BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACD30267.1 ftul2 tmk GIB00719CH01 "thymidylate kinase"
         (209 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

4tmkA [c.37.1] PROTEIN (THYMIDYLATE KINASE)                           158   2e-41
2ccgA [x.x.x] THYMIDYLATE KINASE                                      111   2e-27
2cckB [x.x.x] THYMIDYLATE KINASE                                      110   5e-27
2cckA [x.x.x] THYMIDYLATE KINASE                                      109   6e-27
2ccjA [x.x.x] THYMIDYLATE KINASE                                      109   8e-27
2ccgB [x.x.x] THYMIDYLATE KINASE                                      109   8e-27
2ccjB [x.x.x] THYMIDYLATE KINASE                                      108   1e-26
3hjnB [x.x.x] THYMIDYLATE KINASE                                      107   2e-26
3hjnA [x.x.x] THYMIDYLATE KINASE                                      107   2e-26
2z0hA [x.x.x] THYMIDYLATE KINASE                                      105   9e-26
2pbrA [x.x.x] THYMIDYLATE KINASE                                       98   2e-23
2z0hB [x.x.x] THYMIDYLATE KINASE                                       94   5e-22
2plrB [x.x.x] PROBABLE THYMIDYLATE KINASE                              59   1e-11
2plrA [x.x.x] PROBABLE THYMIDYLATE KINASE                              59   2e-11
1e9dA [c.37.1] THYMIDYLATE KINASE                                      56   8e-11
1e9cA [c.37.1] THYMIDYLATE KINASE                                      56   8e-11
1e9fA [c.37.1] THYMIDYLATE KINASE                                      56   1e-10
1e2gA [c.37.1] THYMIDYLATE KINASE                                      55   1e-10
1e2fA [c.37.1] THYMIDYLATE KINASE                                      55   2e-10
1e2dA [c.37.1] THYMIDYLATE KINASE                                      55   2e-10
3tmkE [c.37.1] THYMIDYLATE KINASE                                      54   4e-10
3tmkD [c.37.1] THYMIDYLATE KINASE                                      54   4e-10
3tmkA [c.37.1] THYMIDYLATE KINASE                                      54   4e-10
1e98A [c.37.1] THYMIDYLATE KINASE                                      54   5e-10
1tmkA [c.37.1] THYMIDYLATE KINASE                                      53   9e-10
1nn5A [c.37.1] SIMILAR TO DEOXYTHYMIDYLATE KINASE (THYMIDYLATE         53   9e-10
3tmkC [c.37.1] THYMIDYLATE KINASE                                      50   6e-09
2v54B [x.x.x] THYMIDYLATE KINASE                                       49   1e-08
2v54A [x.x.x] THYMIDYLATE KINASE                                       49   1e-08

>4tmkA [c.37.1] PROTEIN (THYMIDYLATE KINASE)
          Length = 210

 Score =  158 bits (399), Expect = 2e-41
 Identities = 88/195 (45%), Positives = 125/195 (64%), Gaps = 3/195 (1%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLA-AIYTREPGGTKIAEELRNLVLHNKY-- 58
           +SK+IVIEGL+GAGK+TA + V + LE+  +   ++TREPGGT++AE+LR+L+L  K   
Sbjct: 1   RSKYIVIEGLEGAGKTTARNVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLLLDIKSVG 60

Query: 59  DEEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIR 118
           DE I   +E+LM YA RVQ    +I PAL  G  V+ DR   S+ AYQGGGRG++   + 
Sbjct: 61  DEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLA 120

Query: 119 ALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDS 178
            L D  L    PDL +YLD+ P +GL+RA+  G  DRIE+   +FFN+TR  + +L    
Sbjct: 121 TLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQD 180

Query: 179 DNAIEIDAAKSIQEV 193
            +   IDA + ++ V
Sbjct: 181 KSIHTIDATQPLEAV 195


>2ccgA [x.x.x] THYMIDYLATE KINASE
          Length = 202

 Score =  111 bits (277), Expect = 2e-27
 Identities = 70/204 (34%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 3   SKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
           S FI  EG +G+GK+T I+ V   L K+    I TREPGG    EE+R +VL    D +I
Sbjct: 1   SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDI 58

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
            +  E ++  A R +H    + PAL++G  V+ DR+  SS+AYQG  RG+ + ++RALN+
Sbjct: 59  RT--EAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE 116

