BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACD30798.1 ftul2 ACD30798.1 GIB00719CH01 "ROK family protein"
         (268 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

XYLR1_BACSU RecName: Full=Xylose repressor;                            94   2e-21
XYLR2_BACSU RecName: Full=Xylose repressor;                            91   9e-21
Y188_CLOPE RecName: Full=Uncharacterized protein CPE0188;              91   1e-20
GLK_STRLI RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:...    87   2e-19
GLK_STRCO RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:...    87   2e-19
GLCNE_CRIGR RecName: Full=Bifunctional UDP-N-acetylglucosamine 2...    87   2e-19
GLCNE_HUMAN RecName: Full=Bifunctional UDP-N-acetylglucosamine 2...    86   5e-19
GLCNE_RAT RecName: Full=Bifunctional UDP-N-acetylglucosamine 2-e...    84   2e-18
GLCNE_MOUSE RecName: Full=Bifunctional UDP-N-acetylglucosamine 2...    84   2e-18
GLK_BACHD RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:...    77   2e-16
GLK_BACSU RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:...    73   3e-15
XYLR_ANATD RecName: Full=Xylose repressor;                             70   2e-14
NAGK_VIBF1 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    65   9e-13
NAGK_MANSM RecName: Full=N-acetyl-D-glucosamine kinase;         ...    64   2e-12
NAGK_ALISL RecName: Full=N-acetyl-D-glucosamine kinase;         ...    62   6e-12
NAGK_HAEI8 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    60   3e-11
NAGK_VIBPA RecName: Full=N-acetyl-D-glucosamine kinase;         ...    59   4e-11
NAGK_VIBFM RecName: Full=N-acetyl-D-glucosamine kinase;         ...    59   4e-11
NAGK_PHOPR RecName: Full=N-acetyl-D-glucosamine kinase;         ...    59   6e-11
NAGK_HAES1 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    59   6e-11
NAGK_YERPY RecName: Full=N-acetyl-D-glucosamine kinase;         ...    58   1e-10
NAGK_YERP3 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    58   1e-10
NAGK_YERE8 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    58   1e-10
NAGK_YERPS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    57   1e-10
NAGK_YERPB RecName: Full=N-acetyl-D-glucosamine kinase;         ...    57   1e-10
NAGK_HAEIN RecName: Full=N-acetyl-D-glucosamine kinase;         ...    57   1e-10
NAGK_SHIBS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   3e-10
NAGK_ERWT9 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   3e-10
NAGK_ECO7I RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   3e-10
NAGK_VIBCH RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_SHIDS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOUT RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOSM RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOSE RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOLU RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOLI RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOLC RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOL5 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOK1 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOHS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECODH RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECOBW RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECO8A RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECO81 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECO55 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECO45 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECO27 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
NAGK_ECO24 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    56   4e-10
XYLR_CALSR RecName: Full=Putative xylose repressor;                    55   5e-10
NAGK_SALHS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   5e-10
NAGK_ECOL6 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   5e-10
NAGK_SALPK RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   7e-10
NAGK_SALPC RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   7e-10
NAGK_SALPA RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   7e-10
NAGK_SALCH RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   7e-10
NAGK_SALAR RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   7e-10
NAGK_SALPB RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   9e-10
NAGK_ESCF3 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   9e-10
NAGK_ECO5E RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   9e-10
NAGK_ECO57 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   9e-10
NAGK_CITK8 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    55   9e-10
NAGK_SALSV RecName: Full=N-acetyl-D-glucosamine kinase;         ...    54   1e-09
NAGK_SALG2 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    54   1e-09
NAGK_SALEP RecName: Full=N-acetyl-D-glucosamine kinase;         ...    54   1e-09
NAGK_SALA4 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    54   1e-09
NAGK_SHIFL RecName: Full=N-acetyl-D-glucosamine kinase;         ...    53   3e-09
NAGK_SHIF8 RecName: Full=N-acetyl-D-glucosamine kinase;         ...    53   3e-09
NAGK_SHISS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    53   4e-09
NAGK_SALTY RecName: Full=N-acetyl-D-glucosamine kinase;         ...    52   5e-09
NAGK_SALNS RecName: Full=N-acetyl-D-glucosamine kinase;         ...    52   5e-09
NAGK_SALDC RecName: Full=N-acetyl-D-glucosamine kinase;         ...    52   5e-09
NAGK_PASMU RecName: Full=N-acetyl-D-glucosamine kinase;         ...    52   5e-09
MAK_ECOLI RecName: Full=Fructokinase;         EC=2.7.1.4;AltName...    52   5e-09
NAGK_VIBSL RecName: Full=N-acetyl-D-glucosamine kinase;         ...    52   6e-09
NAGK_SALTI RecName: Full=N-acetyl-D-glucosamine kinase;         ...    52   6e-09
NAGK_YERPN RecName: Full=N-acetyl-D-glucosamine kinase;         ...    50   2e-08
NAGK_YERPE RecName: Full=N-acetyl-D-glucosamine kinase;         ...    50   2e-08
NAGK_YERPA RecName: Full=N-acetyl-D-glucosamine kinase;         ...    50   2e-08
XYLR_LACPE RecName: Full=Xylose repressor;                             49   7e-08
NAGK_VIBVY RecName: Full=N-acetyl-D-glucosamine kinase;         ...    47   1e-07
NAGK_VIBVU RecName: Full=N-acetyl-D-glucosamine kinase;         ...    47   1e-07
MLC_ECOLI RecName: Full=Protein mlc;AltName: Full=Making large c...    44   1e-06
GLK_STAXY RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:...    44   2e-06
SCRK_BACSU RecName: Full=Putative fructokinase;         EC=2.7.1...    37   2e-04
NAGK_ERWCT RecName: Full=N-acetyl-D-glucosamine kinase;         ...    37   2e-04

