# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12750.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV56675.1  [L=607]
Description: elen0 ACV56675.1 GIB01015CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
     0.0031   19.9   0.2      0.093   15.1   0.0    2.5  2  PF10099  Anti-sigma-K factor rskA
  ------ inclusion threshold ------
       0.82   12.5   0.0        2.4   10.9   0.0    1.7  1  PF11611  Telomeric repeat-binding factor 2
        2.3   11.0   0.2        6.7    9.5   0.1    1.8  1  PF07949  YbbR-like protein
         16    7.5   0.1         40    6.2   0.0    1.7  1  PF09850  Uncharacterized protein conserved in bacteria (DUF2
         19    7.4   0.2         40    6.4   0.2    1.5  1  PF11293  Protein of unknown function (DUF3094)
         23    7.2   0.1    3.2e+02    3.6   0.0    2.3  2  PF07610  Protein of unknown function (DUF1573)
         29    7.0   0.0         55    6.1   0.0    1.4  1  PF08550  Fungal protein of unknown function (DUF1752)
         75    5.1   1.6    6.4e+02    2.1   0.0    2.5  2  PF07271  Cytadhesin P30/P32
         82    4.4   0.1    1.7e+02    3.4   0.1    1.4  1  PF05111  Ameloblastin precursor (Amelin)
    1.1e+02    5.1   0.0    2.4e+02    4.0   0.0    1.5  1  PF11278  Protein of unknown function (DUF3079)
    1.2e+02    5.1   0.3    5.4e+02    2.9   0.0    2.0  1  PF00440  Bacterial regulatory proteins, tetR family
    1.7e+02    4.7   0.0      4e+02    3.5   0.0    1.5  1  PF04663  Phenol hydroxylase conserved region
    1.9e+02    5.1   0.1    3.3e+02    4.3   0.0    1.3  1  PF06643  Protein of unknown function (DUF1158)
    2.3e+02    3.7   0.3    5.9e+02    2.4   0.2    1.7  1  PF12584  Protein of unknown function (DUF3758)
    2.3e+02    4.4   0.0    8.8e+02    2.6   0.0    1.9  1  PF01556  DnaJ C terminal region
    2.7e+02    2.6   0.0    4.5e+02    1.9   0.0    1.2  1  PF00148  Nitrogenase component 1 type Oxidoreductase
    2.7e+02    4.6   0.7    6.7e+02    3.3   0.0    1.9  1  PF09676  Type IV conjugative transfer system lipoprotein (Tr
    3.2e+02    3.3   0.1    5.7e+02    2.5   0.1    1.3  1  PF06848  Disaggregatase related repeat
    3.6e+02    2.9   0.0    6.2e+02    2.2   0.0    1.2  1  PF11723  Homotrimeric ring hydroxylase
    3.7e+02    3.6   0.0    7.1e+02    2.6   0.0    1.4  1  PF10017  Uncharacterized conserved protein (DUF2260)
    3.8e+02    3.3   0.1    6.6e+02    2.5   0.0    1.3  1  PF09925  Predicted membrane protein (DUF2157)
    4.2e+02    1.9   0.0    6.5e+02    1.3   0.0    1.2  1  PF04317  YcjX-like family, DUF463
    6.4e+02    3.3   0.1    1.4e+03    2.2   0.1    1.4  1  PF04930  FUN14 family
      7e+02    2.8   0.4    1.4e+03    1.8   0.3    1.4  1  PF10283  Zinc-finger (CX5CX6HX5H) motif
    8.9e+02    2.0   3.6      2e+03    0.9   2.5    1.5  1  PF12438  Protein of unknown function (DUF3679)
    1.4e+03    1.9   0.0    9.9e+03   -0.9   0.0    1.8  1  PF09643  YopX protein
    1.5e+03    1.7   1.3    2.6e+03    0.9   0.9    1.3  1  PF04021  Class III signal peptide
    1.5e+03    2.7   0.0    5.1e+03    1.1   0.0    1.8  1  PF05953  Allatostatin
      2e+03    0.9   3.1    3.7e+03    0.1   2.1    1.4  1  PF08041  PetM family of cytochrome b6f complex subunit 7
    2.3e+03    1.0   8.1    1.4e+02    4.9   1.7    1.9  1  PF04995  Heme exporter protein D (CcmD)
    3.8e+03    0.2   5.3    3.1e+03    0.5   2.2    1.8  1  PF06380  Protein of unknown function (DUF1072)


