RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACV54398.1 elen0 ACV54398.1 GIB01015CH01 "Phenylacetate--CoA
ligase"
         (447 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3dlpX [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE                   75   4e-16
2d1qA [x.x.x] LUCIFERIN 4-MONOOXYGENASE                                72   4e-15
3cw9A [x.x.x] 4-CHLOROBENZOYL COA LIGASE                               71   9e-15
2c4iA [x.x.x] AVIDIN                                                   68   6e-14
3cw8X [x.x.x] 4-CHLOROBENZOYL COA LIGASE                               63   1e-12
3bl4A [x.x.x] UNCHARACTERIZED PROTEIN                                  62   2e-12
2d1rA [x.x.x] LUCIFERIN 4-MONOOXYGENASE                                59   3e-11
2d1tA [x.x.x] LUCIFERIN 4-MONOOXYGENASE                                59   3e-11
2d1sA [x.x.x] LUCIFERIN 4-MONOOXYGENASE                                56   2e-10
3c5eA [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL[M...    50   1e-08
3dhvA [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE                    49   2e-08
3b7wA [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL[M...    44   8e-07
3dayA [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL[M...    42   3e-06
2d42A [x.x.x] NON-TOXIC CRYSTAL PROTEIN                                40   2e-05
3c30A [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ             37   9e-05
2atwA [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA                    35   3e-04

>3dlpX [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
          Length = 504

 Score = 75.1 bits (183), Expect = 4e-16
 Identities = 54/414 (13%), Positives = 111/414 (26%), Gaps = 21/414 (5%)

Query: 22  PELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFPFCDKKTERETQ 81
                L+   L +++                A             A+  F          
Sbjct: 83  LLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQS----GSGARIIFLGDLVRDGEP 138

Query: 82  HVGSFFGEMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPND 141
           +      E       +  F+                Q   +      +          ++
Sbjct: 139 YSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLR-HGRHN 197

Query: 142 RYVHGLNFALYVGGPDV-IGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWH 200
             +  +     VG   V + A  L    + V        L +++Q Q T ++ +P+   H
Sbjct: 198 VVLGLMPLYHVVGFFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPT---H 254

Query: 201 LGEIAKEKGFDP-KEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGAC 259
           L  +A            +    +    A     +  E +      + V+ YG ++   + 
Sbjct: 255 LDALAAAAAHAGSSLKLDSLRHVTFAGATMP-DAVLETVHQHLPGEKVNIYGTTEAMNSL 313

Query: 260 AAAC--EAHDGLHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDI 317
                    +       ++ +  +     E++A GE GEL+           +       
Sbjct: 314 YMRQPKTGTEMAPGFFSEVRIVRIGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATA 373

Query: 318 GYVSTDTCECGRTLARIH-----VTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEYSI 372
             +                    + GR  +M I G  N+ PS+IE V+    G+T    I
Sbjct: 374 EKLQDGWYRTSDVAVWTPEGTVRILGRVPDMIISGGENIHPSEIERVLGTAPGVTEVVVI 433

Query: 373 RVYEKNFTCKYEVSVE-RSLGSDEPYDEVASRTEAALKAHTGVRPAKVIVYDAG 425
            + ++ +       V  R   +            + L      RP +  + D  
Sbjct: 434 GLADQRWGQSVTACVVPRLGETLSADALDTFCRSSELADFK--RPKRYFILDQL 485


>2d1qA [x.x.x] LUCIFERIN 4-MONOOXYGENASE
          Length = 529

 Score = 71.8 bits (174), Expect = 4e-15
 Identities = 46/341 (13%), Positives = 84/341 (24%), Gaps = 12/341 (3%)

Query: 89  EMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPNDRYVHGLN 148
                 E +                   T E+            +   + P    +  + 
Sbjct: 172 SSFKTVEVDRKEQVALIMNSSLPKGVQLTHENIVTRFSHARDPIYGNQVSPGTAVLTVVP 231

