# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_12752.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACV56911.1  [L=191]
Description: elen0 ACV56911.1 GIB01015CH01 "xanthine phosphoribosyltransferase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.8e-12   48.7   0.1    5.5e-12   48.1   0.1    1.2  1  PF00156  Phosphoribosyl transferase domain
  ------ inclusion threshold ------
        6.2    9.3   0.0         19    7.8   0.0    1.8  1  PF03698  Uncharacterised protein family (UPF0180)
         20    7.9   0.1         70    6.1   0.0    1.8  1  PF01221  Dynein light chain type 1
         24    7.2   0.1         49    6.2   0.0    1.5  1  PF00391  PEP-utilising enzyme, mobile domain
         26    7.1   0.0         52    6.1   0.0    1.6  1  PF06399  GTP cyclohydrolase I feedback regulatory protein (G
         38    6.0   0.0         55    5.5   0.0    1.2  1  PF04951  D-aminopeptidase
         43    6.5   0.0         85    5.6   0.0    1.5  1  PF00480  ROK family
         52    5.5   0.0         69    5.1   0.0    1.1  1  PF11382  Protein of unknown function (DUF3186)
         61    5.3   0.0         90    4.8   0.0    1.2  1  PF02527  rRNA small subunit methyltransferase G
    1.5e+02    4.5   0.1    2.6e+02    3.7   0.0    1.3  1  PF01737  YCF9
    1.5e+02    4.9   0.0    2.6e+02    4.2   0.0    1.3  1  PF12562  Protein of unknown function (DUF3746)
    1.9e+02    4.4   0.0    3.7e+02    3.5   0.0    1.5  1  PF02933  Cell division protein 48 (CDC48), domain 2
    3.5e+02    3.0   0.0    5.4e+02    2.4   0.0    1.2  1  PF01189  NOL1/NOP2/sun family
    5.3e+02    0.3   0.0    6.5e+02    0.0   0.0    1.0  1  PF03805  Cytoadherence-linked asexual protein


Domain and alignment annotation for each model:
>> PF00156  Phosphoribosyl transferase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   48.1   0.1   7.7e-16   5.5e-12       5     123 ..      30     152 ..      26     154 .. 0.87

  Alignments for each domain:
  == domain 1    score: 48.1 bits;  conditional E-value: 7.7e-16
                 E...ECCCCHHHHHHCHHHHCEE..EEEEEC----TTCHHHCCCCCCHCHH-B.TTSS.S.......EEEECTCCC-EEEEEES-GGGGTTSEEEEEEC CS
     PF00156   5 ldpedlreagrllaeklreekgkkdvvvGiargGvplatelaraLglpldlvrvrkssap.......assetsrkreaailesrpeedlkgkrvliVDD 96 
                 ld++ ++++g++   +++++ ++k  +++i+++G+ +a ++ar++g+p +++ +  s           + e  ++++ +   ++++ ++++++vli+DD
  ACV56911.1  30 LDIDLFDAMGEEFKRLFADAPITK--ILTIEASGIGIACVVARHFGVPVVFAKKAQSI-NldgemftTRIESFTHGRVYDVIVSKKFLNADDHVLIIDD 125
                 6899999999999999******99..************************99876554.36*****877777777777777788889999********* PP

                 EE----HHHHHHHCCCT-S..EEEEEE CS
     PF00156  97 vlatGgTlraaielLkeagakevgvav 123
                 +la G +l  +iel+ eaga++ g+ +
  ACV56911.1 126 FLANGCALNGLIELVGEAGATVEGIGI 152
                 *******************99877755 PP

>> PF03698  Uncharacterised protein family (UPF0180)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0027        19       4      32 ..     152     180 ..     150     185 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0027
     PF03698   4 iaveesLsnieeaLkekGYeVvelkeeed 32 
                 ia+e++ ++  + L+e+GY  ++l   e+
  ACV56911.1 152 IAIEKGFQPGGDDLRERGYRLESLAIVER 180
                 9*******************999976554 PP

>> PF01221  Dynein light chain type 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0    0.0098        70      55      71 ..      65      81 ..      58      88 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.0098
                EEE-------EEES--S CS
     PF01221 55 hcivGksFGsyvthekk 71
                 c+v ++FG+ v++ kk
  ACV56911.1 65 ACVVARHFGVPVVFAKK 81
                5***********99887 PP

>> PF00391  PEP-utilising enzyme, mobile domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0    0.0068        49      45      61 ..      64      80 ..      49     102 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.0068
     PF00391 45 HaailArelgiPavvgv 61
                 a ++Ar +g+P+v+  
  ACV56911.1 64 IACVVARHFGVPVVFAK 80
                5889*********9865 PP