Domain and alignment annotation for each model:
>> PF10099  Anti-sigma-K factor rskA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   15.1   0.0   2.9e-05     0.093       3      56 ..      24      86 ..      19     138 .. 0.72
   2 ?    1.8   0.0      0.34   1.1e+03     126     161 ..     255     291 ..     253     295 .. 0.66

  Alignments for each domain:
  == domain 1    score: 15.1 bits;  conditional E-value: 2.9e-05
     PF10099  3 palwdrIearlfaepa.........aaaaarsarlwr..rlrrWrglalaaaAaaavlalalllv 56
                +a+ drIe++ +++++         ++++a +a+     +++r r  ++a+aA++++la++++l+
  ACV56675.1 24 RAVLDRIESQQSEQTRptgatgsaaPRHQAGPAP--TpfSVKRHRFRGFAVAACLLLLAVLVGLS 86
                678888988888888899***9854333344444..24688888888889999999999999888 PP

  == domain 2    score: 1.8 bits;  conditional E-value: 0.34
     PF10099 126 Glldaeesgeltlpadlaaaaaaa.lavtlEppGGsp 161
                 Gl++ e +g +t  +d  + +++a l vt+E + Gs 
  ACV56675.1 255 GLWTNEDAGAVTGYQDYIDTLDGAtLTVTIEKADGSH 291
                 5666666666644444444445455**********97 PP

>> PF11611  Telomeric repeat-binding factor 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.9   0.0   0.00075       2.4      27      57 ..     482     512 ..     465     515 .. 0.84

  Alignments for each domain:
  == domain 1    score: 10.9 bits;  conditional E-value: 0.00075
                 -BEE----SEEEEEEEEEEE-----B-B--- CS
     PF11611  27 eflkpkaggeflivevtvkNngeeaitvnss 57 
                 e  +p++g  ++++++tv N+++++++ + +
  ACV56675.1 482 ENGAPSDGYAYAAIDITVRNTSDKTLYADAT 512
                 556789*******************998765 PP

>> PF07949  YbbR-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.5   0.1    0.0021       6.7      30      79 ..     265     313 ..     264     315 .. 0.95

  Alignments for each domain:
  == domain 1    score: 9.5 bits;  conditional E-value: 0.0021
     PF07949  30 vtGpesvldkieevkaevyvDlsglke.dvtvevklllpdgnvevePstvt 79 
                 vtG ++ +d+++ +  +v   +++++    t++++l + d++++++Ps+++
  ACV56675.1 265 VTGYQDYIDTLDGATLTV--TIEKADGsHATKSIELTAADVKAKLVPSETN 313
                 9*****************..*******999*****************9876 PP

>> PF09850  Uncharacterized protein conserved in bacteria (DUF2077)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0     0.012        40     139     203 ..      24      86 ..      15      89 .. 0.68

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.012
     PF09850 139 eeelealrsrlyellrkreeepaelsphwqgaaaarrrlkrrrlpvwvilalalllllllylgls 203
                 ++ l+++ s+  e+ r+++++ +++ +h++g+a+++ + kr+r  +   +++a+llll++++gls
  ACV56675.1  24 RAVLDRIESQQSEQTRPTGATGSAAPRHQAGPAPTPFSVKRHR--FRGFAVAACLLLLAVLVGLS 86 
                 4567777888888888887777788999999999999995555..44444444555555555554 PP

>> PF11293  Protein of unknown function (DUF3094)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.2     0.012        40      22      46 ..      61      87 ..      48      92 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.012
     PF11293 22 qvERrPFrpwlLl..lvvlAvvigLGL 46
                 v R+ Fr + ++  l++lAv +gL L
  ACV56675.1 61 SVKRHRFRGFAVAacLLLLAVLVGLSL 87
                589999999987533899*******87 PP

