RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACV55248.1 elen0 ACV55248.1 GIB01015CH01 "NADPH-dependent FMN
reductase"
         (187 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2d5iA [x.x.x] AZO REDUCTASE                                            90   4e-21
2b3dA [x.x.x] MODULATOR OF DRUG ACTIVITY B                             80   6e-18
3b6mA [x.x.x] FLAVOPROTEIN WRBA                                        78   2e-17
3b6mB [x.x.x] FLAVOPROTEIN WRBA                                        74   4e-16
3b6iA [x.x.x] FLAVOPROTEIN WRBA                                        71   3e-15
1dxqA [c.23.5] QUINONE REDUCTASE                                       69   8e-15
2b3dB [x.x.x] MODULATOR OF DRUG ACTIVITY B                             68   2e-14
2amjC [x.x.x] MODULATOR OF DRUG ACTIVITY B                             67   4e-14
3brcA [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION                    60   4e-12
3brcB [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION                    60   5e-12
3edoB [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN                   59   1e-11
3edoA [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN                   58   2e-11
2a5lB [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA                       55   1e-10
2amjD [x.x.x] MODULATOR OF DRUG ACTIVITY B                             55   2e-10
1d4aA [c.23.5] QUINONE REDUCTASE                                       54   4e-10
2amjB [x.x.x] MODULATOR OF DRUG ACTIVITY B                             47   5e-08
1aktA [x.x.x] FLAVODOXIN                                               46   9e-08
2a5lA [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA                       45   2e-07
2amjA [x.x.x] MODULATOR OF DRUG ACTIVITY B                             44   3e-07
2arkF [x.x.x] FLAVODOXIN                                               42   2e-06
2arkA [x.x.x] FLAVODOXIN                                               41   2e-06
2arkB [x.x.x] FLAVODOXIN                                               40   7e-06
2arkC [x.x.x] FLAVODOXIN                                               39   9e-06
3d7nA [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN                            38   2e-05

>2d5iA [x.x.x] AZO REDUCTASE
          Length = 200

 Score = 90.2 bits (223), Expect = 4e-21
 Identities = 33/195 (16%), Positives = 66/195 (33%), Gaps = 30/195 (15%)

Query: 2   KLLAIAGSLR-ENSYNRQLAEAAGALMREKHP--EVGYGILRWEDVPFMNQDI------- 51
           K+L +  S+    S + QL++      REKH   E+    L    +P ++ ++       
Sbjct: 2   KVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPS 61

Query: 52  -------EHPAPEAVMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEA- 103
                  +  A      +   ++  D + + +P YN  I   LKN  D ++R        
Sbjct: 62  DAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYT 121

Query: 104 -----QVLAEKPVALAGASIGMSG---ASHAQDQLVGMLSFLDAHVMNKPRLC----IPH 151
                 ++  K   +  +  G+            L   L F+    +           P 
Sbjct: 122 ENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPE 181

Query: 152 IATQADEQGRLKLES 166
           +A +A    +  ++S
Sbjct: 182 MAAKAQSDAKAAIDS 196


>2b3dA [x.x.x] MODULATOR OF DRUG ACTIVITY B
          Length = 193

 Score = 79.8 bits (196), Expect = 6e-18
 Identities = 19/161 (11%), Positives = 45/161 (27%), Gaps = 13/161 (8%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L I G+ +    N QL +    +      ++G+ +          + +   +   V  
Sbjct: 3   NILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDV----------RIVRADSDYDVKA 52

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             +    AD +    P +    P  +K  +D +            ++       +    S
Sbjct: 53  EVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTE--GHGTLYASDGRTRKDPSKKYGS 110

Query: 122 GASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRL 162
           G      + +  L++         +    H     D     
Sbjct: 111 GGLVQGKKYMLSLTWNAPMEAFTEKDQFFH-GVGVDGVYLP 150


