RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACV54068.1 elen0 ACV54068.1 GIB01015CH01 "transcriptional
regulator, BadM/Rrf2 family"
         (158 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1f6vA [a.49.1.1] DNA TRANSPOSITION PROTEIN                             45   1e-07
2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89                            45   1e-07
2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167 ...    42   9e-07
1qbjA [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE       41   2e-06
1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108             40   3e-06
1xd7A [a.4.5.55] YWNA                                                  37   3e-05
1oyiA [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN                   36   5e-05
2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73        35   1e-04
1q1hA [a.4.5.41] TRANSCRIPTION FACTOR E                                33   4e-04
1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220      33   4e-04
1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75             33   6e-04
2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 -- 93    32   0.001
1o57A1 [a.4.5.40] PUR OPERON REPRESSOR A:2 -- 74                       32   0.001

>1f6vA [a.49.1.1] DNA TRANSPOSITION PROTEIN
          Length = 91

 Score = 44.9 bits (106), Expect = 1e-07
 Identities = 15/80 (18%), Positives = 23/80 (28%), Gaps = 14/80 (17%)

Query: 10 GMRAILYLAAQ-GTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKD 68
          G R     A         K IA+   I  +  ++L Q +           K G  R+   
Sbjct: 1  GSRIAKRTAINKTKKADVKAIADAWQINGEKELELLQQIA---------QKPGALRILNH 51

Query: 69 P----ADTNVLEIMEALDDD 84
               A T   +     +D 
Sbjct: 52 SLRLAAMTAHGKGERVNEDY 71


>2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
          Length = 89

 Score = 44.6 bits (105), Expect = 1e-07
 Identities = 12/87 (13%), Positives = 23/87 (26%)

Query: 1  MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKH 60
          M  K  ++   R  + L       S + IA D+ I R  L        +   ++      
Sbjct: 1  MPTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSA 60

Query: 61 GGYRLAKDPADTNVLEIMEALDDDAKQ 87
                +         +  A      +
Sbjct: 61 AVSEAEQIRQLKKENALQRARTRHPAE 87


>2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
          -- 257
          Length = 91

 Score = 41.9 bits (98), Expect = 9e-07
 Identities = 13/68 (19%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 12 RAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPAD 71
               L        +  IA+ + I R  ++   + L +AG+IE+R     G  +     +
Sbjct: 23 HIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIK-VLNN 81

Query: 72 TNVLEIME 79
            ++E+  
Sbjct: 82 KFLIELEN 89


>1qbjA [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
          Length = 65

 Score = 40.9 bits (96), Expect = 2e-06
 Identities = 8/55 (14%), Positives = 23/55 (41%)

Query: 12 RAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLA 66
             L    +G   ++ D++  +  P+  + ++   L   G ++   G    +++A
Sbjct: 11 LKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA 65


>1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
          Length = 101

 Score = 40.0 bits (93), Expect = 3e-06
 Identities = 10/67 (14%), Positives = 20/67 (29%), Gaps = 3/67 (4%)

Query: 6  STDYGMRAILYLAAQGTTCSSKDIAEDMSIPR---DYLIQLAQLLRNAGIIEARPGKHGG 62
               M     +   G   S  ++   + +P      + +L + L + G  E    +   
Sbjct: 27 KWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEES 86

Query: 63 YRLAKDP 69
          Y L    
Sbjct: 87 YALTVAS 93


>1xd7A [a.4.5.55] YWNA
          Length = 116

 Score = 36.6 bits (84), Expect = 3e-05
 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 1/102 (0%)

Query: 13  AILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPADT 72
            IL L +     SS+ IA+ ++     + ++  LL+ A I+ +R G   G  L KDPAD 
Sbjct: 8   HILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGV-PGASLKKDPADI 66

Query: 73  NVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEE 114
           ++LE+  A+  + K     K             + + + +  
Sbjct: 67  SLLEVYRAVQKNPKCPVGKKIQNALDETFESVQRAMENELAS 108


>1oyiA [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
          Length = 62

 Score = 36.0 bits (83), Expect = 5e-05
 Identities = 1/42 (2%), Positives = 17/42 (40%)

Query: 25 SSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLA 66
          ++  +   +++ +  + +    L+ + ++ +       + + 
Sbjct: 20 TAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMT 61


>2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
          Length = 73

 Score = 34.5 bits (79), Expect = 1e-04
 Identities = 11/56 (19%), Positives = 21/56 (37%)

Query: 12 RAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAK 67
            IL    +     + +IAE +++          LL  AG+++  P + G      
Sbjct: 3  NEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYWF 58


>1q1hA [a.4.5.41] TRANSCRIPTION FACTOR E
          Length = 85

 Score = 33.2 bits (76), Expect = 4e-04
 Identities = 10/52 (19%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 20 QGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPAD 71
          +GT  + ++IA  ++I  + + +   LL   G +  R  +  G+ +     +
Sbjct: 30 KGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTR-SGWFIYYWKPN 80


>1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
          Length = 73

 Score = 32.9 bits (75), Expect = 4e-04
 Identities = 7/57 (12%), Positives = 15/57 (26%), Gaps = 2/57 (3%)

Query: 12 RAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKD 68
                  +       D+A  +   R  + +    L++ G+IE              
Sbjct: 16 HCEKPQGEKTFKVKXDDLARCLDDTRLNISKTLNELQDNGLIELHRK--EILIPDAQ 70


>1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
          Length = 75

 Score = 32.5 bits (74), Expect = 6e-04
 Identities = 7/60 (11%), Positives = 18/60 (30%), Gaps = 2/60 (3%)

Query: 6  STDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRL 65
          +       + ++       S  +IAE  ++      +   +L   G +  +      Y  
Sbjct: 3  TLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD--KRYVP 60


>2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
          93
          Length = 69

 Score = 31.8 bits (72), Expect = 0.001
 Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%)

Query: 14 ILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAK 67
          I      G   S  DI   + + R+ + +  Q+L    ++        G  +  
Sbjct: 16 IDGTFRPGARLSEPDICAALDVSRNTVREAFQILIEDRLVAHELN--RGVFVRV 67


>1o57A1 [a.4.5.40] PUR OPERON REPRESSOR A:2 -- 74
          Length = 73

 Score = 31.7 bits (72), Expect = 0.001
 Identities = 12/67 (17%), Positives = 18/67 (26%), Gaps = 10/67 (14%)

Query: 11 MRAILYLAAQ--GTTCSSKDIAE-----DMSIPRDYLIQLAQLLRNAGI--IEARPGKHG 61
          +  +                 +E       SI  D L  + Q     GI  +   PG  G
Sbjct: 8  LVDLTNYLLTHPHELIPLTFFSERYESAKSSISED-LTIIKQTFEQQGIGTLLTVPGAAG 66

Query: 62 GYRLAKD 68
          G +    
Sbjct: 67 GVKYIPK 73


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.315    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0524    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 14,139,641
Number of extensions: 973307
Number of successful extensions: 5025
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4750
Number of HSP's successfully gapped: 361
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)