Query: 149 FALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEK 208
           F    G    +G    G   + +     +  L  L+ Y+ T +   P+    L +     
Sbjct: 232 FHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSELLN 291

Query: 209 GFDPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDG 268
               K D +    I +G A  S +             V   YGL++   A     E  D 
Sbjct: 292 ----KYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK 347

Query: 269 LHIVEDQILVET---VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTC 325
                  + +     +D  T + L P   GE+           +                
Sbjct: 348 PGASGKVVPLFKAKVIDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWL 407

Query: 326 ECGRTLAR-----IHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEYSIRVYEKNFT 380
             G            +  R   +       V P+++E V+     +       V +    
Sbjct: 408 HTGDIGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAG 467

Query: 381 CKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVIV 421
                 V    G +    EV     + +     +R     V
Sbjct: 468 ELPGAVVVLESGKNMTEKEVMDYVASQVSNAKRLRGGVRFV 508


>3cw9A [x.x.x] 4-CHLOROBENZOYL COA LIGASE
          Length = 503

 Score = 70.5 bits (171), Expect = 9e-15
 Identities = 45/341 (13%), Positives = 90/341 (26%), Gaps = 14/341 (4%)

Query: 34  DMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFPFCDKKTERETQHVGSFFGEMCSV 93
             +A                      I      A+  F          +      E    
Sbjct: 91  AELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARIIFLGDLVRDGEPYSYGPPIEDPQR 150

Query: 94  PEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPNDRYVHGLNFALYV 153
              +  F+                Q      +              ++  +  +     V
Sbjct: 151 EPAQPAFIFYTSGTTGLPKAAIIPQRAA-ESRVLFMSTQVGLRHGRHNVVLGLMPLYHVV 209

Query: 154 GGPDV-IGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGFDP 212
           G   V + A  L    + V        L +++Q Q T ++ +P+   HL  +A       
Sbjct: 210 GFFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPT---HLDALAAAAAHAG 266

Query: 213 -KEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAAC--EAHDGL 269
                +    +          +  E +      + V+ YG ++   +          +  
Sbjct: 267 SSLKLDSLRHVTFA-GATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKTGTEMA 325

Query: 270 HIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGR 329
                ++ +  +     E++A GE GEL+           +         +         
Sbjct: 326 PGFFSEVRIVRIGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATAEKLQDGWYRTSD 385

Query: 330 TLAR-----IHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDG 365
                    + + GR D+M I G  N+ PS+IE V+    G
Sbjct: 386 VAVWTPEGTVRILGRVDDMIISGGENIHPSEIERVLGTAPG 426


>2c4iA [x.x.x] AVIDIN
          Length = 242

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 26/221 (11%), Positives = 53/221 (23%), Gaps = 19/221 (8%)

Query: 154 GGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGFDPK 213
              D  G + L  + +   +V      +   +    I                       
Sbjct: 24  CFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLKCSLTGK----------WT 73

Query: 214 EDFNIHTIIVAGEAGGS--IKSTREAIENLWGAKVVDFYGLSDIYGACAA----ACEAHD 267
            D   +  I A  + G                 K    +G  +  G+            +
Sbjct: 74  NDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTIGSTTVFTGQCFIDRN 133

Query: 268 GLHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCEC 327
           G  +++   L+ +     G+       G  ++T L  +   +    T D+G   T     
Sbjct: 134 GKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLSARKCSLTGKWTNDLGSNMTIGAVN 193

Query: 328 G---RTLARIHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDG 365
                T   I              ++   + I    +   G
Sbjct: 194 SRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFG 234


>3cw8X [x.x.x] 4-CHLOROBENZOYL COA LIGASE
          Length = 501

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 55/423 (13%), Positives = 114/423 (26%), Gaps = 20/423 (4%)

Query: 11  YYDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP 70
                +  +P      L+   L +++                A            I    
Sbjct: 72  LALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARIIFLGD 131