>3b6mA [x.x.x] FLAVOPROTEIN WRBA
          Length = 188

 Score = 78.3 bits (192), Expect = 2e-17
 Identities = 24/188 (12%), Positives = 53/188 (28%), Gaps = 9/188 (4%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
           K+L +  S+  +      A A GA   +   EV    +     P + +        A + 
Sbjct: 2   KVLVLYYSMYGHIETMARAVAEGASKVDGA-EVVVKRVPETMPPQLFEKAGGKTQTAPVA 60

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             + + + D +   +P     + G ++  LD          +  L  K  ++  ++    
Sbjct: 61  TPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLW---ASGALYGKLASVFSSTGTGG 117

Query: 122 GASHAQDQLVGMLSFLDAHVMNKPRLCIP----HIATQADEQGRLKL-ESSAPYLEAQAD 176
           G           L+     ++               T A   G  +  +        Q +
Sbjct: 118 GQEQTITSTWTTLAHHGMVIVPIGYAAQGGTPYGATTIAGGDGSRQPSQEELSIARYQGE 177

Query: 177 AFVRFVER 184
                  +
Sbjct: 178 YVAGLAVK 185


>3b6mB [x.x.x] FLAVOPROTEIN WRBA
          Length = 189

 Score = 73.6 bits (180), Expect = 4e-16
 Identities = 23/183 (12%), Positives = 51/183 (27%), Gaps = 5/183 (2%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
           K+L +  S+  +      A A GA   +   EV    +     P + +        A + 
Sbjct: 2   KVLVLYYSMYGHIETMARAVAEGASKVDGA-EVVVKRVPETMPPQLFEKAGGKTQTAPVA 60

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             + + + D +   +P     + G ++  LD          +  L  K  ++  ++    
Sbjct: 61  TPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLW---ASGALYGKLASVFSSTGTGG 117

Query: 122 GASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRF 181
           G           L+     ++           T          + S    + +       
Sbjct: 118 GQEQTITSTWTTLAHHGMVIVPIG-YAAQEGGTPYGATTIAGGDGSRQPSQEELSIARYQ 176

Query: 182 VER 184
            E 
Sbjct: 177 GEY 179


>3b6iA [x.x.x] FLAVOPROTEIN WRBA
          Length = 197

 Score = 71.0 bits (173), Expect = 3e-15
 Identities = 21/130 (16%), Positives = 44/130 (33%), Gaps = 8/130 (6%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
           K+L +  S+  +      A A GA   +   EV    +     P + +        A + 
Sbjct: 2   KVLVLYYSMYGHIETMARAVAEGASKVDGA-EVVVKRVPETMPPQLFEKAGGKTQTAPVA 60

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             + + + D +   +P     + G ++  LD          +  L  K  ++       +
Sbjct: 61  TPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLW---ASGALYGKLASV----FSST 113

Query: 122 GASHAQDQLV 131
           G    Q+Q +
Sbjct: 114 GTGGGQEQTI 123


>1dxqA [c.23.5] QUINONE REDUCTASE
          Length = 273

 Score = 69.3 bits (168), Expect = 8e-15
 Identities = 15/119 (12%), Positives = 35/119 (29%), Gaps = 23/119 (19%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVG---YGILRWEDV-------------- 44
           + L +     + S+N  + EAA   ++++  EV       + +  +              
Sbjct: 4   RALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSK 63

Query: 45  ------PFMNQDIEHPAPEAVMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRP 97
                        E      ++   + +  AD +    P     +P  LK   + +   
Sbjct: 64  NFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVA 122


>2b3dB [x.x.x] MODULATOR OF DRUG ACTIVITY B
          Length = 191

 Score = 68.2 bits (166), Expect = 2e-14
 Identities = 18/141 (12%), Positives = 37/141 (26%), Gaps = 14/141 (9%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L I G+ +    N QL +    +      ++         V   +          V  
Sbjct: 3   NILIINGAKKFAHSNGQLNDTLTEVADGTLRDL---GHDVRIVRADSDY-------DVKA 52

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             +    AD +    P +    P  +K  +D +          + A             S
Sbjct: 53  EVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEG---HGTLYASDGRTDPSKK-YGS 108

