RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ACV55525.1 elen0 ACV55525.1 GIB01015CH01 "isoleucyl-tRNA
synthetase"
         (948 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00133 tRNA-synt_1 "tRNA synthetases class I (I, L, M and V)"        535   e-155
PF08264 Anticodon_1 "Anticodon-binding domain"                         96   8e-23
PF09334 tRNA-synt_1g "tRNA synthetases class I (M)"                    67   4e-14
PF01406 tRNA-synt_1e "tRNA synthetases class I (C) catalytic dom...    49   8e-09
PF10139 Virul_Fac "Putative bacterial virulence factor"                34   2e-04
PF01921 tRNA-synt_1f "tRNA synthetases class I (K)"                    34   3e-04

>PF00133 tRNA-synt_1 "tRNA synthetases class I (I, L, M and V)"
          Length = 593

 Score =  535 bits (1379), Expect = e-155
 Identities = 285/630 (45%), Positives = 386/630 (61%), Gaps = 49/630 (7%)

Query: 32  KWEEEHIYEQVLEKNKDGKP-FILHDGPPYANGPIHIGHAFNKILKDFVNKSHAQRGFFT 90
           +WEE  I+E    K   GKP F++HDGPPYANG +HIGHA N  +KD + +    +G+  
Sbjct: 5   RWEENGIFEASARK---GKPKFVIHDGPPYANGSLHIGHALNYTIKDIIARYKRMQGYNV 61

Query: 91  PYVPGWDCHGQPIEHMVEKTLGPDKMAKIDQPTLRRLCREWAEKYVDVQREGFKRLGVNA 150
            Y PGWDCHG PIE  VEK LG  K   + +   R  CREWAE+Y+   RE  KRLG++ 
Sbjct: 62  LYPPGWDCHGLPIELKVEKKLGI-KGGDLGREEFREKCREWAEEYIGEIREQLKRLGLSV 120

Query: 151 DWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSP 210
           DW+  Y T  PNYEA    VF ++Y  G +YRG++P++WC  C TALA+AE+EY +  SP
Sbjct: 121 DWDREYFTMDPNYEAAVQWVFVKLYEKGLIYRGKRPVNWCPVCGTALADAEVEYKEVKSP 180

Query: 211 SIFVKFKMDIMPGMFETAGAAGD-AYVLIWTTTPWTLPANTAVSLAPDADYVMVQADGSN 269
           S++VKF +           A GD  Y+++WTT P TLP NTAV++ PD +YV+ + DG  
Sbjct: 181 SVYVKFPL-----------ADGDEVYLVVWTTRPETLPGNTAVAVHPDIEYVL-EKDGEK 228

Query: 270 MIMARELVEQVAEIAGWESYDLVRGEDGEPVALKGREFTGLTYTCPVRQDLKGTIIYGDH 329
           +I+A  LVE++A+        L+   D      KG++  G TY  P+    +  +I  D+
Sbjct: 229 LILAEALVEKLAK-------KLLELADE-----KGKDLVGKTYIHPLT-GREIPVIAADY 275

Query: 330 VTLDSGTGAVHTAPGHGQDDYLVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVI 389
           VT+D GTGAVH AP H +DDY V     +P++  VD++G  T+EAG FAGLDV EA   I
Sbjct: 276 VTMDFGTGAVHIAPAHDEDDYEVGKRHGLPIINVVDEDGRFTEEAGEFAGLDVFEARKAI 335

Query: 390 IEWLRERGTLVAQKEILHSYPHCWRCHEPVIFRATDQWFVSMDKNSLRENALKAIENDVE 449
           +E L+E+G L+  ++  HSYPHCWR   P+I R TDQWFV +DK  L+E AL+A+E +V 
Sbjct: 336 VEDLKEKGLLLKIEKYEHSYPHCWRSKTPIIPRLTDQWFVKVDK--LKERALEAVE-EVN 392

Query: 450 WIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCGSTVAN--EQTFDAVIDLFY 507
           W+P     R  + + +  DWCISRQR WG PIPV+ C   G  +    E+   A ++   
Sbjct: 393 WVPESGEKRFENWLENLRDWCISRQRYWGTPIPVWYCEDGGEVLVGSVEELVAARVE--- 449

Query: 508 REGADAWFTREPSEYLPRGVKCETCGCTELTPEKDILDVWWESGVSHTSVLK---HREAE 564
            EGADAW  R   + LP+       G  EL  + D+LD W++SG    + L     RE  
Sbjct: 450 EEGADAWLHRPAIDLLPK-------GGGELRRDTDVLDTWFDSGSWPFATLGWPFEREEF 502

Query: 565 GLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNG 624
              +PAD+Y+EGSDQ RGWF SSL+ S   +G  P+K V+  G  +D +GRKMSKSLGN 
Sbjct: 503 EYFYPADLYVEGSDQIRGWFASSLMLSTALFGKAPFKNVLTHGLVLDEDGRKMSKSLGNV 562

Query: 625 VDPAEVMAKSGADVLRLWVASVDYSQDVSI 654
           VDP +V+ K GAD LRLW+AS D  +D+ +
Sbjct: 563 VDPLDVIDKYGADALRLWLASSDPGRDIGL 592


>PF08264 Anticodon_1 "Anticodon-binding domain"
          Length = 153

 Score = 95.6 bits (237), Expect = 8e-23
 Identities = 54/160 (33%), Positives = 87/160 (54%), Gaps = 15/160 (9%)

Query: 700 DQWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPR 759
           D+W + R    +  V+ AY+ Y+F+   RA+ ++  NDL   Y+D TK  L ++  DS +
Sbjct: 1   DRWILSRLNETIKKVTEAYENYRFNTALRAIMEFFWNDLCNWYIDETKPWLLAKDEDS-K 59