>> PF07610  Protein of unknown function (DUF1573)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0      0.88   2.8e+03       3      13 ..     498     508 ..     497     513 .. 0.88
   2 ?    3.6   0.0       0.1   3.2e+02      32      43 ..     557     568 ..     553     569 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.88
     PF07610   3 kftNtGdapLv 13 
                 +++Nt d++L 
  ACV56675.1 498 TVRNTSDKTLY 508
                 89*******95 PP

  == domain 2    score: 3.6 bits;  conditional E-value: 0.1
     PF07610  32 pIaPGesgeikv 43 
                 pI+PGe+ +++v
  ACV56675.1 557 PIQPGETKTFTV 568
                 8********998 PP

>> PF08550  Fungal protein of unknown function (DUF1752)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.017        55       9      22 ..     445     458 ..     437     458 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.017
     PF08550   9 kkslpngeRLENls 22 
                  ++lp+  RLENl+
  ACV56675.1 445 ATQLPTEVRLENLA 458
                 469*********96 PP

>> PF07271  Cytadhesin P30/P32
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.0      0.44   1.4e+03     116     151 ..      27      62 ..      14      66 .. 0.86
   2 ?    2.1   0.0       0.2   6.4e+02     123     176 ..     291     343 ..     279     347 .. 0.68

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.44
     PF07271 116 lqriseqeeqqaveidpaeevnaqeeaqPagvnvav 151
                 l+ri+ q+ +q+    ++  +  +++a Pa+ + +v
  ACV56675.1  27 LDRIESQQSEQTRPTGATGSAAPRHQAGPAPTPFSV 62 
                 899999999999999999999999999999988765 PP

  == domain 2    score: 2.1 bits;  conditional E-value: 0.2
     PF07271 123 eeqqaveidpaeevnaqeeaqPagvnvavnp....qPqvqqqlgPnfqqrvnllrtgf 176
                 + ++++e  +   ++ +++  P+  n +  p     Pq+  +++ ++q+r+n +  g+
  ACV56675.1 291 HATKSIELTA---ADVKAKLVPSETNGT--PalelIPQIVDPFEGDVQERLNKRSEGY 343
                 4567777665...344455556644432..223449****************987775 PP

>> PF05111  Ameloblastin precursor (Amelin)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1     0.054   1.7e+02      14      40 ..      76     102 ..      68     116 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.054
     PF05111  14 lililsllklslavpafpqqpGapGma 40 
                 l+l+  l+ lslavp f +++G  G+a
  ACV56675.1  76 LLLLAVLVGLSLAVPRFAKNAGPLGFA 102
                 67777899*************988876 PP

>> PF11278  Protein of unknown function (DUF3079)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.074   2.4e+02      28      43 ..     437     452 ..     432     457 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.074
     PF11278  28 laCgnGseRtqHPvEl 43 
                 l+C+nG+  tq P+E+
  ACV56675.1 437 LTCTNGTVATQLPTEV 452
                 89************97 PP

>> PF00440  Bacterial regulatory proteins, tetR family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.17   5.4e+02      17      39 ..     566     588 ..     564     590 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.17
                 S-HHHHHHHCTS-HHHHHHHTSS CS
     PF00440  17 ttvreIAkeAGvskgalYrhFps 39 
                 +tv  ++++++ + +++ +h+++
  ACV56675.1 566 FTVLHVVAASDLADPTFSYHYRN 588
                 688899***************98 PP

>> PF04663  Phenol hydroxylase conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.12     4e+02      10      38 ..     110     138 ..     107     141 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.12
                 --EEEEEE-TT-TTS-S-EEEEE----BH CS
     PF04663  10 gkqLlyvgWddHllFcapvalplpPdmpf 38 
                 g+ Ll +g d  +lF a +++ +pPd ++
  ACV56675.1 110 GNSLLAMGEDGRILFEADILFRVPPDDRY 138
                 7899*********************9876 PP