Query: 122 GASHAQDQLVGMLSFLDAHVM 142
           G      + +  L++      
Sbjct: 109 GGLVQGKKYMLSLTWNAPMEA 129


>2amjC [x.x.x] MODULATOR OF DRUG ACTIVITY B
          Length = 171

 Score = 67.1 bits (163), Expect = 4e-14
 Identities = 22/188 (11%), Positives = 45/188 (23%), Gaps = 29/188 (15%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L I G+      N  L E A   +R+   +V              + +   +   V  
Sbjct: 2   NILIINGA---KQLNDTLTEVADGTLRDLGHDV--------------RIVRADSDYDVKA 44

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSA--------TEAQVLAEKPVAL 113
             +    AD +           P  +K  +D +                +  L +    L
Sbjct: 45  EVQNFLWADVVIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYASDKKYGSGGLVQGKKYL 102

Query: 114 AGASIGMSGASHAQDQLVGMLSFLDAHVMNKP--RLCIPHIATQADEQGRLKLESSAPYL 171
           +         +       G+         +K    L  P     A++  +  +       
Sbjct: 103 SLTWNAPEAFTEKDQFFHGVGVDGVYLPFHKANQFLGEPLPTFIANDVIKPDVPRYTEEY 162

Query: 172 EAQADAFV 179
                   
Sbjct: 163 RKHLVEIF 170


>3brcA [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
          Length = 148

 Score = 60.5 bits (146), Expect = 4e-12
 Identities = 15/144 (10%), Positives = 37/144 (25%), Gaps = 16/144 (11%)

Query: 12  ENSYNRQLAEAAGALMREKHP--EVGYGILRWEDVPFMNQDIEH------PAPEAVMRVR 63
           E+   +   E+A     ++             + +    + +              +   
Sbjct: 2   EDLIGKAYLESAE----DRRRGDRSEEVEAIRKYIRSARRTVVPNWNAEKVDAINDVLRS 57

Query: 64  EAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATE---AQVLAEKPVALAGASIGM 120
             +REA+ L   +   +   P   K L   +S            V     + +  +   +
Sbjct: 58  FNLREAEHLQFNTNWADLTRPAVTKALALDISGADLVIARGRLGVPGSGSLLVIDSRGRL 117

Query: 121 -SGASHAQDQLVGMLSFLDAHVMN 143
            S AS        +   + +    
Sbjct: 118 LSAASPPHVIHSEVREAVRSETHA 141


>3brcB [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
          Length = 149

 Score = 60.1 bits (145), Expect = 5e-12
 Identities = 13/134 (9%), Positives = 33/134 (24%), Gaps = 11/134 (8%)

Query: 13  NSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEH------PAPEAVMRVREAV 66
           +   +   E+A    R             + +    + +              +     +
Sbjct: 3   DLIGKAYLESAEDRRRGD--RSEEVEAIRKYIRSARRTVVPNWNAEKVDAINDVLRSFNL 60

Query: 67  READGLWLFSPEYNHAIPGPLKNLLDWLSRPVSA---TEAQVLAEKPVALAGASIGMSGA 123
           REA+ L   +   +   P   K L   +S            V     + +  +   +  A
Sbjct: 61  REAEHLQFNTNWADLTRPAVTKALALDISGADLVIARGRLGVPGSGSLLVIDSRGRLLSA 120

Query: 124 SHAQDQLVGMLSFL 137
           +     +   +   
Sbjct: 121 ASPPHVIHSEVREA 134


>3edoB [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
          Length = 146

 Score = 58.6 bits (141), Expect = 1e-11
 Identities = 16/147 (10%), Positives = 40/147 (27%), Gaps = 18/147 (12%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILR---WEDVPFMNQDIEHP--AP 56
           K L +  S   +   ++  +    +   +  EV               +  D        
Sbjct: 3   KTLILYYSW--SGETKKAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIQGNKDF 60

Query: 57  EAVMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGA 116
             +          D + + SP ++     P+K LLD  +             +  +   +
Sbjct: 61  PEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQKN----------YRGEVASFFTS 110

