RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACV55075.1 elen0 ACV55075.1 GIB01015CH01 "translation
elongation factor Ts"
         (286 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1aipC2 [d.43.1.1] ELONGATION FACTOR TS C:54 -- 196                    121   8e-31
1xb2B3 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:223 -- 331     85   9e-20
1xb2B1 [a.5.2.2] ELONGATION FACTOR TS, MITOCHONDRIAL B:56 -- 111       81   2e-18
1aipC1 [a.5.2.2] ELONGATION FACTOR TS C:2 -- 53                        79   5e-18
1xb2B2 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:112 -- 222     76   5e-17
1efuB4 [d.43.1.1] ELONGATION FACTOR TS B:55 -- 139                     74   2e-16
2di0A1 [a.5.2.4] ACTIVATING SIGNAL COINTEGRATOR 1 COMPLEX SUBUNI...    58   1e-11
1vegA [a.5.2.1] NEDD8 ULTIMATE BUSTER-1                                56   6e-11
2bwbA1 [a.5.2.1] UBIQUITIN-LIKE PROTEIN DSK2 A:328 -- 371              53   5e-10
1wj7A1 [a.5.2.1] HYPOTHETICAL PROTEIN (RSGI RUH-015) A:8 -- 98         53   6e-10
2cp8A1 [a.5.2.1] NEXT TO BRCA1 GENE 1 PROTEIN A:8 -- 48                52   1e-09
1v92A [a.5.2.3] NSFL1 COFACTOR P47                                     51   2e-09
1wglA [a.5.2.4] TOLL-INTERACTING PROTEIN                               51   2e-09
2dahA1 [a.5.2.1] UBIQUILIN-3 A:8 -- 48                                 48   1e-08
1wgnA [a.5.2.1] UBIQUITIN ASSOCIATED PROTEIN                           48   2e-08
2g3qA1 [a.5.2.1] PROTEIN YBL047C A:1339 -- 1381                        44   3e-07

>1aipC2 [d.43.1.1] ELONGATION FACTOR TS C:54 -- 196
          Length = 143

 Score =  121 bits (306), Expect = 8e-31
 Identities = 46/141 (32%), Positives = 68/141 (48%), Gaps = 1/141 (0%)

Query: 146 VEGGAVSSYIHGGGKIGVLVQFDVEGIDPAS-DGFKQFGRDXXXXXXXXXXXXXTRESVD 204
              G +  YIH   ++GVLV+ + E    A  + F+   +D             + E + 
Sbjct: 2   AREGIIGHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSAEEIP 61

Query: 205 PAIVEHEKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAA 264
              +E E+ IY+  A   GKP+ I EK+A GRL+K+ +E  L EQPFVK+    V E   
Sbjct: 62  AEELEKERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQ 121

Query: 265 EVAKNLGGEIKIVDFKRFVLG 285
           +    +G  I +  F RF LG
Sbjct: 122 QAIAKIGENIVVRRFCRFELG 142



 Score = 41.7 bits (98), Expect = 1e-06
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 57  TNEGTVMAIVSDDATSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKP 107
             EG +   +  +   G +VELNCETDFV  N+ F+  A+ +A       P
Sbjct: 2   AREGIIGHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNP 52


>1xb2B3 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:223 -- 331
          Length = 109

 Score = 85.2 bits (211), Expect = 9e-20
 Identities = 21/139 (15%), Positives = 40/139 (28%), Gaps = 31/139 (22%)

Query: 148 GGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFKQFGRDXXXXXXXXXXXXXTRESVDPAI 207
           G  V SY+HG      L                  G+                  +   +
Sbjct: 1   GFYVGSYVHGAMHSPSLHNL-------------VLGKYGALVICE-------TSELKANL 40

Query: 208 VEHEKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVA 267
            +  + +       +       +    G       E+ +  QP++ +P  ++ +Y     
Sbjct: 41  ADLGRRLGQHVVGMAPLSVGSLDDEPGGE-----AETKMLSQPYLLDPSITLGQYVQP-- 93

Query: 268 KNLGGEIKIVDFKRFVLGE 286
                 + +VDF RF  GE
Sbjct: 94  ----HGVSVVDFVRFECGE 108


>1xb2B1 [a.5.2.2] ELONGATION FACTOR TS, MITOCHONDRIAL B:56 -- 111
          Length = 56

 Score = 80.6 bits (199), Expect = 2e-18
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 2  AAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGR 55
          +A +  ++ +LR  TG   + CKKAL    G++ QA   L  +       KA R
Sbjct: 1  SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAAR 54


>1aipC1 [a.5.2.2] ELONGATION FACTOR TS C:2 -- 53
          Length = 52

 Score = 79.3 bits (196), Expect = 5e-18
 Identities = 25/50 (50%), Positives = 35/50 (70%)

Query: 6  ASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGR 55
            ++K+LRE TGAGMM+ K+AL +A  + ++AV +LR RG    AKKA R
Sbjct: 3  MELIKKLREATGAGMMDVKRALEDAGWDEEKAVQLLRERGAMKAAKKADR 52


>1xb2B2 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:112 -- 222
          Length = 111

 Score = 76.0 bits (187), Expect = 5e-17
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 18/113 (15%)

Query: 54  GRATNEGTVMAIVSDDATSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKP------ 107
           GR T EG +  +   +  +  +VE+NCETDFV  N KF+   +++A   L          
Sbjct: 1   GRKTKEGLIGLLQ--EGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQL 58