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVG-SPDRIEKAGLEFFNKTRKVFKDLV-KDSDN 180
             +NG  PDL IYL++   +G +R  K     +R+++  L+F  K  + +++++  +S  
Sbjct: 117 FAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNESQR 176

Query: 181 AIEIDAAKSIQEVEKQIYLILDKH 204
              ++A + ++ V +  Y  + K+
Sbjct: 177 FKSVNADQPLENVVEDTYQTIIKY 200


>2cckB [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score =  110 bits (274), Expect = 5e-27
 Identities = 68/202 (33%), Positives = 115/202 (56%), Gaps = 13/202 (6%)

Query: 3   SKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
           S FI  EG +G+GK+T I+ V   L K+    I TREPGG    EE+R +VL    D   
Sbjct: 1   SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGDMDIR- 58

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
              +E ++  A R +H    + PAL++G  V+ DR+  SS+AYQG  RG+ + ++RALN+
Sbjct: 59  ---TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE 115

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAI 182
             +NG  PDL IYL++   +G +R  K    +R+++  L+F  K  + ++++++      
Sbjct: 116 FAINGLYPDLTIYLNVSAEVGRERIIK----NRLDQEDLKFHEKVIEGYQEIIRFK---- 167

Query: 183 EIDAAKSIQEVEKQIYLILDKH 204
            ++A + ++ V +  Y  + K+
Sbjct: 168 SVNADQPLENVVEDTYQTIIKY 189


>2cckA [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score =  109 bits (273), Expect = 6e-27
 Identities = 68/202 (33%), Positives = 116/202 (57%), Gaps = 13/202 (6%)

Query: 3   SKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
           S FI  EG +G+GK+T I+ V   L K+    I TREPGG    EE+R +VL     E++
Sbjct: 1   SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVL-----EDM 54

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
              +E ++  A R +H    + PAL++G  V+ DR+  SS+AYQG  RG+ + ++RALN+
Sbjct: 55  DIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE 114

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAI 182
             +NG  PDL IYL++   +G +R  K     R+++  L+F  K  + ++++++      
Sbjct: 115 FAINGLYPDLTIYLNVSAEVGRERIIK---NSRLDQEDLKFHEKVIEGYQEIIRFK---- 167

Query: 183 EIDAAKSIQEVEKQIYLILDKH 204
            ++A + ++ V +  Y  + K+
Sbjct: 168 SVNADQPLENVVEDTYQTIIKY 189


>2ccjA [x.x.x] THYMIDYLATE KINASE
          Length = 196

 Score =  109 bits (272), Expect = 8e-27
 Identities = 69/202 (34%), Positives = 118/202 (58%), Gaps = 9/202 (4%)

Query: 3   SKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
           S FI  EG +G+GK+T I+ V   L K+    I TREPGG    EE+R +VL    D +I
Sbjct: 1   SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDI 58

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
            +  E ++  A R +H    + PAL++G  V+ DR+  SS+AYQG  RG+ + ++RALN+
Sbjct: 59  RT--EAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE 116

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAI 182
             +NG  PDL IYL++   +G +R  K  + +R+++  L+F  K  + +++++    +  
Sbjct: 117 FAINGLYPDLTIYLNVSAEVGRERIIK--NSNRLDQEDLKFHEKVIEGYQEIIHRFKS-- 172

Query: 183 EIDAAKSIQEVEKQIYLILDKH 204
            ++A + ++ V +  Y  + K+
Sbjct: 173 -VNADQPLENVVEDTYQTIIKY 193


>2ccgB [x.x.x] THYMIDYLATE KINASE
          Length = 199

 Score =  109 bits (272), Expect = 8e-27
 Identities = 69/203 (33%), Positives = 117/203 (57%), Gaps = 9/203 (4%)

Query: 3   SKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
           S FI  EG +G+GK+T I+ V   L K+    I TREPGG    EE+R +VL    D +I
Sbjct: 2   SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDI 59

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
            +  E ++  A R +H    + PAL++G  V+ DR+  SS+AYQG  RG+ + ++RALN+
Sbjct: 60  RT--EAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE 117

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLV-KDSDNA 181
             +NG  PDL IYL++   +G +R  K    + +++  L+F  K  + +++++  +S   
Sbjct: 118 FAINGLYPDLTIYLNVSAEVGRERIIK----NSLDQEDLKFHEKVIEGYQEIIHNESQRF 173