Query: 71  FCDKKTERETQHVGSFFGEMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEAR 130
                             E       +  F+                Q   +      + 
Sbjct: 132 LVRDGEPYSYGP----PIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMST 187

Query: 131 LFWQAGMRPNDRYVHGLNFALYVGGPDV-IGAQRLGALAIWVGAVPSDRLLFVLKQYQPT 189
                    ++  +  +     VG   V + A  L    + +        L +++Q Q T
Sbjct: 188 -QVGLRHGRHNVVLGLMPLYHVVGFFAVLVAALALDGTYVVIEEFRPVDALQLVQQEQVT 246

Query: 190 IIWTSPSYAWHLGEIAKEKGFDP-KEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVD 248
            ++ +P+   HL  +A            +    +    A     +  E +      + V+
Sbjct: 247 SLFATPT---HLDALAAAAAHAGSSLKLDSLRHVTFAGATMP-DAVLETVHQHLPGEKVN 302

Query: 249 FYGLSDIYGACAAAC--EAHDGLHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKA 306
            YG ++   +          +       ++ +  +     E++A GE GEL+        
Sbjct: 303 IYGTTEAMNSLYMRQPKTGTEMAPGFFSEVRIVRIGGGVDEIVANGEEGELIVAASDSAF 362

Query: 307 RPMIRFRTGDIGYVSTDTCECGRTLA-----RIHVTGRKDEMFIVGAVNVFPSDIEYVVR 361
              +         +                  + + GR D+M I G  N+ PS+IE V+ 
Sbjct: 363 VGYLNQPEATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDDMIISGGENIHPSEIERVLG 422

Query: 362 GLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVIV 421
              G+T E  +      +       V   LG     D + +   ++  A     P +  +
Sbjct: 423 TAPGVT-EVVVIGLADQWGQSVTACVVPRLGETLSADALDTFCRSSELADFKR-PKRYFI 480

Query: 422 YDA 424
            D 
Sbjct: 481 LDQ 483


>3bl4A [x.x.x] UNCHARACTERIZED PROTEIN
          Length = 117

 Score = 62.4 bits (151), Expect = 2e-12
 Identities = 15/110 (13%), Positives = 31/110 (28%), Gaps = 6/110 (5%)

Query: 261 AACEAHDGLHIVEDQILVETVDPTTGEVLAP-GETGELVYTTLCKKARPMIRFRTGDIGY 319
           +      GL +  D  ++    P    + A   E    V         P++   T D+  
Sbjct: 2   SEVGTEAGLTLGGD-GILRLTWPRGAAITAADAERALRVNQLCGDDRHPLVDATTADVSR 60

Query: 320 VSTDTCECGRTLARI-HVTGRKDEMFIVG---AVNVFPSDIEYVVRGLDG 365
            +          +RI  +     +  +      +N  P   ++     D 
Sbjct: 61  GARAVFGRPCQASRIALLGSSPVDRVLANFFLGINAVPCPTKFFTSERDA 110


>2d1rA [x.x.x] LUCIFERIN 4-MONOOXYGENASE
          Length = 537

 Score = 59.0 bits (141), Expect = 3e-11
 Identities = 38/280 (13%), Positives = 72/280 (25%), Gaps = 12/280 (4%)

Query: 94  PEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPNDRYVHGLNFALYV 153
            +E+V  +               T E+            +   + P    +  + F    
Sbjct: 182 RKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQVSPGTAVLTVVPFHHGF 241

Query: 154 GGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGFDPK 213
           G    +G    G   + +     +  L  L+ Y+ T +   P+    L +          
Sbjct: 242 GMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSELLNK---- 297

Query: 214 EDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAA---CEAHDGLH 270
            D +    I +G A  S +             V   YGL++   A        +      
Sbjct: 298 YDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGASG 357

