RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACV54491.1 elen0 ACV54491.1 GIB01015CH01 "transcriptional
regulator, LuxR family"
         (519 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cloA [x.x.x] TRANSCRIPTIONAL REGULATOR                                62   3e-12
3c57B [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN         62   4e-12
3c57A [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN         59   4e-11
3c3wA [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN         54   9e-10
3c3wB [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN         52   3e-09
1co0A [a.4.12] TRP OPERON REPRESSOR                                    50   2e-08
2d9sA [x.x.x] CBL E3 UBIQUITIN PROTEIN LIGASE                          49   3e-08
3clmA [x.x.x] TRANSALDOLASE                                            42   3e-06
3cloC [x.x.x] TRANSCRIPTIONAL REGULATOR                                39   3e-05
2dk5A [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA                   38   9e-05
1a04A [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEI...    37   1e-04
1dpuA [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN          37   1e-04
2efnA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL                  37   2e-04
2cg4A [x.x.x] REGULATORY PROTEIN ASNC                                  37   2e-04
2dvpA [x.x.x] HYPOTHETICAL PROTEIN PH1917                              36   3e-04
1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]                   35   4e-04
2dbbA [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR              34   8e-04
3cwoX [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY         34   8e-04

>3cloA [x.x.x] TRANSCRIPTIONAL REGULATOR
          Length = 249

 Score = 62.3 bits (150), Expect = 3e-12
 Identities = 21/58 (36%), Positives = 32/58 (55%)

Query: 454 QLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILNLVEQ 511
            L+ RE+EIL  + +G +++ IA TL I+ +T   H +NI  K+ V N  E     E 
Sbjct: 189 ILSEREKEILRCIRKGLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACRAAEL 246


>3c57B [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 49

 Score = 62.1 bits (151), Expect = 4e-12
 Identities = 14/49 (28%), Positives = 28/49 (57%)

Query: 456 TGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQE 504
           T +E  +L LL+ G T + IAD + + + T K ++  + AK+ +  + +
Sbjct: 1   TDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ 49


>3c57A [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 51

 Score = 58.6 bits (142), Expect = 4e-11
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 455 LTGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQE 504
           LT +E  +L LL+ G T + IAD + + + T K ++  + AK+ +  + +
Sbjct: 2   LTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ 51


>3c3wA [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 211

 Score = 54.0 bits (129), Expect = 9e-10
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 441 KLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVH 500
           KL+ A         LT +E  +L LL+ G T + IAD + + + T K ++  + AK+ + 
Sbjct: 136 KLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGME 195

Query: 501 NQQEILNLV 509
            + +     
Sbjct: 196 RRTQAAVFA 204


>3c3wB [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 210

 Score = 52.5 bits (125), Expect = 3e-09
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 441 KLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVH 500
           KL+ A         LT +E  +L LL+ G T + IAD + + + T K ++  + AK+ + 
Sbjct: 136 KLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGME 195

Query: 501 NQQEILNLV 509
            + +     
Sbjct: 196 RRTQAAVFA 204


>1co0A [a.4.12] TRP OPERON REPRESSOR
          Length = 105

 Score = 49.9 bits (119), Expect = 2e-08
 Identities = 8/58 (13%), Positives = 21/58 (36%), Gaps = 1/58 (1%)

Query: 454 QLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILNLVEQ 511
            L  R   +  LL    + + + + L    +T      ++     V  +Q +  ++ +
Sbjct: 47  ALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSL-KAAPVELRQWLEEVLLK 103


>2d9sA [x.x.x] CBL E3 UBIQUITIN PROTEIN LIGASE
          Length = 53

 Score = 49.0 bits (117), Expect = 3e-08
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 461 EILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHN 501
           EI  L+++G + Q I   LVI  +  +   +NI  +    +
Sbjct: 12  EIERLMSQGYSYQDIQKALVIAHNNIEMA-KNILREFSGPS 51


>3clmA [x.x.x] TRANSALDOLASE
          Length = 348

 Score = 42.2 bits (98), Expect = 3e-06
 Identities = 8/85 (9%), Positives = 20/85 (23%)

Query: 429 APDVHDALPHANKLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKT 488
                              A    ++      E   L A+G     +       ++ A  
Sbjct: 206 LDATLPDRLKGKTAIALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYP 265