Query: 182 IEIDAAKSIQEVEKQIYLILDKH 204
             ++A + ++ V +  Y  + K+
Sbjct: 174 KSVNADQPLENVVEDTYQTIIKY 196


>2ccjB [x.x.x] THYMIDYLATE KINASE
          Length = 195

 Score =  108 bits (271), Expect = 1e-26
 Identities = 69/202 (34%), Positives = 118/202 (58%), Gaps = 10/202 (4%)

Query: 3   SKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
           S FI  EG +G+GK+T I+ V   L K+    I TREPGG    EE+R +VL    D +I
Sbjct: 1   SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDI 58

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
            +  E ++  A R +H    + PAL++G  V+ DR+  SS+AYQG  RG+ + ++RALN+
Sbjct: 59  RT--EAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE 116

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAI 182
             +NG  PDL IYL++   +G +R  K    +R+++  L+F  K  + ++++++   +  
Sbjct: 117 FAINGLYPDLTIYLNVSAEVGRERIIK---NNRLDQEDLKFHEKVIEGYQEIIQRFKS-- 171

Query: 183 EIDAAKSIQEVEKQIYLILDKH 204
            ++A + ++ V +  Y  + K+
Sbjct: 172 -VNADQPLENVVEDTYQTIIKY 192


>3hjnB [x.x.x] THYMIDYLATE KINASE
          Length = 184

 Score =  107 bits (268), Expect = 2e-26
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 23/198 (11%)

Query: 5   FIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHS 64
           FI  EG+DG+GKST I  + +YLEK     I  REPGGT+  E++R ++L    +EE+  
Sbjct: 2   FITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILL----EEEVTP 57

Query: 65  DSELLMIYAGRVQHYRNL----IAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRAL 120
            +EL +  A      RNL    I   L +G  V+ DR+  SS+AYQG GR +    +  L
Sbjct: 58  KAELFLFLAS-----RNLLVTEIKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEEL 112

Query: 121 NDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKD-SD 179
           ND   +G  PDL  Y+D+D    L+R       +R EK   EF  + R+ +  L ++  +
Sbjct: 113 NDFATDGLIPDLTFYIDVDVETALKR-------NRFEKR--EFLERVREGYLVLAREHPE 163

Query: 180 NAIEIDAAKSIQEVEKQI 197
             + +D  +SI+E+ + +
Sbjct: 164 RIVVLDGKRSIEEIHRDV 181


>3hjnA [x.x.x] THYMIDYLATE KINASE
          Length = 189

 Score =  107 bits (268), Expect = 2e-26
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 22/198 (11%)

Query: 5   FIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHS 64
           FI  EG+DG+GKST I  + +YLEK     I  REPGGT+  E++R ++L    +EE+  
Sbjct: 2   FITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILL----EEEVTP 57

Query: 65  DSELLMIYAGRVQHYRNL----IAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRAL 120
            +EL +  A      RNL    I   L +G  V+ DR+  SS+AYQG GR +    +  L
Sbjct: 58  KAELFLFLAS-----RNLLVTEIKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEEL 112

Query: 121 NDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKD-SD 179
           ND   +G  PDL  Y+D+D    L+R       +R EK   EF  + R+ +  L ++  +
Sbjct: 113 NDFATDGLIPDLTFYIDVDVETALKR------KNRFEKR--EFLERVREGYLVLAREHPE 164

Query: 180 NAIEIDAAKSIQEVEKQI 197
             + +D  +SI+E+ + +
Sbjct: 165 RIVVLDGKRSIEEIHRDV 182


>2z0hA [x.x.x] THYMIDYLATE KINASE
          Length = 184

 Score =  105 bits (263), Expect = 9e-26
 Identities = 67/194 (34%), Positives = 107/194 (55%), Gaps = 19/194 (9%)

Query: 5   FIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHS 64
           FI  EG+DG+GKST I  + +YLEK     I  REPGGT+  E++R ++L    +EE+  
Sbjct: 2   FITFEGIDGSGKSTQIQLLAQYLEKRG-KVILKREPGGTETGEKIRKILL----EEEVTP 56

Query: 65  DSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNF 124
            +EL +  A R     NL+   +++   V+ DR+  SS+AYQG GR +    +  LND  
Sbjct: 57  KAELFLFLASR-----NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFA 111

