RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ACV55893.1 elen0 ACV55893.1 GIB01015CH01 "trigger factor"
         (501 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF05697 Trigger_N "Bacterial trigger factor protein (TF)"              89   2e-20
PF05698 Trigger_C "Bacterial trigger factor protein (TF) C-termi...    60   8e-12

>PF05697 Trigger_N "Bacterial trigger factor protein (TF)"
          Length = 146

 Score = 88.7 bits (219), Expect = 2e-20
 Identities = 54/146 (36%), Positives = 85/146 (58%), Gaps = 1/146 (0%)

Query: 7   VETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGA 66
           ++  VE LE  + K+TV V A +I+  + K  K  A K   PGFRKGK PR II+   G 
Sbjct: 1   MQVTVEKLEGLKVKLTVEVPAEEIEKAVDKALKKLAKKVKIPGFRKGKVPRSIIEKRYGK 60

Query: 67  EAVRATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVKPEIEIS 126
            AVRA   ++++   Y  A+ + +L P+ +PE +  +  E G+   F+ TV V PE+E+ 
Sbjct: 61  SAVRAEALNELLQEAYEEAVKEENLRPVGQPEIEPKEF-EPGEDLEFTATVEVYPEVELG 119

Query: 127 SYEPVEIELPAEGTTDAEIDEQIDAL 152
            Y+ +E+E P    TD ++DE+++ L
Sbjct: 120 DYKGLEVEKPVVEVTDEDVDEELERL 145


>PF05698 Trigger_C "Bacterial trigger factor protein (TF)
           C-terminus"
          Length = 161

 Score = 59.8 bits (144), Expect = 8e-12
 Identities = 47/156 (30%), Positives = 81/156 (51%), Gaps = 3/156 (1%)

Query: 277 VEDLRARIAESVTSQKADMMPRLKENACLYALAERVEGDVPEAMLEDAEASLIQDFFQQL 336
           +E+L+A+I E++  +K     +  +NA L AL E  E D+PEA++E     L++ F QQL
Sbjct: 1   LEELKAKIKENLEEEKEQAADQKLKNAVLDALVENTEIDLPEALVEQEIDRLLEQFEQQL 60

Query: 337 QSQGMTFDVYLAQQGITPDQFKEDVKKQAEDMSKQDLALDAWARHFGMXXXXXXXXXXXX 396
           Q QG+  + YL   G T ++ +E+ ++QAE   K  L L+  A+   +            
Sbjct: 61  QQQGLDLEQYLQFTGTTEEELREEFEEQAEKRVKLGLILEEIAKKEKIEVTDEEVKAEIE 120

Query: 397 KSGVE---DPAALEAEWRSNGQLHMVRQGVIRTKAV 429
           +   +   DP  ++   + NGQL  ++  ++  KAV
Sbjct: 121 EMAKQYGMDPEEVKEFLKKNGQLDELKADILEEKAV 156


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.323    0.138    0.383 

Gapped
Lambda     K      H
   0.267   0.0579    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,699,001
Number of extensions: 832026
Number of successful extensions: 107076
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2081
Number of HSP's successfully gapped: 252
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)