Query: 117 SIGMSGASHAQ-DQLVGMLSFLDAHVM 142
           +     A  +  ++    L+ +     
Sbjct: 111 AGTNHKAYVSHFNEWADGLNVIGVARD 137


>3edoA [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
          Length = 147

 Score = 57.9 bits (139), Expect = 2e-11
 Identities = 18/140 (12%), Positives = 42/140 (30%), Gaps = 19/140 (13%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDV-----PFMNQDIEHPAP 56
           K L +  S       ++  +    +   +  EV      ++         ++Q   +   
Sbjct: 4   KTLILYYSWS--GETKKAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIQGNKDF 61

Query: 57  EAVMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGA 116
             +          D + + SP ++     P+K LLD  +             +  +   +
Sbjct: 62  PEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQKN----------YRGEVASFFTS 111

Query: 117 SIGMSGA--SHAQDQLVGML 134
           +     A  SH  +   G+ 
Sbjct: 112 AGTNHKAYVSHFNEWADGLN 131


>2a5lB [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
          Length = 171

 Score = 55.4 bits (133), Expect = 1e-10
 Identities = 22/121 (18%), Positives = 36/121 (29%), Gaps = 19/121 (15%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L +  S          A      + +                   + +   + EA+  
Sbjct: 3   YILVLYYSR---HGATAEARQIARGVEQ------------GGFEARVRTVPAVSTEALYA 47

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             E ++   GL L SP        PLK  LD  S          L  KP A+  ++  + 
Sbjct: 48  TLEDLKNCAGLALGSPTRF-GNASPLKYFLDGTSSLW---LTGSLVGKPAAVFTSTASLH 103

Query: 122 G 122
           G
Sbjct: 104 G 104


>2amjD [x.x.x] MODULATOR OF DRUG ACTIVITY B
          Length = 171

 Score = 54.9 bits (131), Expect = 2e-10
 Identities = 18/189 (9%), Positives = 38/189 (20%), Gaps = 33/189 (17%)

Query: 1   MKLLAIAGSLRENSYN--RQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEA 58
             +L I G+  +             G  +R                          +   
Sbjct: 5   SNILIINGAKNDTLTEVADGTLRDLGHDVRIVRA---------------------DSDYD 43

Query: 59  VMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSA------TEAQVLAEKPVA 112
           V    +    AD +           P  +K  +D +              +  L +    
Sbjct: 44  VKAEVQNFLWADVVIW--QPGWWGAPWTVKKYIDDVFTEGHGTLYASKYGSGGLVQGKKY 101

Query: 113 LAGASIGMSGASHAQDQLVGMLSFLDAHVMNKP--RLCIPHIATQADEQGRLKLESSAPY 170
           L+         +       G+         +K    L  P     A++  +  +      
Sbjct: 102 LSLTWNAPEAFTEKDQFFHGVGVDGVYLPFHKANQFLGEPLPTFIANDVIKPDVPRYTEE 161

Query: 171 LEAQADAFV 179
                    
Sbjct: 162 YRKHLVEIF 170


>1d4aA [c.23.5] QUINONE REDUCTASE
          Length = 273

 Score = 53.9 bits (129), Expect = 4e-10
 Identities = 26/174 (14%), Positives = 56/174 (32%), Gaps = 32/174 (18%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGY---------GILRWEDVPFMNQDIE 52
           + L +       S+N  + EAA A +++K  EV            I+  +D+    +D  
Sbjct: 4   RALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPA 63

Query: 53  HPAPEA--------------VMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRP- 97
           +    A              ++  ++ +  AD +    P     +P  LK   + +    
Sbjct: 64  NFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGE 123

Query: 98  -----VSATEAQVLAEKPVAL---AGASIGMSGASHAQDQLVGMLSFLDAHVMN 143
                 +  +      K   L    G S  M         +  +L  + + +++
Sbjct: 124 FAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILH 177