>XYLR1_BACSU RecName: Full=Xylose repressor;
          Length = 384

 Score = 93.6 bits (231), Expect = 2e-21
 Identities = 80/265 (30%), Positives = 141/265 (53%), Gaps = 23/265 (8%)

Query: 13  VGVDIGGTKVNA--GRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSE--VE 68
           VG+D+G   +N     + G  +LD Y        E     +ID++ + I ++  S   + 
Sbjct: 83  VGIDVGVDYINGILTDLEGTIVLDQYRHLESNSPEITKDILIDMIHHFITQMPQSPYGLI 142

Query: 69  GIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYG 128
           GIG+ +P + D+++ IV+   +  +W++I LK  ++ ++ VPVFI+N+AN  A G++++G
Sbjct: 143 GIGICVPGLIDKDQKIVFTPNS--NWRDIDLKSSIQEKYNVPVFIENEANAGAYGEKVFG 200

Query: 129 KGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLD-----------GILE 177
             K ++N                   L +  +  +GE G +  +D           G  E
Sbjct: 201 AAKNHDNXXXXXXXXXXXXXXXXNNHLYRGVSGFSGEMGHMT-IDFNGPKCSCGNRGCWE 259

Query: 178 DYCSGQFFIKKIGVEG-----VEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPE 232
            Y S +  +K +  +       +I+  A  ND  T+N  + FG +LG+ + +I+ T +P+
Sbjct: 260 LYASEKALLKSLQTKEKKLSYQDIINLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQ 319

Query: 233 VIIIAGSIISAREFFEKAMWDEIKT 257
            +I+  SII +      +M  E+ +
Sbjct: 320 AVILRNSIIESHPMVLNSMRSEVSS 344


>XYLR2_BACSU RecName: Full=Xylose repressor;
          Length = 384

 Score = 91.3 bits (225), Expect = 9e-21
 Identities = 73/265 (27%), Positives = 134/265 (50%), Gaps = 23/265 (8%)

Query: 13  VGVDIGGTKVNA--GRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSE--VE 68
           +G+D+G   ++     + G  +LD +        E     +ID++ + I ++  S   + 
Sbjct: 83  IGIDVGVDYISGILTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMPQSPYGLI 142

Query: 69  GIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYG 128
           GIG+ +P + D+ + IV+   +  +W++I LK  ++ +F VPVFI+N+AN  A G++++G
Sbjct: 143 GIGICVPGLIDKNQKIVFTPNS--NWRDIDLKSFIQEKFNVPVFIENEANAGAYGEKVFG 200

Query: 129 KGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLD-----------GILE 177
             K + N +                 L +  +  +GE G +  +D           G  E
Sbjct: 201 AAKNHNNIIYASISTXXXXXXXXNNHLYRGVSGFSGEMGHMT-IDFNGPKCSCGNRGCWE 259

Query: 178 DYCSGQFFIKKI-----GVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPE 232
            Y S +  +K +      V   +I+  A  ND  T+N  + FG +LG+ + +I+ T +P+
Sbjct: 260 LYASEKALLKSLQTKEKKVSYQDIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQ 319

Query: 233 VIIIAGSIISAREFFEKAMWDEIKT 257
            II+  SII +      ++  E+ +
Sbjct: 320 AIILRNSIIESHPMVLNSIRSEVSS 344


>Y188_CLOPE RecName: Full=Uncharacterized protein CPE0188;
          Length = 295

 Score = 90.9 bits (224), Expect = 1e-20
 Identities = 74/255 (29%), Positives = 128/255 (50%), Gaps = 12/255 (4%)