>> PF06643  Protein of unknown function (DUF1158)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0       0.1   3.3e+02       3      31 ..      65      93 ..      63      97 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.1
     PF06643  3 hpletlltaagilllallsslllpapslg 31
                h +  +  aa +llla+l  l l  p+++
  ACV56675.1 65 HRFRGFAVAACLLLLAVLVGLSLAVPRFA 93
                66667778999999999999999999875 PP

>> PF12584  Protein of unknown function (DUF3758)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.2      0.18   5.9e+02       7      15 ..     395     403 ..     393     403 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.18
     PF12584   7 vanpDtWLv 15 
                 v+++DtW+v
  ACV56675.1 395 VTPQDTWVV 403
                 799****98 PP

>> PF01556  DnaJ C terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.27   8.8e+02      33      55 ..     264     286 ..     262     298 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.27
     PF01556  33 allGgkvkvptldgkkvkvkipa 55 
                 a++G +  ++tldg +++v+i++
  ACV56675.1 264 AVTGYQDYIDTLDGATLTVTIEK 286
                 899999***********999876 PP

>> PF00148  Nitrogenase component 1 type Oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.14   4.5e+02      79     101 ..     142     164 ..     141     187 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.14
     PF00148  79 gvvtTCvteliGdDieavareae 101
                 gv+t C+  + GdDi +v  +++
  ACV56675.1 142 GVYTGCMFRIEGDDIVRVQAHID 164
                 79*************99987765 PP

>> PF09676  Type IV conjugative transfer system lipoprotein (TraV)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.21   6.7e+02      61     104 ..     369     413 ..     349     416 .. 0.80

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.21
     PF09676  61 aegn.saaasaqsvtvaaassaasktarplplaaleskPlRtger 104
                 ++ + + +++a++ +v +as++++++++p+ +    ++PlR ge+
  ACV56675.1 369 QSLDrPLTEPASQPAVEPASAEPDEAVTPQDTWVVCKNPLRLGEA 413
                 2222589999*****************99999999999***9987 PP

>> PF06848  Disaggregatase related repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.18   5.7e+02      90     131 ..     467     508 ..     463     513 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.18
     PF06848  90 dkevawknaGGdwydkngvlqGstpyatitlkgselpdnryy 131
                 d++  +k +GG   d+ng       ya+i +   +++d+  y
  ACV56675.1 467 DSNKFFKANGGFTLDENGAPSDGYAYAAIDITVRNTSDKTLY 508
                 67778999***************************9999877 PP

>> PF11723  Homotrimeric ring hydroxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.19   6.2e+02     148     182 ..     554     588 ..     542     593 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.19
                 EEEEEETTEEEEEEEE-EE-SSHHHHHHHHHHHHH CS
     PF11723 148 wyvPidektheyfellgkkvateeeakefedefee 182
                 ++vPi+  +++ f +l  ++a++    +f+ ++++
  ACV56675.1 554 FFVPIQPGETKTFTVLHVVAASDLADPTFSYHYRN 588
                 89**********************99999999987 PP

>> PF10017  Uncharacterized conserved protein (DUF2260)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.22   7.1e+02      93     118 ..     169     194 ..     155     199 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.22
     PF10017  93 yKytleefealleaaglevlqvwtde 118
                 y+yt++ef+a  +  ++  +q+w+ +
  ACV56675.1 169 YRYTYDEFQAASNPDRWAEAQQWSTA 194
                 89*********************875 PP

>> PF09925  Predicted membrane protein (DUF2157)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0       0.2   6.6e+02      84     108 ..      65      89 ..      52      90 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.2
     PF09925  84 rrekatlaeallllaallvgallal 108
                  r++  + +a+lll+a+lvg +la+
  ACV56675.1  65 HRFRGFAVAACLLLLAVLVGLSLAV 89 
                 4677778999************996 PP