>2amjB [x.x.x] MODULATOR OF DRUG ACTIVITY B
          Length = 178

 Score = 46.8 bits (110), Expect = 5e-08
 Identities = 19/192 (9%), Positives = 49/192 (25%), Gaps = 31/192 (16%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L I G+      N  L E A   +R+   +               + +   +   V  
Sbjct: 6   NILIINGANG--QLNDTLTEVADGTLRDLGHD--------------VRIVRADSDYDVKA 49

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             +    AD +      +    P  +K  +D +          + A       G+   + 
Sbjct: 50  EVQNFLWADVVIWQPGWWGA--PWTVKKYIDDVFTEG---HGTLYASDGRTKYGSGGLVQ 104

Query: 122 GASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQ---------ADEQGRLKLESSAPYLE 172
           G  +         +F +        + +  +                  +  +   P + 
Sbjct: 105 GKKYLSLTWNAPEAFTEKDQFF-HGVGVDGVYLPFHKANQFLGEPLPTFIANDVIKPDVP 163

Query: 173 AQADAFVRFVER 184
              + + + +  
Sbjct: 164 RYTEEYRKHLVE 175


>1aktA [x.x.x] FLAVODOXIN
          Length = 147

 Score = 45.9 bits (108), Expect = 9e-08
 Identities = 21/145 (14%), Positives = 36/145 (24%), Gaps = 25/145 (17%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
           K L + GS   N+     AE     + +                +     +  + EA   
Sbjct: 2   KALIVYGSTTGNT--EYTAETIARELADAG--------------YEVDSRDAASVEAGG- 44

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
                   D + L    +N        + +          E      + VA  G      
Sbjct: 45  ---LFEGFDLVLLGCSTWNDDSIELQDDFIPLFDSL----EETGAQGRKVACFGCGDSSY 97

Query: 122 G-ASHAQDQLVGMLSFLDAHVMNKP 145
                A D +   L  L A ++   
Sbjct: 98  EYFCGAVDAIEEKLKNLGAEIVQDG 122


>2a5lA [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
          Length = 167

 Score = 44.6 bits (105), Expect = 2e-07
 Identities = 27/136 (19%), Positives = 38/136 (27%), Gaps = 25/136 (18%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L +  S          A      + +   E                     A  A + 
Sbjct: 3   YILVLYYSR---HGATAEARQIARGVEQGGFEA----------RVRTVPAVSTALYATL- 48

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
             E ++   GL L SP        PLK  LD  S          L  KP A+  ++  + 
Sbjct: 49  --EDLKNCAGLALGSPTRFG-NASPLKYFLDGTSSLW---LTGSLVGKPAAVFTSTASLH 102

Query: 122 GASHAQDQLVGMLSFL 137
           G      Q    LS L
Sbjct: 103 G-----GQETTQLSLL 113


>2amjA [x.x.x] MODULATOR OF DRUG ACTIVITY B
          Length = 174

 Score = 44.4 bits (104), Expect = 3e-07
 Identities = 20/187 (10%), Positives = 46/187 (24%), Gaps = 22/187 (11%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
            +L I G+      N  L E A   +R+   +               + +   +   V  
Sbjct: 3   NILIINGAKG--QLNDTLTEVADGTLRDLGHD--------------VRIVRADSDYDVKA 46

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSA--TEAQVLAEKPVALAGASIG 119
             +    AD +           P  +K  +D +          +         L      
Sbjct: 47  EVQNFLWADVVI--WQPGWWGAPWTVKKYIDDVFTEGHGTLYASDGRKYGSGGLVQGKKY 104

Query: 120 MSGASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQ--ADEQGRLKLESSAPYLEAQADA 177
           +S   +A +       F     ++   L                +  +   P +    + 
Sbjct: 105 LSLTWNAPEAFTEKDQFFHGVGVDGVYLPFHKANQFLGEPLPTFIANDVIKPDVPRYTEE 164

