hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_12729.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ACV54563.1
Accession:      [none]
Description:    elen0 ACV54563.1 GIB01015CH01 "transcriptional regulator, LuxR family"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0048694  C-terminal effector domain of the bipartite     42.9    1.3e-11   1
0051317  C-terminal effector domain of the bipartite     43.6    8.3e-11   1
0046851  C-terminal effector domain of the bipartite     41.1    5.9e-10   1
0047924  C-terminal effector domain of the bipartite     38.3    1.8e-09   1
0045681  C-terminal effector domain of the bipartite     36.6    5.4e-09   1
0042501  MFS general substrate transporter               12.0    0.00075   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0042501    1/1       1   398 [.     1   447 []    12.0  0.00075
0048694    1/1     392   470 ..     1    87 []    42.9  1.3e-11
0051317    1/1     402   471 ..     1    70 []    43.6  8.3e-11
0045681    1/1     408   470 ..     1    67 []    36.6  5.4e-09
0046851    1/1     410   470 ..     1    67 []    41.1  5.9e-10
0047924    1/1     410   470 ..     1    65 []    38.3  1.8e-09

Alignments of top-scoring domains:
0042501: domain 1 of 1, from 1 to 398: score 12.0, E = 0.00075
                   *->Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpa
                      M++ +  e+ +  + ++++  +r  i l +f++ ++ g+   ++g  
  ACV54563.1     1    MQQATGGEKSRVVAKPARSDIQRGGIALDAFASALFWGYVAIMFGSS 47   

                   lpll.edlglsaaqaglllsafflgyalgallaGplaDrfGrrrvlllgl
                      ++e+ gl +  ++l       g +++ + +G l+ r     +++lgl
  ACV54563.1    48 EIKIaESIGLAPENVAL-----ICGNVVALVAVGLLGPRAHGSHLFVLGL 92   

                   llfalgslllalaallgpslalllllrflqGlgagglfpaalallaewfp
                   ++++ +++l  ++ l  p +  ++ +r+++  ++++l  a    ++  + 
  ACV54563.1    93 AGSGTACILQTVSLLS-PEMVPVAWSRLFACGASAILVLAWCEHISSET- 140  

                   pkergralglfgaggglGgalgpllggllleldlgWrwafliaailalll
                    +er ++l+l ++          ++  l+    lg r+a l++++l ++ 
  ACV54563.1   141 SQERPLFLALCSLL--------TIVIVLVSIQ-LGARSAILFGGVLPVVS 181  

                   alllllllpesprflllkglseeerkvlerrlkadaeakaasplsllell
                   a+l++++ + s r+                  ++++  ++++pl l    
  ACV54563.1   182 AALGAYRTRASART------------------APSVTIQPPFPLYL---- 209  

                   rnprflllllayfllflgfyglltflplylqevlglsasqaglllalfgl
                       ++l+++++++ f+++    t  +  ++   g+++  ag+ ++++ +
  ACV54563.1   210 ---IVILFVFGFMISFFSLLNRRTGTVENFMIPAGIDPFLAGWTVLVLVI 256  

                   ggilgsllagrlsdrlpegrrrrllliglllaalgllllallpgtslall
                   +g++ +ll  r       + + ++ ++ + la lglll  +l ++    l
  ACV54563.1   257 AGCVWMLLPQR-------H-ASLVTTVLIPLASLGLLLPPFLRYGLQETL 298  

                   llllfllgfglggafpllfalvaelfppelrgtasgllnlagnlggallg
                    ++++++ ++ +++ ++ ++ + ++f      t + ++ ++g +g+++ g
  ACV54563.1   299 PAVVAFIVICEAIICSVGPSNAKKYFH-IGSFTFVFWTRSFGLIGMIV-G 346  

                   pllagllldat....gyaaaflllaalallalllllllrretkgrsleei
                    ++a ll+d +++++++ ++++++aa a+l+l ++++l+r   + ++e++
  ACV54563.1   347 YAAAILLFDIMkiaiDFDILLIMFAAYAILCLTVAVMLGRIGLKAPAERE 396  

                   eeeeklllelllllllllalllaalalLtprErevlrllaeGlsnkeIAerl
                        +++    ++ +a +la  + Lt+rE evl+l+a+G+++  + ++l
  ACV54563.1   392    PAERERESTPAAAAHALAERYGLTAREAEVLELVAQGRNMTYVQKAL 438  

                   gisekTVkthlsrilrKlgvrnraelvalalrlglldldelllldllallllLtprElevlrllaeglsnkeIAellgisekTVkth
                          ++la  ++Lt+rE evl l+a+g+++  +   l+is++T +th
  ACV54563.1   402    AAAAHALAERYGLTAREAEVLELVAQGRNMTYVQKALCISPGTSSTH 448  

                   lsrilrKlgvrsraelvalalelddllllLtprelevlrllaeglsnkeiAellgisekTVkthlsnilr
                          + Lt+re evl l+a+g+++  + + l+is++T +th+++i +
  ACV54563.1   408    LAERYGLTAREAEVLELVAQGRNMTYVQKALCISPGTSSTHINHIHQ 454  

                   KlgvrsraelvalalelgllpllsLtprElevlrllaeglsnkeiAellgisekTVkthlsnilrKl
                      + ++Lt+rE evl l+a+g+++  +  +l+is++T +th+++i +Kl
  ACV54563.1   410    ERYGLTAREAEVLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKL 456  

                   gvssraelvalalrlglldldllsLtprelevlrllaeGlsnkeiAellgisekTVkthlsnilrkl
                      + ++Lt re+evl l+a+G+++  +  +l+is++T +th+++i +kl
  ACV54563.1   410    ERYGLTAREAEVLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKL 456  

                   gvrsraelvalalrlgli