Query: 271 IVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRT 330
            V      + +D  T + L P   GE+           +                  G  
Sbjct: 358 KVVPLFKAKVIDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWLHTGDI 417

Query: 331 LAR-----IHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDG 365
                     +  R   +       V P+++E V+     
Sbjct: 418 GYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPS 457


>2d1tA [x.x.x] LUCIFERIN 4-MONOOXYGENASE
          Length = 538

 Score = 59.0 bits (141), Expect = 3e-11
 Identities = 42/286 (14%), Positives = 78/286 (27%), Gaps = 12/286 (4%)

Query: 93  VPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPNDRYVHGLNFALY 152
             +E+V  +               T E+            +   + P    +  + F   
Sbjct: 182 DRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQVSPGTAVLTVVPFHHG 241

Query: 153 VGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGFDP 212
            G    +G    G   + +     +  L  L+ Y+ T +   P+    L +         
Sbjct: 242 FGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTNVILVPTLFAILNKSELL----N 297

Query: 213 KEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHD---GL 269
           K D +    I +G A  S +             V   YGL++   A     E  D     
Sbjct: 298 KYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGAS 357

Query: 270 HIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMI---RFRTGDIGYVSTDTCE 326
             V      + +D  T + L P   GE+           +      +          T +
Sbjct: 358 GKVVPLFKAKVIDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWLHTGD 417

Query: 327 CGRTLAR--IHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEY 370
            G         +  R   +       V P+++E V+     +    
Sbjct: 418 IGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAG 463


>2d1sA [x.x.x] LUCIFERIN 4-MONOOXYGENASE
          Length = 538

 Score = 55.9 bits (133), Expect = 2e-10
 Identities = 43/347 (12%), Positives = 84/347 (24%), Gaps = 17/347 (4%)

Query: 89  EMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPNDRYVHGLN 148
            +    +E+V  +               T E+            +   + P    +  + 
Sbjct: 178 TVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQVSPGTAVLTVVP 237

Query: 149 FALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEK 208
           F    G    +G    G   + +     +  L  L+ Y+ T +   P+    L +     
Sbjct: 238 FHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSELLN 297

Query: 209 GFDPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDG 268
            +D     N+  I   G          EA+   +    V          +        D 
Sbjct: 298 KYDL---SNLVEIASGGAPLSKE--VGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDD 352

Query: 269 ----LHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGD-----IGY 319
                  V      + +D  T + L P   GE+           +             G+
Sbjct: 353 KPGASGKVVPLFKAKVIDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGW 412

Query: 320 VSTDTCECGRTLARIHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEYSIRVYEKNF 379
           + T             +  R   +       V P+++E V+     +       V +   
Sbjct: 413 LHTGDIGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVA 472

Query: 380 TCKYEVSVERSLGSDE-PYDEVASRTEAALKAHTGVRPAKVIVYDAG 425
                  V    G +    + +         A        V   D  
Sbjct: 473 GELPGAVVVLESGKNMTEKEVMDYVASQVSNAK--RLRGGVRFVDEV 517


>3c5eA [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
           MITOCHONDRIAL[MASQUE : MEMB(X) 46 / COIL(x) 0]
          Length = 536

 Score = 50.2 bits (118), Expect = 1e-08
 Identities = 30/240 (12%), Positives = 66/240 (27%), Gaps = 14/240 (5%)

Query: 210 FDPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHD-- 267
               +  ++   +  GE+   +  T E      G  + + YG ++    C  +       
Sbjct: 290 LSSYKFPHLQNCVTVGES--LLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIKP 347

Query: 268 GLHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCEC 327
           G            +    G VL PG  G++       +   +      +    + +    
Sbjct: 348 GYMGTAASCYDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGD 407

Query: 328 GRTLARI---------HVTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEYSIRVYEKN 378
              L               GR D++       + PS++E  +     +     I   +  
Sbjct: 408 FWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPV 467