Query: 760 RRAVQTVLMNILEVLVRVLAPVLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFA 819
           RR+ QTVL  +LE L+R+LAP L FT +E+W    Q + E  G+  +V LA WP+     
Sbjct: 60  RRSAQTVLYEVLEALLRLLAPFLPFTAEEIW----QQLEELLGKEESVHLAPWPE----- 110

Query: 820 PAIPADGERVSEDFGVIMGVREVVTKALEDARGQKVVNKS 859
                D E + E+    + + + V +A+   R +K +  S
Sbjct: 111 -----DPEELDEELEAEVELLKDVVQAIRKLRAEKNIPPS 145


>PF09334 tRNA-synt_1g "tRNA synthetases class I (M)"
          Length = 363

 Score = 66.6 bits (162), Expect = 4e-14
 Identities = 44/146 (30%), Positives = 71/146 (48%), Gaps = 18/146 (12%)

Query: 59  PYANGPIHIGHAFNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKT-LGPDKMA 117
           PYANG  H+GHA+  I  D + +    RG+   ++ G D HG PIE   EK  + P    
Sbjct: 8   PYANGKPHLGHAYTYIAADVLARYQRLRGYDVLFLTGTDEHGTPIELKAEKEGITP---- 63

Query: 118 KIDQPTLRRLCREWAEKYVDVQREGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLD 177
                      +E  +KY    +E FK+ G++ D  +   T +P ++    E+F R+Y +
Sbjct: 64  -----------QELVDKYHAEFKELFKKFGISFD--NFIRTTSPEHKELVQEIFLRLYEN 110

Query: 178 GSVYRGRKPIHWCKRCHTALAEAEIE 203
           G +Y+G     +C    T L + ++E
Sbjct: 111 GDIYKGEYEQWYCPSDETFLPDRQVE 136



 Score = 45.0 bits (106), Expect = 1e-07
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 546 VWWESGVSHTSVLKHR-EAEGL-RFPADMY-LEGSDQHRGWFQSSLLTSM-GAYGVP-PY 600
           VW+++ + + S L +  + E   +F AD+Y   G D  R  F +    +M  A G+P P 
Sbjct: 228 VWFDALIGYISALGYLCDGEDFDKFWADLYHFIGKDIVR--FHTIYWPAMLMALGLPLPK 285

Query: 601 KAVMHCGFTVDGEGRKMSKSLGNGVDPAEVMAKSGADVLRLWV 643
           K   H   TV  EG KMSKS GN VDP +++ + GAD LR ++
Sbjct: 286 KVFAHGFLTV--EGGKMSKSRGNVVDPDDLLDRYGADALRYYL 326


>PF01406 tRNA-synt_1e "tRNA synthetases class I (C) catalytic
           domain"
          Length = 300

 Score = 48.9 bits (116), Expect = 8e-09
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 585 QSSLLTSMGAYGVPPYKAVMHCGF-TVDGEGRKMSKSLGNGVDPAEVMAKSGADVLRLWV 643
           ++ +  S  A G P     MH GF T+DGE  KMSKSLGN +   +++ K   +VLRL++
Sbjct: 222 ENEIAQSEAATGKPFANYWMHNGFLTIDGE--KMSKSLGNFITIRDLLKKYDPEVLRLFL 279

Query: 644 ASVDYSQDVSISDEILQRTS 663
            S  Y   ++ S+E L+  +
Sbjct: 280 LSTHYRSPLNFSEEALEEAA 299


>PF10139 Virul_Fac "Putative bacterial virulence factor"
          Length = 772

 Score = 34.3 bits (78), Expect = 2e-04
 Identities = 34/138 (24%), Positives = 61/138 (44%), Gaps = 6/138 (4%)

Query: 737 DLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNILEVLVRVLAPVLSFTTDEVWEHYPQA 796
           D++ +  +A  +    E PDSP      T  +  L+ L R   PV   T D+V + +   
Sbjct: 121 DIAKILANAFFNDFDQEKPDSPLDEEQITAHLEQLQGL-RQPQPVPGLTEDDVVDLWDYL 179

Query: 797 MRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVREVVTK-ALEDARGQKV 855
            R        ++   WP+A++ AP +  D    +E F ++ G    +T+  L  A   + 
Sbjct: 180 ERHFGKAQKELEDHYWPEAAELAPYLSIDDR--AELFSLLWGENPELTQLYLHLAHALQA 237

Query: 856 VNKSQEAAVVVTA--PRA 871
           +  ++E    ++A  PRA
Sbjct: 238 LGHAEEVYAPLSALVPRA 255


>PF01921 tRNA-synt_1f "tRNA synthetases class I (K)"
          Length = 354

 Score = 33.9 bits (77), Expect = 3e-04
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 2/98 (2%)

Query: 576 GSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNGVDPAEVMAKSG 635
           G D   G +  S   +    G PP   V      +D  G+KMS S GNG+ P E +  + 
Sbjct: 239 GKDHSSGSYDVSKEIAEILGGEPPEGFVYE--LFLDKGGQKMSSSKGNGITPDEWLEYAP 296

Query: 636 ADVLRLWVASVDYSQDVSISDEILQRTSEAYRRIRNTF 673
            + LR  +A     +   +  +++ R  + Y R+   +
Sbjct: 297 PESLRFLMARYKPKKAKRLYFDVIPRLVDEYDRLERKY 334


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.135    0.423 

Gapped
Lambda     K      H
   0.267   0.0551    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 17,825,141
Number of extensions: 1020585
Number of successful extensions: 129227
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2573
Number of HSP's successfully gapped: 196
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)