Query: 125 LNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKD-SDNAIE 183
            +G  PDL  Y+D+D    L+R       +R EK   EF  + R+ +  L ++  +  + 
Sbjct: 112 TDGLIPDLTFYIDVDVETALKR------KNRFEKR--EFLERVREGYLVLAREHPERIVV 163

Query: 184 IDAAKSIQEVEKQI 197
           +D  +SI+E+ + +
Sbjct: 164 LDGKRSIEEIHRDV 177


>2pbrA [x.x.x] THYMIDYLATE KINASE
          Length = 195

 Score = 97.8 bits (242), Expect = 2e-23
 Identities = 63/192 (32%), Positives = 99/192 (51%), Gaps = 9/192 (4%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           I  EG+DG+GK+T    + +YL++        REPGGTK+ E    +             
Sbjct: 3   IAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGE----VXXXXXXXXXXXXX 58

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
                  A R +     I P L++   V+ DRF  S++AYQG G+G+++  I+ LN+   
Sbjct: 59  XXXXXXXASRSKLIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKGLDVEFIKNLNEFAT 118

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEID 185
            G +PD+ + LDI   + L+R ++    +R E    EF  K RK F +L K+ +N + ID
Sbjct: 119 RGVKPDITLLLDIPVDIALRRLKE---KNRFENK--EFLEKVRKGFLELAKEEENVVVID 173

Query: 186 AAKSIQEVEKQI 197
           A+   +EV K+I
Sbjct: 174 ASGEEEEVFKEI 185


>2z0hB [x.x.x] THYMIDYLATE KINASE
          Length = 175

 Score = 93.6 bits (231), Expect = 5e-22
 Identities = 54/135 (40%), Positives = 79/135 (58%), Gaps = 12/135 (8%)

Query: 5   FIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHS 64
           FI  EG+DG+GKST I  + +YLEK     I  REPGGT+  E++R ++L    +EE+  
Sbjct: 1   FITFEGIDGSGKSTQIQLLAQYLEKK---VILKREPGGTETGEKIRKILL----EEEVTP 53

Query: 65  DSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNF 124
            +EL +  A R     NL+   +++   V+ DR+  SS+AYQG GR +    +  LND  
Sbjct: 54  KAELFLFLASR-----NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFA 108

Query: 125 LNGCEPDLVIYLDID 139
            +G  PDL  Y+D+D
Sbjct: 109 TDGLIPDLTFYIDVD 123


>2plrB [x.x.x] PROBABLE THYMIDYLATE KINASE
          Length = 207

 Score = 58.9 bits (141), Expect = 1e-11
 Identities = 50/205 (24%), Positives = 99/205 (48%), Gaps = 27/205 (13%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           I  EG+DG+GKS+  + ++ ++E      +Y  E      ++ + +++   K  + +   
Sbjct: 5   IAFEGIDGSGKSSQATLLKDWIELKR--DVYLTE------SDWIHDIIKEAKKKDLLTPL 56

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
           +  L+        Y   I P L+ G  V+SDR+ +++ A +   RGV++  ++ L   + 
Sbjct: 57  TFSLIHATDFSDRYERYILP-LKSGFIVISDRYIYTAYA-RDSVRGVDIDWVKKL---YS 111

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFF-------------NKTRKVFK 172
              +PD+  Y+ + P + L+R +K     + ++AG + F                 +V+ 
Sbjct: 112 FAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYD 171

Query: 173 DLVKDSDNAIEIDAAKSIQEVEKQI 197
            LVKD +N I ID  K+ +E++ QI
Sbjct: 172 KLVKD-ENFIVIDGTKTPKEIQIQI 195


>2plrA [x.x.x] PROBABLE THYMIDYLATE KINASE
          Length = 211

 Score = 58.5 bits (140), Expect = 2e-11
 Identities = 50/205 (24%), Positives = 99/205 (48%), Gaps = 24/205 (11%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           I  EG+DG+GKS+  + ++ ++E      +Y  E   +   + + +++   K  + +   
Sbjct: 6   IAFEGIDGSGKSSQATLLKDWIELKR--DVYLTEWNSS---DWIHDIIKEAKKKDLLTPL 60

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
           +  L+        Y   I P L+ G  V+SDR+ +++ A +   RGV++  ++ L   + 
Sbjct: 61  TFSLIHATDFSDRYERYILP-LKSGFIVISDRYIYTAYA-RDSVRGVDIDWVKKL---YS 115