Query: 379 FTCKYEVSVE-RSLGSDEPYDEVASRTEAALKAHTGVRPAKVIVYDAGKLGTSSEHKASR 437
                +  V   S       +++    +  +K+ T        +     L  +   K  R
Sbjct: 468 RGEVVKAFVVLASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQR 527


>3dhvA [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE
          Length = 498

 Score = 49.4 bits (116), Expect = 2e-08
 Identities = 39/319 (12%), Positives = 84/319 (26%), Gaps = 21/319 (6%)

Query: 136 GMRPNDRYVHGLNFALYVGGPDVIGAQRLGA---LAIWVGAVPSDRLLFVLKQYQPTIIW 192
            ++    +++   F+  +   D+  +   G                L   L+Q    +  
Sbjct: 175 NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWT 234

Query: 193 TSPSYAWHLGEIAKEKGFDPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGL 252
           ++PS+A      A                 +        +  R+ IE    A +++ YG 
Sbjct: 235 STPSFAEMCLMEASFSE----SMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGP 290

Query: 253 SDIYGACAA-------ACEAHDGLHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKK 305
           ++   A            +                +    G +   GE GE+V       
Sbjct: 291 TEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVS 350

Query: 306 ARPMIRFRTGDIGYVS------TDTCECGRTLARIHVT-GRKDEMFIVGAVNVFPSDIEY 358
              +      +  +          T + G     +    GR D    +    +   +IE+
Sbjct: 351 VGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEH 410

Query: 359 VVRGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAK 418
            +R    + G   + + +          V     S E   ++ S  +  L          
Sbjct: 411 HLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIP 470

Query: 419 VIVYDAGKLGTSSEHKASR 437
                   +  +   K  R
Sbjct: 471 RKFMYQSSIPMTPNGKVDR 489


>3b7wA [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
           MITOCHONDRIAL[MASQUE : MEMB(X) 46 / COIL(x) 0]
          Length = 537

 Score = 44.0 bits (102), Expect = 8e-07
 Identities = 38/380 (10%), Positives = 88/380 (23%), Gaps = 17/380 (4%)

Query: 31  RLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFPFCDKKTERETQHVGSFFGEM 90
           RL+   A A        +  D    +   +     +++         ++  +  S     
Sbjct: 116 RLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNEASTTHHC 175

Query: 91  CSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPNDRYVHGLNFA 150
                +E   +               +     L    +A      G++ +D      +  
Sbjct: 176 VETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT---GLQASDIMWTISDTG 232

Query: 151 LYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF 210
                                  +P    L V+ +                         
Sbjct: 233 XXXXXXXXXXXXXXXXXXXXXXXLPKFDPL-VILKXXXXXXXXXXXXXXXXXXXXXXXDL 291

Query: 211 DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAA--CEAHDG 268
              +  ++   +  GE+   +  T E      G  + + YG ++    C  +   +   G
Sbjct: 292 SSYKFPHLQNCVTVGES--LLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIKPG 349

Query: 269 LHIVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGD---------IGY 319
                       +    G VL PG  G++       +   +      +           +
Sbjct: 350 YMGTAASCYDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDF 409

Query: 320 VSTDTCECGRTLARIHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEYSIRVYEKNF 379
                             GR D++       + PS++E  +     +     I   +   
Sbjct: 410 WLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVR 469

Query: 380 TCKYEVSVERSLGSDEPYDE 399
               +  V  +        E
Sbjct: 470 GEVVKAFVVLASQFLSHDPE 489


>3dayA [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
           MITOCHONDRIAL[MASQUE : MEMB(X) 46 / COIL(x) 0]
          Length = 535

 Score = 42.1 bits (97), Expect = 3e-06
 Identities = 26/187 (13%), Positives = 49/187 (26%), Gaps = 12/187 (6%)

Query: 213 KEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAAC--EAHDGLH 270
              F      V          T E      G  + + YG ++    C  +   +   G  
Sbjct: 293 SYKFPHLQNCVTVGESLL-PETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIKPGYM 351

