochondrial ribosomal death-associated protein 3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.39   7.8e+02      24      39 ..      36      51 ..      24      57 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.39
     PF10236 24 krvvltGekgsGKSvl 39
                +  v+ G++g GKS+l
  ACV56230.1 36 ETHVIMGPNGAGKSTL 51
                56799*********86 PP

>> PF02776  Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.43   8.5e+02      56      72 ..     193     209 ..     192     213 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.43
                 HH----SS----EE--S CS
     PF02776  56 dgyaratgkpgvvlvts 72 
                 d+y ratg   vv++++
  ACV56230.1 193 DAYRRATGGALVVITHN 209
                 79*************97 PP

>> PF03215  Rad17 cell cycle checkpoint protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.27   5.4e+02      49      64 ..      39      54 ..      33      64 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.27
     PF03215 49 lltGPsGcgKsTtvkv 64
                 + GP G+gKsT  +v
  ACV56230.1 39 VIMGPNGAGKSTLGHV 54
                589*********7555 PP

>> PF10443  RNA12 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.0      0.33   6.6e+02      21      34 ..      39      52 ..      33      79 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.33
     PF10443 21 vvkgPrGSGkkeLv 34
                v+ gP G Gk+ L 
  ACV56230.1 39 VIMGPNGAGKSTLG 52
                799********985 PP

>> PF11613  Agonist of corticotropin releasing factor R2, Urocortin-2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.2       0.5     1e+03      16      28 ..     249     261 ..     248     263 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.5
                 HHSSHHHHHHHHH CS
     PF11613  16 leqAkakalRaqA 28 
                 +eqA a a+R+  
  ACV56230.1 249 FEQAGAEAAREPV 261
                 9*********965 PP

>> PF02223  Thymidylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.45     9e+02       3      16 ..      42      55 ..      40      60 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.45
                --TT---HHHHHHH CS
     PF02223  3 GlDGaGKttqaell 16
                G +GaGK+t+   +
  ACV56230.1 42 GPNGAGKSTLGHVV 55
                89*******97765 PP

>> PF01225  Mur ligase family, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.1      0.81   1.6e+03      39      69 ..     201     231 ..     179     233 .. 0.81

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.81
                 --EEEE-TTS-TT.-HHHTT--EEEHHHHHH CS
     PF01225  39 GAvaVvseaikrdenpevpvipvedraeaLa 69 
                 GA++V++   +  e+++v ++ v  r ++ a
  ACV56230.1 201 GALVVITHNTRILEHVDVDRVHVMVRGRMVA 231
                 8899999999999999998888877766665 PP

>> PF03237  Terminase-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.0      0.49   9.9e+02       1      14 [.      39      52 ..      39      60 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.49
     PF03237  1 lilgsrqsGKTfal 14
                +i+g++++GK++++
  ACV56230.1 39 VIMGPNGAGKSTLG 52
                69*********987 PP

>> PF05688  Salmonella repeat of unknown function (DUF824)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.1      0.77   1.5e+03      17      24 ..       1       8 [.       1       9 [. 0.94

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.77
     PF05688 17 ltVtvkDa 24
                +t+t++D+
  ACV56230.1  1 MTITTRDS 8 
                9******8 PP

>> PF11359  Glycoprotein UL132
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.0      0.78   1.6e+03     115     146 ..     226     257 ..     221     262 .. 0.86

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.78
     PF11359 115 rgripaasssskyqrlekrdydeleeeasaar 146
                 rgr+ a   ss  + ++++ +++ e++ ++a 
  ACV56230.1 226 RGRMVAEGDSSLIESINEQGFEQFEQAGAEAA 257
                 8999999****************999877654 PP

>> PF05382  Bacteriophage peptidoglycan hydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.0   0.3       1.9   3.8e+03      82      99 ..      39      56 ..      32      60 .. 0.92

  Alignments for each domain:
  == domain 1    score: 0.0 bits;  conditional E-value: 1.9
     PF05382 82 viwGkkgasaGagGhvgi 99
                vi+G +ga + + Ghv++
  ACV56230.1 39 VIMGPNGAGKSTLGHVVM 56
                799*************98 PP

>> PF08047  Histidine operon leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.7   1.5       3.3   6.5e+03       5       9 ..     123     127 ..     123     127 .. 0.96

  Alignments for each domain:
  == domain 1    score: -0.7 bits;  conditional E-value: 3.3
     PF08047   5 QFKnH 9  
                 QFK+H
  ACV56230.1 123 QFKKH 127
                 ***99 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (264 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       316  (0.0265279); expected 238.2 (0.02)
Passed bias filter:                      305  (0.0256044); expected 238.2 (0.02)
Passed Vit filter:                        51  (0.0042814); expected 11.9 (0.001)
Passed Fwd filter:                        51  (0.0042814); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              50  [number of targets reported over threshold]
# CPU time: 0.23u 0.03s 00:00:00.26 Elapsed: 00:00:00
# Mc/sec: 2478.04
//