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFF-------------NKTRKVFK 172
              +PD+  Y+ + P + L+R +K     + ++AG + F                 +V+ 
Sbjct: 116 FAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYD 175

Query: 173 DLVKDSDNAIEIDAAKSIQEVEKQI 197
            LVKD +N I ID  K+ +E++ QI
Sbjct: 176 KLVKD-ENFIVIDGTKTPKEIQIQI 199


>1e9dA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 56.2 bits (134), Expect = 8e-11
 Identities = 56/196 (28%), Positives = 91/196 (46%), Gaps = 11/196 (5%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 7   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 65

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +AY G      L   +  +   +
Sbjct: 66  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPD---V 120

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L     L L  A K G+          F  +  + F  L+KD+  N   +
Sbjct: 121 GLPKPDLVLFLQ----LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMV 176

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 177 DASKSIEAVHEDIRVL 192


>1e9cA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score = 56.2 bits (134), Expect = 8e-11
 Identities = 56/196 (28%), Positives = 91/196 (46%), Gaps = 11/196 (5%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 6   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 64

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +AY G      L   +  +   +
Sbjct: 65  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPD---V 119

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L     L L  A K G+          F  +  + F  L+KD+  N   +
Sbjct: 120 GLPKPDLVLFLQ----LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMV 175

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 176 DASKSIEAVHEDIRVL 191


>1e9fA [c.37.1] THYMIDYLATE KINASE
          Length = 202

 Score = 55.8 bits (133), Expect = 1e-10
 Identities = 54/196 (27%), Positives = 91/196 (46%), Gaps = 18/196 (9%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+DGAGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 6   IVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 64

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +A+ G      L   +  +   +
Sbjct: 65  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---V 119

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L +         Q   +  R E     F  +  + F  L+KD+  N   +
Sbjct: 120 GLPKPDLVLFLQL---------QLADAAKRYENGA--FQERALRCFHQLMKDTTLNWKMV 168

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 169 DASKSIEAVHEDIRVL 184


>1e2gA [c.37.1] THYMIDYLATE KINASE
          Length = 205

 Score = 55.5 bits (132), Expect = 1e-10
 Identities = 55/196 (28%), Positives = 91/196 (46%), Gaps = 15/196 (7%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 6   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 64

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +A+ G      L   +  +   +
Sbjct: 65  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---V 119

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L       LQ A      +R E     F  +  + F  L+KD+  N   +
Sbjct: 120 GLPKPDLVLFLQ------LQLADAAKRGERYENGA--FQERALRCFHQLMKDTTLNWKMV 171

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 172 DASKSIEAVHEDIRVL 187


>1e2fA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 54.7 bits (130), Expect = 2e-10
 Identities = 55/196 (28%), Positives = 91/196 (46%), Gaps = 11/196 (5%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 7   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 65

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +A+ G      L   +  +   +
Sbjct: 66  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---V 120

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L     L L  A K G+          F  +  + F  L+KD+  N   +
Sbjct: 121 GLPKPDLVLFLQ----LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMV 176

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 177 DASKSIEAVHEDIRVL 192


>1e2dA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score = 54.7 bits (130), Expect = 2e-10
 Identities = 55/196 (28%), Positives = 91/196 (46%), Gaps = 11/196 (5%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 6   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 64

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +A+ G      L   +  +   +
Sbjct: 65  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---V 119

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L     L L  A K G+          F  +  + F  L+KD+  N   +
Sbjct: 120 GLPKPDLVLFLQ----LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMV 175

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 176 DASKSIEAVHEDIRVL 191


>3tmkE [c.37.1] THYMIDYLATE KINASE
          Length = 215

 Score = 53.9 bits (128), Expect = 4e-10
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 25/212 (11%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I+IEGLD  GK+T  + + K L+ N    +       T+I   +   +  + +   
Sbjct: 3   RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ-- 58

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQG--GGRGVELSKIRA 119
             SD  + ++++       + I   L +G N+V DR+ +S +AY    G  G++L     
Sbjct: 59  -LSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQ 117

Query: 120 LNDNFLNGCEPDLVIYL---DIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVF----- 171
            +   L   +PDL ++L   D+D       A+K G  D   +  ++F  K ++ F     
Sbjct: 118 PDVGLL---KPDLTLFLSTQDVD-----NNAEKSGFGDERYET-VKFQEKVKQTFMKLLD 168

