RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACV55893.1 elen0 ACV55893.1 GIB01015CH01 "trigger factor"
         (501 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2d3o1 [x.x.x] TRIGGER FACTOR                                           84   7e-19
3chxA [x.x.x] PMOB[MASQUE : MEMB(X) 46 / COIL(x) 0]                    40   2e-05
1bl4A [d.26.1] PROTEIN (FK506 BINDING PROTEIN)                         39   3e-05
1bkfA [x.x.x] FK506 BINDING PROTEIN                                    38   5e-05
2dg9A [x.x.x] FK506-BINDING PROTEIN 1A                                 38   6e-05
1c9hA [d.26.1] FKBP12.6                                                38   8e-05
2dg4A [x.x.x] FK506-BINDING PROTEIN 1A                                 37   1e-04
2d9fA [x.x.x] FK506-BINDING PROTEIN 8 VARIANT                          36   2e-04

>2d3o1 [x.x.x] TRIGGER FACTOR
          Length = 100

 Score = 84.4 bits (209), Expect = 7e-19
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 2/101 (1%)

Query: 17  NRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVRATVTDD 76
           N+ +  V+V AA+++    + +   A     PGFR GKAPR +I+N +G   V + V D 
Sbjct: 1   NKVEFKVSVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVIENRVGKGYVESQVRDR 60

Query: 77  VVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTV 117
           ++   Y   + +  L        D  D+ ++G+ + F+   
Sbjct: 61  LLETHYSQGLRELGLNL-VDATVDPQDV-QSGQAFEFTVKG 99


>3chxA [x.x.x] PMOB[MASQUE : MEMB(X) 46 / COIL(x) 0]
          Length = 362

 Score = 39.9 bits (93), Expect = 2e-05
 Identities = 4/102 (3%), Positives = 15/102 (14%), Gaps = 6/102 (5%)

Query: 136 PAEGTTDAEIDEQIDALREHYYSFED----ASAATKVKEDSYIDLAMKATDDKGEEIPSL 191
           P      A + + +  +                   ++       A        +   + 
Sbjct: 227 PRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTK 286

Query: 192 TTENRPYG--LGANLFPAEFDEQLVGLKKGQTATFTLDMPAD 231
                  G             + +    +             
Sbjct: 287 DYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLA 328


>1bl4A [d.26.1] PROTEIN (FK506 BINDING PROTEIN)
          Length = 107

 Score = 39.1 bits (91), Expect = 3e-05
 Identities = 12/67 (17%), Positives = 24/67 (35%), Gaps = 2/67 (2%)

Query: 167 KVKEDSYIDLAMKATDDKGEEIPSLTTENRPYG--LGANLFPAEFDEQLVGLKKGQTATF 224
             K      +      + G+++ S    N+P+   LG       ++E +  +  GQ A  
Sbjct: 15  FPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKL 74

Query: 225 TLDMPAD 231
           T+     
Sbjct: 75  TISPDYA 81


>1bkfA [x.x.x] FK506 BINDING PROTEIN
          Length = 107

 Score = 38.4 bits (89), Expect = 5e-05
 Identities = 12/62 (19%), Positives = 24/62 (38%), Gaps = 2/62 (3%)

Query: 167 KVKEDSYIDLAMKATDDKGEEIPSLTTENRPYG--LGANLFPAEFDEQLVGLKKGQTATF 224
             K      +      + G++  S   +N+P+   LG       ++E +  +  GQ A  
Sbjct: 15  FPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKL 74

Query: 225 TL 226
           T+
Sbjct: 75  TI 76


>2dg9A [x.x.x] FK506-BINDING PROTEIN 1A
          Length = 107

 Score = 38.0 bits (88), Expect = 6e-05
 Identities = 12/67 (17%), Positives = 22/67 (32%), Gaps = 2/67 (2%)

Query: 167 KVKEDSYIDLAMKATDDKGEEIPSLTTENRPYG--LGANLFPAEFDEQLVGLKKGQTATF 224
             K      +      + G++  S    N+P+   LG        +E +  +  GQ A  
Sbjct: 15  FPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGLEEGVAQMSVGQRAKL 74

Query: 225 TLDMPAD 231
           T+     
Sbjct: 75  TISPDYA 81


>1c9hA [d.26.1] FKBP12.6
          Length = 107

 Score = 37.6 bits (87), Expect = 8e-05
 Identities = 12/62 (19%), Positives = 21/62 (33%), Gaps = 2/62 (3%)

Query: 167 KVKEDSYIDLAMKATDDKGEEIPSLTTENRPYG--LGANLFPAEFDEQLVGLKKGQTATF 224
             K+     +        G++  S    N+P+   +G       F+E    +  GQ A  
Sbjct: 15  FPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKL 74

Query: 225 TL 226
           T 
Sbjct: 75  TC 76


>2dg4A [x.x.x] FK506-BINDING PROTEIN 1A
          Length = 107

 Score = 36.8 bits (85), Expect = 1e-04
 Identities = 13/62 (20%), Positives = 23/62 (37%), Gaps = 2/62 (3%)

Query: 167 KVKEDSYIDLAMKATDDKGEEIPSLTTENRPYG--LGANLFPAEFDEQLVGLKKGQTATF 224
             K      +      + G++  S    N+P+   LG       F+E +  +  GQ A  
Sbjct: 15  FPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKL 74

Query: 225 TL 226
           T+
Sbjct: 75  TI 76


>2d9fA [x.x.x] FK506-BINDING PROTEIN 8 VARIANT
          Length = 135

 Score = 36.1 bits (83), Expect = 2e-04
 Identities = 12/92 (13%), Positives = 31/92 (33%), Gaps = 6/92 (6%)

Query: 139 GTTDAEIDEQIDALREHYYSFEDASAAT----KVKEDSYIDLAMKATDDKGEEIPSLTTE 194
           G++ +  +E +D L       +          +  +   + + ++ + + G  +      
Sbjct: 1   GSSGSSGEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQE--EP 58

Query: 195 NRPYGLGANLFPAEFDEQLVGLKKGQTATFTL 226
              + LG        D  +  +  G+TA  T 
Sbjct: 59  ELVFTLGDCDVIQALDLSVPLMDVGETAMVTA 90


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.138    0.383 

Gapped
Lambda     K      H
   0.267   0.0436    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,231,768
Number of extensions: 1568636
Number of successful extensions: 17657
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8527
Number of HSP's successfully gapped: 461
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)