Query: 108 ----------XXXXXXXXXXXXGETVEAVVTDAIHTLGENIQLARFAVVEGGA 150
                                   +++  +  AI  LGEN+ L R A V+  A
Sbjct: 59  STYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVPA 111



 Score = 35.6 bits (82), Expect = 7e-05
 Identities = 9/59 (15%), Positives = 19/59 (32%)

Query: 227 AIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFKRFVLG 285
              +   +   + F   S L+E P     + S+ +  A     LG  + +       + 
Sbjct: 52  QNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVP 110


>1efuB4 [d.43.1.1] ELONGATION FACTOR TS B:55 -- 139
          Length = 85

 Score = 74.4 bits (183), Expect = 2e-16
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 57  TNEGTVMAIVSDDATSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPXXXXXXXXX 116
             +G +   +  +   G ++E+NC+TDFV  +  F+A+A+K+  AA+A K          
Sbjct: 2   AADGVIKTKIDGN--YGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKI------TDV 53

Query: 117 XXXGETVEAVVTDAIHTLGENIQLARFAVVEG 148
                  E      +  +GENI + R A +EG
Sbjct: 54  EVLKAQFEEERVALVAKIGENINIRRVAALEG 85


>2di0A1 [a.5.2.4] ACTIVATING SIGNAL COINTEGRATOR 1 COMPLEX SUBUNIT
          A:8 -- 70
          Length = 63

 Score = 58.3 bits (141), Expect = 1e-11
 Identities = 7/60 (11%), Positives = 21/60 (35%), Gaps = 1/60 (1%)

Query: 2  AAVTASMVKELREMTG-AGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEG 60
               S++ +++++    G       L     + +Q ++ +    LA    +  R  +  
Sbjct: 3  GVELDSLISQVKDLLPDLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDRE 62


>1vegA [a.5.2.1] NEDD8 ULTIMATE BUSTER-1
          Length = 83

 Score = 55.8 bits (134), Expect = 6e-11
 Identities = 11/57 (19%), Positives = 19/57 (33%), Gaps = 1/57 (1%)

Query: 4  VTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEG 60
           +   + +L  M G   +  + AL    GN+  A   L   G +          + G
Sbjct: 28 PSQESINQLVYM-GFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSGPSSG 83


>2bwbA1 [a.5.2.1] UBIQUITIN-LIKE PROTEIN DSK2 A:328 -- 371
          Length = 44

 Score = 52.8 bits (127), Expect = 5e-10
 Identities = 8/39 (20%), Positives = 16/39 (41%)

Query: 3  AVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVL 41
                +++L +M          AL  + G++  A+D L
Sbjct: 3  ERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 41


>1wj7A1 [a.5.2.1] HYPOTHETICAL PROTEIN (RSGI RUH-015) A:8 -- 98
          Length = 91

 Score = 52.6 bits (126), Expect = 6e-10
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 8  MVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKA 53
           VK+L ++TG    EC  AL + +G++++A++VL        + + 
Sbjct: 35 KVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEM 80


>2cp8A1 [a.5.2.1] NEXT TO BRCA1 GENE 1 PROTEIN A:8 -- 48
          Length = 41

 Score = 51.6 bits (124), Expect = 1e-09
 Identities = 10/37 (27%), Positives = 16/37 (43%)

Query: 6  ASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLR 42
          A+++  L EM         + L + + NI Q V  L 
Sbjct: 3  AALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELL 39


>1v92A [a.5.2.3] NSFL1 COFACTOR P47
          Length = 46

 Score = 50.9 bits (122), Expect = 2e-09
 Identities = 9/42 (21%), Positives = 16/42 (38%)

Query: 1  MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLR 42
          MA      ++E   +TGA     +  L  A  ++  A+    
Sbjct: 1  MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFY 42


>1wglA [a.5.2.4] TOLL-INTERACTING PROTEIN
          Length = 59

 Score = 50.6 bits (121), Expect = 2e-09
 Identities = 10/49 (20%), Positives = 18/49 (36%), Gaps = 1/49 (2%)

Query: 7  SMVKELREMT-GAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAG 54
            +K +++M         +  L    GN D A++ L   G       +G
Sbjct: 11 EDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG 59


>2dahA1 [a.5.2.1] UBIQUILIN-3 A:8 -- 48
          Length = 41

 Score = 48.1 bits (115), Expect = 1e-08
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 6  ASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLR 42
             +++LR M         +AL+   G++D AV+ LR
Sbjct: 3  QVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLR 39


>1wgnA [a.5.2.1] UBIQUITIN ASSOCIATED PROTEIN
          Length = 63

 Score = 47.6 bits (113), Expect = 2e-08
 Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 1/47 (2%)

Query: 1  MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLA 47
          ++      V+ +  M G       +A+ +   NI+Q +D L      
Sbjct: 15 LSPSERQCVETVVNM-GYSYECVLRAMKKKGENIEQILDYLFAHSGP 60


>2g3qA1 [a.5.2.1] PROTEIN YBL047C A:1339 -- 1381
          Length = 43

 Score = 43.5 bits (103), Expect = 3e-07
 Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 4  VTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLR 42
            +  V+EL  M G    E   AL + + +++ A + L 
Sbjct: 3  PKSLAVEELSGM-GFTEEEAHNALEKCNWDLEAATNFLL 40


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.314    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0490    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 10,720,321
Number of extensions: 726878
Number of successful extensions: 3677
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 3491
Number of HSP's successfully gapped: 152
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)