Query: 172 KDLVKDSDNAIEIDAA-KSIQEVEKQIYLILD 202
           K++ K  ++   +D   K IQEVE  I+ I++
Sbjct: 169 KEIRKGDESITIVDVTNKGIQEVEALIWQIVE 200


>3tmkD [c.37.1] THYMIDYLATE KINASE
          Length = 214

 Score = 53.9 bits (128), Expect = 4e-10
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 25/212 (11%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I+IEGLD  GK+T  + + K L+ N    +       T+I   +   +  + +   
Sbjct: 2   RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ-- 57

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQG--GGRGVELSKIRA 119
             SD  + ++++       + I   L +G N+V DR+ +S +AY    G  G++L     
Sbjct: 58  -LSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQ 116

Query: 120 LNDNFLNGCEPDLVIYL---DIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVF----- 171
            +   L   +PDL ++L   D+D       A+K G  D   +  ++F  K ++ F     
Sbjct: 117 PDVGLL---KPDLTLFLSTQDVD-----NNAEKSGFGDERYET-VKFQEKVKQTFMKLLD 167

Query: 172 KDLVKDSDNAIEIDAA-KSIQEVEKQIYLILD 202
           K++ K  ++   +D   K IQEVE  I+ I++
Sbjct: 168 KEIRKGDESITIVDVTNKGIQEVEALIWQIVE 199


>3tmkA [c.37.1] THYMIDYLATE KINASE
          Length = 216

 Score = 53.9 bits (128), Expect = 4e-10
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 25/212 (11%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I+IEGLD  GK+T  + + K L+ N    +       T+I   +   +  + +   
Sbjct: 4   RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ-- 59

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQG--GGRGVELSKIRA 119
             SD  + ++++       + I   L +G N+V DR+ +S +AY    G  G++L     
Sbjct: 60  -LSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQ 118

Query: 120 LNDNFLNGCEPDLVIYL---DIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVF----- 171
            +   L   +PDL ++L   D+D       A+K G  D   +  ++F  K ++ F     
Sbjct: 119 PDVGLL---KPDLTLFLSTQDVD-----NNAEKSGFGDERYET-VKFQEKVKQTFMKLLD 169

Query: 172 KDLVKDSDNAIEIDAA-KSIQEVEKQIYLILD 202
           K++ K  ++   +D   K IQEVE  I+ I++
Sbjct: 170 KEIRKGDESITIVDVTNKGIQEVEALIWQIVE 201


>1e98A [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 53.5 bits (127), Expect = 5e-10
 Identities = 54/196 (27%), Positives = 91/196 (46%), Gaps = 11/196 (5%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 7   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 65

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +A+ G      L   +  +   +
Sbjct: 66  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---V 120

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L     L L  A K G+          F  +  + F  L+KD+  N   +
Sbjct: 121 GLPKPDLVLFLQ----LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMV 176

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+K I+ V ++I ++
Sbjct: 177 DASKRIEAVHEEIRVL 192


>1tmkA [c.37.1] THYMIDYLATE KINASE
          Length = 204

 Score = 52.8 bits (125), Expect = 9e-10
 Identities = 49/204 (24%), Positives = 96/204 (47%), Gaps = 19/204 (9%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I+IEGLD  GK+T  + + K L+ N    +       T+I   +   +  + +   
Sbjct: 2   RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ-- 57

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQG--GGRGVELSKIRA 119
             SD  + ++++       + I   L +G N+V DR+ +S +AY    G  G++L     
Sbjct: 58  -LSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQ 116

Query: 120 LNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD 179
            +   L   +PDL ++L      G +R + V   +++++  ++  +      K++ K  +
Sbjct: 117 PDVGLL---KPDLTLFLSTQ--FGDERYETVKFQEKVKQTFMKLLD------KEIRKGDE 165

Query: 180 NAIEIDAA-KSIQEVEKQIYLILD 202
           +   +D   K IQEVE  I+ I++
Sbjct: 166 SITIVDVTNKGIQEVEALIWQIVE 189


>1nn5A [c.37.1] SIMILAR TO DEOXYTHYMIDYLATE KINASE (THYMIDYLATE
          Length = 204

 Score = 52.8 bits (125), Expect = 9e-10
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 16/196 (8%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV+EG+D AGKST    + + L      A   R P  +    +L +  L  K D E HS 
Sbjct: 6   IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS- 64