Query: 489 HLRNIYAKMDVHNQQEILNLVEQTI 513
               + + + VH    + +   +  
Sbjct: 266 DTLYVDSLIGVHTVNTVPDATLKAF 290


>3cloC [x.x.x] TRANSCRIPTIONAL REGULATOR
          Length = 248

 Score = 39.2 bits (89), Expect = 3e-05
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 469 GRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILNLVEQ 511
           G +++ IA TL I+ +T   H +NI  K+ V N  E     E 
Sbjct: 203 GLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACRAAEL 245


>2dk5A [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
          Length = 91

 Score = 37.6 bits (87), Expect = 9e-05
 Identities = 4/43 (9%), Positives = 16/43 (37%), Gaps = 4/43 (9%)

Query: 454 QLTGREEEILVLLA----RGRTAQHIADTLVITQSTAKTHLRN 492
               +E+ +  ++     +G  ++ +     +  +     L+N
Sbjct: 17  GSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKN 59


>1a04A [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
           NARL
          Length = 205

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 31/47 (65%)

Query: 458 REEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQE 504
           RE +IL L+A+G   + IA  L IT+ST K H++++  KM + ++ E
Sbjct: 148 RERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVE 194


>1dpuA [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
          Length = 69

 Score = 36.8 bits (85), Expect = 1e-04
 Identities = 9/58 (15%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 453 YQLTGREEEILVLLAR-----GRTAQHIADTL-VITQSTAKTHLRNIYAKMDVHNQQE 504
             LT  + ++L L+       G   Q + + L  ++ S+ K  +  +  +  +++  +
Sbjct: 2   NGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVD 59


>2efnA [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
          Length = 150

 Score = 36.7 bits (84), Expect = 2e-04
 Identities = 9/63 (14%), Positives = 22/63 (34%), Gaps = 2/63 (3%)

Query: 455 LTGREEEILVLLARGR--TAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILNLVEQT 512
           +   +  IL +L      +   IA  + I ++T    ++ +     +      +N     
Sbjct: 1   MDEIDLRILKILQYNAKYSLDEIAREIRIPKATLSYRIKKLEKDGVIKGYYAYINPASLN 60

Query: 513 IDE 515
           +D 
Sbjct: 61  LDY 63


>2cg4A [x.x.x] REGULATORY PROTEIN ASNC
          Length = 149

 Score = 36.7 bits (84), Expect = 2e-04
 Identities = 6/57 (10%), Positives = 17/57 (29%), Gaps = 2/57 (3%)

Query: 453 YQLTGREEEILVLLARGR--TAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILN 507
           Y +   +  IL  L          +A    ++  T    +  +     +   +  ++
Sbjct: 1   YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVS 57


>2dvpA [x.x.x] HYPOTHETICAL PROTEIN PH1917
          Length = 184

 Score = 35.7 bits (81), Expect = 3e-04
 Identities = 5/77 (6%), Positives = 16/77 (20%), Gaps = 1/77 (1%)

Query: 430 PDVHDALPHANKLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKTH 489
             +   +       +         +  G        +     ++     + I +  A +H
Sbjct: 109 SVIGFYIDGKAYKFSGVTWGRISNEKRGTHGFGYDPIFIPEGSEKTFAEMTIEEKNALSH 168

Query: 490 LRNIYAKMDVHNQQEIL 506
                        +  L
Sbjct: 169 RGKALKAF-FEWLKVNL 184


>1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
          Length = 294

 Score = 35.5 bits (81), Expect = 4e-04
 Identities = 7/49 (14%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 454 QLTGREEEILVLLARGR--TAQHIADTLVITQSTAKTHLRNIYAKMDVH 500
           +      +++ LLA G   + + + +TL ++++    H++ +       
Sbjct: 1   KDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDV 49


>2dbbA [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
          Length = 146

 Score = 34.4 bits (78), Expect = 8e-04
 Identities = 8/56 (14%), Positives = 22/56 (39%), Gaps = 2/56 (3%)

Query: 454 QLTGREEEILVLLARGR--TAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILN 507
           +L   + +++ +L+     T + +AD L  T+      +  +     +     I +
Sbjct: 1   KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPD 56


>3cwoX [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
          Length = 236

 Score = 34.3 bits (78), Expect = 8e-04
 Identities = 10/60 (16%), Positives = 16/60 (26%)

Query: 456 TGREEEILVLLARGRTAQHIADTLVITQSTAKTHLRNIYAKMDVHNQQEILNLVEQTIDE 515
           TG      V+    R A  I  T +    T   +   +   +       I+        E
Sbjct: 127 TGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKME 186


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.327    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0407    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 38,319,872
Number of extensions: 2426520
Number of successful extensions: 24427
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 10491
Number of HSP's successfully gapped: 346
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)