>> PF04317  YcjX-like family, DUF463
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0       0.2   6.5e+02     200     240 ..     307     343 ..     294     355 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.2
     PF04317 200 llPgelegaPvLtFfPlaalkeeeakkgsllavlerryeaY 240
                 l+P+e +g+P+L+++P  +    +  +g +++ l++r e Y
  ACV56675.1 307 LVPSETNGTPALELIPQIV----DPFEGDVQERLNKRSEGY 343
                 79**************664....345555555555555555 PP

>> PF04930  FUN14 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1      0.43   1.4e+03      13      41 ..      69      97 ..      67     113 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.43
     PF04930 13 GyalkkvgklaaiavGggilllqilaqkG 41
                G+a++  + l+a++vG+++++  ++++ G
  ACV56675.1 69 GFAVAACLLLLAVLVGLSLAVPRFAKNAG 97
                9******************9999999887 PP

>> PF10283  Zinc-finger (CX5CX6HX5H) motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.3      0.43   1.4e+03       6      12 ..     226     232 ..     226     232 .. 0.93

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.43
     PF10283   6 GanCYRr 12 
                 G++CY+r
  ACV56675.1 226 GVKCYQR 232
                 89****8 PP

>> PF12438  Protein of unknown function (DUF3679)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   2.5       0.6     2e+03       4      20 ..      72      88 ..      70      89 .. 0.88

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.6
     PF12438  4 llviillfgVllGmqqA 20
                +++ +ll+ Vl+G++ A
  ACV56675.1 72 VAACLLLLAVLVGLSLA 88
                7899**********988 PP

>> PF09643  YopX protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   0.0       3.1   9.9e+03      65      81 ..     154     172 ..     118     196 .. 0.59

  Alignments for each domain:
  == domain 1    score: -0.9 bits;  conditional E-value: 3.1
                 T-EEEETTTSCCEE..EEE CS
     PF09643  65 GDIvkvseerievv..kyk 81 
                 +DIv+v++++ + +  +y+
  ACV56675.1 154 DDIVRVQAHIDKGElyRYT 172
                 3466665554444444333 PP

>> PF04021  Class III signal peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.9       0.8   2.6e+03      11      23 ..      76      88 ..      75      90 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.8
     PF04021 11 lLilavlvvaiia 23
                lL+lavlv + +a
  ACV56675.1 76 LLLLAVLVGLSLA 88
                899*****99876 PP

>> PF05953  Allatostatin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0       1.6   5.1e+03       2      10 ..     248     256 ..     248     256 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 1.6
     PF05953   2 RspdYaFGL 10 
                 R  dY FGL
  ACV56675.1 248 RLSDYCFGL 256
                 6789****9 PP

>> PF08041  PetM family of cytochrome b6f complex subunit 7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   2.1       1.1   3.7e+03       6      20 ..      73      87 ..      70      87 .. 0.82

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.1
     PF08041  6 gAvIcivLVLvGLAl 20
                +A +   +VLvGL+l
  ACV56675.1 73 AACLLLLAVLVGLSL 87
                57788899*****86 PP

>> PF04995  Heme exporter protein D (CcmD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   1.7     0.042   1.4e+02      10      27 ..      71      88 ..      70      91 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.042
     PF04995 10 sYGltllvlagLivwslr 27
                +++++ll+la+L+++sl+
  ACV56675.1 71 AVAACLLLLAVLVGLSLA 88
                78*************996 PP

>> PF06380  Protein of unknown function (DUF1072)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   2.2      0.97   3.1e+03       7      24 ..      72      89 ..      71      90 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 0.97
     PF06380  7 IAvCvLalTvlagigava 24
                +A+C+L l vl g+++++
  ACV56675.1 72 VAACLLLLAVLVGLSLAV 89
                69***********99875 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (607 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       305  (0.0256044); expected 238.2 (0.02)
Passed bias filter:                      274  (0.023002); expected 238.2 (0.02)
Passed Vit filter:                        33  (0.00277032); expected 11.9 (0.001)
Passed Fwd filter:                        33  (0.00277032); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              31  [number of targets reported over threshold]
# CPU time: 0.35u 0.05s 00:00:00.40 Elapsed: 00:00:01
# Mc/sec: 3744.15
//