>> PF06399  GTP cyclohydrolase I feedback regulatory protein (GFRP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0    0.0073        52      23      56 ..      22      55 ..       3      80 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.0073
     PF06399 23 sdpelmalleaekvtvlGnnfseyyvdepprvvl 56
                 d  l ++l+ ++  ++G++f+  ++d p   +l
  ACV56911.1 22 VDSFLNHQLDIDLFDAMGEEFKRLFADAPITKIL 55
                57788999*******************9975554 PP

>> PF04951  D-aminopeptidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0    0.0076        55     132     153 ..      58      79 ..      51      98 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.0076
                 EE-----HHHH----S----EE CS
     PF04951 132 evgEaglnaalageygvpvvlv 153
                 e++ +g+  ++a+++gvpvv++
  ACV56911.1  58 EASGIGIACVVARHFGVPVVFA 79 
                 677789999***********97 PP

>> PF00480  ROK family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.012        85      72     112 ..      53      93 ..      45     101 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.012
                 SSGC--HCCTTHHHHHHHHHTS-EEEEEHHHHHHHHHHHCH CS
     PF00480  72 stPnikwadvdlvkkleerlnvpvvlendanaaalaEkvfg 112
                 ++  i++  + +++ +  +++vpvv+++ a++  l  ++f+
  ACV56911.1  53 KILTIEASGIGIACVVARHFGVPVVFAKKAQSINLDGEMFT 93 
                 555567777899999****************9998777776 PP

>> PF11382  Protein of unknown function (DUF3186)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0    0.0096        69      83     116 ..     117     150 ..      98     171 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.0096
     PF11382  83 gkkValvelpdaddddvdavkelLekAGatvvgr 116
                 +  V+++    a+    +++ el+ +AGatv+g 
  ACV56911.1 117 DDHVLIIDDFLANGCALNGLIELVGEAGATVEGI 150
                 7789999999999999***************996 PP

>> PF02527  rRNA small subunit methyltransferase G
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.013        90      94     135 ..      84     124 ..      77     133 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.013
                 HCT-SSEEEEES-TTTTTTTT-BSEEEEC-SSSHHHHHHHHC CS
     PF02527  94 elklenveivearaeekqeeekydvitsRAlaslneltelal 135
                  ++l+  e+  +r+e++ +   ydvi+s  + + ++ + +  
  ACV56911.1  84 SINLD-GEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIID 124
                 55666.788999****************99988877766655 PP

>> PF01737  YCF9
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.037   2.6e+02      19      26 ..      73      80 ..      62      87 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.037
                --HHHHHT CS
     PF01737 19 gVPVvlAs 26
                gVPVv+A 
  ACV56911.1 73 GVPVVFAK 80
                9*****95 PP

>> PF12562  Protein of unknown function (DUF3746)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.036   2.6e+02      24      36 ..      87      99 ..      83     100 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.036
     PF12562 24 FdNstYTTRtgsy 36
                +d+  +TTR+ s 
  ACV56911.1 87 LDGEMFTTRIESF 99
                69999****9886 PP

>> PF02933  Cell division protein 48 (CDC48), domain 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.051   3.7e+02       5      21 ..      36      53 ..      35      69 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.051
                HHHH.HHHHHHTT-EE-T CS
     PF02933  5 dema.ylkrqFlgrpvsk 21
                d m  ++kr F++ p++k
  ACV56911.1 36 DAMGeEFKRLFADAPITK 53
                67888**********997 PP

>> PF01189  NOL1/NOP2/sun family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0     0.076   5.4e+02     152     173 ..      37      58 ..      22      60 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.076
                 H---TCCEEEECSSEEEEEETT CS
     PF01189 152 llgsefdrilldaPcsgtgvir 173
                 + g+ef r+  daP ++  +i+
  ACV56911.1  37 AMGEEFKRLFADAPITKILTIE 58 
                 56789***********998886 PP

>> PF03805  Cytoadherence-linked asexual protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.0   0.0     0.091   6.5e+02     622     675 ..       2      55 ..       1      60 [. 0.87

  Alignments for each domain:
  == domain 1    score: 0.0 bits;  conditional E-value: 0.091
     PF03805 622 eeLekllkketiekmkksikflihvnsflqlDffhaLnetplkekrkyplslvl 675
                 e Le++++++ + k   ++k    +n  l +D f a+ e+  + +   p++ +l
  ACV56911.1   2 ELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKIL 55 
                 568899999999999999998889999999*****************9999887 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (191 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       237  (0.0198959); expected 238.2 (0.02)
Passed bias filter:                      232  (0.0194762); expected 238.2 (0.02)
Passed Vit filter:                        14  (0.00117529); expected 11.9 (0.001)
Passed Fwd filter:                        14  (0.00117529); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              14  [number of targets reported over threshold]
# CPU time: 0.16u 0.04s 00:00:00.20 Elapsed: 00:00:01
# Mc/sec: 2577.19
//