Query: 178 FVRFVER 184
           + + +  
Sbjct: 165 YRKHLVE 171


>2arkF [x.x.x] FLAVODOXIN
          Length = 178

 Score = 41.6 bits (97), Expect = 2e-06
 Identities = 26/183 (14%), Positives = 48/183 (26%), Gaps = 27/183 (14%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
           K+L I  +   N+  ++    A      +  EV     R + V    ++           
Sbjct: 3   KVLVIYDTRTGNT--KKAELVAEGARSLEGTEV-----RLKHVDEATKE----------- 44

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
               V  ADGL + SP     +    +   D L           +  K      +S G  
Sbjct: 45  ---DVLWADGLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWG 95

Query: 122 GASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRF 181
           G +     ++ +        +         +   A   G  + E               +
Sbjct: 96  GGNEVACSILTLNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEW 155

Query: 182 VER 184
           V  
Sbjct: 156 VAI 158


>2arkA [x.x.x] FLAVODOXIN
          Length = 180

 Score = 41.3 bits (96), Expect = 2e-06
 Identities = 18/121 (14%), Positives = 31/121 (25%), Gaps = 6/121 (4%)

Query: 64  EAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGA 123
           E V  ADGL + SP     +    +   D L           +  K      +S G  G 
Sbjct: 46  EDVLWADGLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWGGG 99

Query: 124 SHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVE 183
           +     ++ +        +         +   A   G  + E               +V 
Sbjct: 100 NEVACSILTLNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVA 159

Query: 184 R 184
            
Sbjct: 160 I 160


>2arkB [x.x.x] FLAVODOXIN
          Length = 179

 Score = 39.7 bits (92), Expect = 7e-06
 Identities = 18/121 (14%), Positives = 31/121 (25%), Gaps = 6/121 (4%)

Query: 64  EAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGA 123
           E V  ADGL + SP     +    +   D L           +  K      +S G  G 
Sbjct: 45  EDVLWADGLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWGGG 98

Query: 124 SHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVE 183
           +     ++ +        +         +   A   G  + E               +V 
Sbjct: 99  NEVACSILTLNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVA 158

Query: 184 R 184
            
Sbjct: 159 I 159


>2arkC [x.x.x] FLAVODOXIN
          Length = 179

 Score = 39.3 bits (91), Expect = 9e-06
 Identities = 26/183 (14%), Positives = 48/183 (26%), Gaps = 27/183 (14%)

Query: 2   KLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMR 61
           K+L I  +   N+  ++    A      +  EV     R + V    ++           
Sbjct: 3   KVLVIYDTRTGNT--KKAELVAEGARSLEGTEV-----RLKHVDEATKE----------- 44

Query: 62  VREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMS 121
               V  ADGL + SP     +    +   D L           +  K      +S G  
Sbjct: 45  ---DVLWADGLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWG 95

Query: 122 GASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRF 181
           G +     ++ +        +         +   A   G  + E               +
Sbjct: 96  GGNEVACSILTLNFGFLVFGVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEW 155

Query: 182 VER 184
           V  
Sbjct: 156 VAI 158


>3d7nA [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
          Length = 153

 Score = 38.3 bits (88), Expect = 2e-05
 Identities = 15/106 (14%), Positives = 30/106 (28%), Gaps = 5/106 (4%)

Query: 56  PEAVMRVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAG 115
                    A+  AD +   +P Y        K   D  S+P  + +     +K      
Sbjct: 36  GNLSEDGWAALDAADAIIFGTPTYG-GPSWQFKKFADASSKPWFSAK---WQDKVFGGFT 91

Query: 116 ASIGMSGASHAQ-DQLVGMLSFLDAHVMNKPRLCIPHIATQADEQG 160
            S  ++G        LV +        ++   +      +  D + 
Sbjct: 92  NSASLNGDKLNTLQYLVLLAGQHGGLWVSLGYIAPAQSESVGDLET 137


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.134    0.420 

Gapped
Lambda     K      H
   0.267   0.0522    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 23,713,169
Number of extensions: 1516293
Number of successful extensions: 16649
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8113
Number of HSP's successfully gapped: 275
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.7 bits)