Query: 271 IVEDQILVETVDPTTGEVLAPGETGELVYTTLCKKARPMIR-------FRTGDIGYVSTD 323
                     +    G VL PG  G++       +   +             +I      
Sbjct: 352 GTAASCYDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDFWL 411

Query: 324 TCECGRTLAR--IHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDGLTGEYSIRVYEKNFTC 381
             + G           GR D++       + PS++E  +     +     I   ++    
Sbjct: 412 LGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDRGEVV 471

Query: 382 KYEVSVE 388
           K  V + 
Sbjct: 472 KAFVVLA 478


>2d42A [x.x.x] NON-TOXIC CRYSTAL PROTEIN
          Length = 249

 Score = 39.5 bits (90), Expect = 2e-05
 Identities = 14/255 (5%), Positives = 35/255 (13%), Gaps = 37/255 (14%)

Query: 124 WQDTEARLFWQAGMRPNDRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVL 183
                     Q        Y    +                    I    V       VL
Sbjct: 5   LLRELEIYGMQYANSHQYTYGSSYSDDTNPIR------IAGLDARIPDPIVTDPVNHIVL 58

Query: 184 KQYQPTIIWTSPSYAWHLGEIAKEKGFDPKEDFNIHTIIVAGEAGGSIKSTREAIENLWG 243
            +   T   ++                          +       G   +     +    
Sbjct: 59  DRRIITNTTSNSLEGVF---SFSNAYTSRTSSQTRDGVTAGTNITGKYFANLFFEQVGLS 115

Query: 244 AKVVDFYGLSDIYGACAAACEAHDGLHIV-----------------------EDQILVET 280
            ++     +++       A +       +                         + +V  
Sbjct: 116 GRIAFEGAVTNENKYTLDATQDFRDSQTIRVPPFHRATGVYTLEQGAFEKMTVLECVVSG 175

Query: 281 VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLAR--IHVTG 338
                     P  +   +   +            G       +            I    
Sbjct: 176 NGIIRYYRTLPDNSYTEIVQRVNIIDVLQANGTPGFTISKEQN---RAYFTGEGTISGQI 232

Query: 339 RKDEMFIVGAVNVFP 353
                  V    +  
Sbjct: 233 GLQTFIDVVIEPLPG 247


>3c30A [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
          Length = 218

 Score = 37.2 bits (85), Expect = 9e-05
 Identities = 9/103 (8%), Positives = 20/103 (19%), Gaps = 17/103 (16%)

Query: 278 VETVDPTTGEVLAPGETGELVYTTLCK---------------KARPMIRFRTGDIGYVST 322
               D      L   +       +L                     +      D+ ++S+
Sbjct: 10  QSLFDFR-LAALRIHQDSTAKNASLINALVSRDSSRLDEFFSSVDELELSNAPDLRFISS 68

Query: 323 DTCECGRTLARIHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDG 365
                          G   +        V  S   ++V+    
Sbjct: 69  HDNILWDD-GNASFYGIAQQELNKLIRRVAISGNWHLVQTPSE 110


>2atwA [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
          Length = 223

 Score = 35.3 bits (80), Expect = 3e-04
 Identities = 9/99 (9%), Positives = 21/99 (21%), Gaps = 18/99 (18%)

Query: 285 TGEVLAPGETGELV---------YTTLCKKARPMIR----FRTGDIGYVSTDTCECGRTL 331
            GE++A     +                 KA   +        G+              +
Sbjct: 5   EGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGESYEHGNRLRCYVVGV 64

Query: 332 AR-----IHVTGRKDEMFIVGAVNVFPSDIEYVVRGLDG 365
            R     +    R     +    ++   +I      +  
Sbjct: 65  TRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVA 103


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.325    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0535    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 30,732,010
Number of extensions: 1907242
Number of successful extensions: 21338
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 9010
Number of HSP's successfully gapped: 713
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)