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + ++++        LI   L +G+ +V DR+ +S +A+ G      L   +  +   +
Sbjct: 65  --VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---V 119

Query: 126 NGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD-NAIEI 184
              +PDLV++L +      +R       +R E     F  +  + F  L+KD+  N   +
Sbjct: 120 GLPKPDLVLFLQLQLADAAKR-------ERYENGA--FQERALRCFHQLMKDTTLNWKMV 170

Query: 185 DAAKSIQEVEKQIYLI 200
           DA+KSI+ V + I ++
Sbjct: 171 DASKSIEAVHEDIRVL 186


>3tmkC [c.37.1] THYMIDYLATE KINASE
          Length = 205

 Score = 50.1 bits (118), Expect = 6e-09
 Identities = 48/204 (23%), Positives = 95/204 (46%), Gaps = 20/204 (9%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I+IEGLD  GK+T  + + K L+ N    +       T+I   +   +  + +   
Sbjct: 4   RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ-- 59

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQG--GGRGVELSKIRA 119
             SD  + ++++       + I   L +G N+V DR+ +S +AY    G  G++L     
Sbjct: 60  -LSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQ 118

Query: 120 LNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD 179
            +   L   +PDL ++L        +R + V   +++++  ++  +      K++ K  +
Sbjct: 119 PDVGLL---KPDLTLFLSTQDD---ERYETVKFQEKVKQTFMKLLD------KEIRKGDE 166

Query: 180 NAIEIDAA-KSIQEVEKQIYLILD 202
           +   +D   K IQEVE  I+ I++
Sbjct: 167 SITIVDVTNKGIQEVEALIWQIVE 190


>2v54B [x.x.x] THYMIDYLATE KINASE
          Length = 203

 Score = 49.3 bits (116), Expect = 1e-08
 Identities = 43/193 (22%), Positives = 98/193 (50%), Gaps = 17/193 (8%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV EGLD +GK+T    + + +  N +   Y   P  + +  ++ +  L  K   + ++D
Sbjct: 6   IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYND 60

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + +++      + + I   LE+GI ++ DR+ +S +AY    +G  ++    L+ ++ 
Sbjct: 61  HIVNLLFCANRWEFASFIQEQLEQGITLIVDRYAFSGVAY-AAAKGASMT----LSKSYE 115

Query: 126 NGC-EPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEI 184
           +G  +PDLVI+L+     G +   +    +  E   + F  K  + +K ++++ D   +I
Sbjct: 116 SGLPKPDLVIFLE----SGSKEINRNVGEEIYE--DVTFQQKVLQEYKKMIEEGDIHWQI 169

Query: 185 DAAKSIQEVEKQI 197
            +++  ++V+K++
Sbjct: 170 ISSEFEEDVKKEL 182


>2v54A [x.x.x] THYMIDYLATE KINASE
          Length = 204

 Score = 49.3 bits (116), Expect = 1e-08
 Identities = 43/193 (22%), Positives = 98/193 (50%), Gaps = 17/193 (8%)

Query: 6   IVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSD 65
           IV EGLD +GK+T    + + +  N +   Y   P  + +  ++ +  L  K   + ++D
Sbjct: 7   IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYND 61

Query: 66  SELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFL 125
             + +++      + + I   LE+GI ++ DR+ +S +AY    +G  ++    L+ ++ 
Sbjct: 62  HIVNLLFCANRWEFASFIQEQLEQGITLIVDRYAFSGVAY-AAAKGASMT----LSKSYE 116

Query: 126 NGC-EPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEI 184
           +G  +PDLVI+L+     G +   +    +  E   + F  K  + +K ++++ D   +I
Sbjct: 117 SGLPKPDLVIFLE----SGSKEINRNVGEEIYE--DVTFQQKVLQEYKKMIEEGDIHWQI 170

Query: 185 DAAKSIQEVEKQI 197
            +++  ++V+K++
Sbjct: 171 ISSEFEEDVKKEL 183


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.312    0.130    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,021,989,706
Number of extensions: 41708428
Number of successful extensions: 108727
Number of sequences better than 1.0e-03: 1625
Number of HSP's gapped: 106255
Number of HSP's successfully gapped: 2188
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.5 bits)