Query: 15  VDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV-FTSEVEGIGVG 73
           +DIGGT +  G +  +  L     +   +A     S+I+ V + I ++   +++ GI V 
Sbjct: 7   IDIGGTSIKYGVINEDGTLLETNDR-DTEAYKGGLSIIEKVKDIIHELKINNDISGICVS 65

Query: 74  IPS-VADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQ 132
               V  +E  IVY    I ++  + +K+ILE EF +P F++ND NC A+G+   G GK 
Sbjct: 66  TAGMVCPKEGKIVYAGPTIPNYTGVEVKKILEEEFNLPCFVENDVNCAALGEFFGGAGKG 125

Query: 133 YENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKI--- 189
             +                 G +L   +  AGE G +      ++D  S    +K +   
Sbjct: 126 THSMACXXXXXXXXXXXXXDGKVLHGFSNSAGEIGYMMVNGEHIQDIASASALVKNVALR 185

Query: 190 ------GVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISA 243
                  ++G  +L    N D       ++   +L + I +I+Y ++PEV+++ G I++ 
Sbjct: 186 KGVEPSSIDGRYVLDNYENGDLICKEEVEKLADNLALGISNIVYLINPEVVVLGGGIMAR 245

Query: 244 REFFEKAMWDEIKTF 258
            E F   + + ++ +
Sbjct: 246 EEVFRPLIENSLRKY 260


>GLK_STRLI RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
           Full=Glucose kinase;
          Length = 317

 Score = 87.0 bits (214), Expect = 2e-19
 Identities = 81/265 (30%), Positives = 124/265 (46%), Gaps = 44/265 (16%)

Query: 13  VGVDIGGTKVNAGRVCGE-NLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEGI 70
           +GVDIGGTK+ AG V  E N+L ++    P   E    +++D + + +       E+  +
Sbjct: 5   IGVDIGGTKIAAGVVDEEGNILSTHKVPTPTTPE----AIVDAIASAVEGARVGHEIVAV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+G     +R++  VY   NI  W++  LKE +EA   +PV ++NDAN  A G+  +G G
Sbjct: 61  GIGAAGYVNRQRSTVYFAPNI-DWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGG 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG---MLPYLDGIL---------ED 178
           K + N +                 L +     A EFG   M+P  DG+L         E 
Sbjct: 120 KGHRNVICXXXXXXXXXXXXXXNKLRRGHFGVAAEFGHIRMVP--DGLLCGCGSQGCWEQ 177

Query: 179 YCSGQFFIKKI-----------------------GVEGVEILKRARNNDKDTINIYKQFG 215
           Y SG+  ++                         G+EG  I   AR      ++ Y++  
Sbjct: 178 YASGRALVRYAKQRANATPERAEVLLALGDGTPDGIEGKHISVAARQGCPVAVDSYRELA 237

Query: 216 KHLGVAIKSIMYTLDPEVIIIAGSI 240
           +  G  +  +    DP   I+ G +
Sbjct: 238 RWAGAGLADLASLFDPSAFIVGGGL 262


>GLK_STRCO RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
           Full=Glucose kinase;
          Length = 317

 Score = 87.0 bits (214), Expect = 2e-19
 Identities = 81/265 (30%), Positives = 124/265 (46%), Gaps = 44/265 (16%)

Query: 13  VGVDIGGTKVNAGRVCGE-NLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEGI 70
           +GVDIGGTK+ AG V  E N+L ++    P   E    +++D + + +       E+  +
Sbjct: 5   IGVDIGGTKIAAGVVDEEGNILSTHKVPTPTTPE----AIVDAIASAVEGARVGHEIVAV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+G     +R++  VY   NI  W++  LKE +EA   +PV ++NDAN  A G+  +G G
Sbjct: 61  GIGAAGYVNRQRSTVYFAPNI-DWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGG 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG---MLPYLDGIL---------ED 178
           K + N +                 L +     A EFG   M+P  DG+L         E 
Sbjct: 120 KGHRNVICXXXXXXXXXXXXXXNKLRRGHFGVAAEFGHIRMVP--DGLLCGCGSQGCWEQ 177

Query: 179 YCSGQFFIKKI-----------------------GVEGVEILKRARNNDKDTINIYKQFG 215
           Y SG+  ++                         G+EG  I   AR      ++ Y++  
Sbjct: 178 YASGRALVRYAKQRANATPERAEVLLALGDGTPDGIEGKHISVAARQGCPVAVDSYRELA 237

Query: 216 KHLGVAIKSIMYTLDPEVIIIAGSI 240
           +  G  +  +    DP   I+ G +
Sbjct: 238 RWAGAGLADLASLFDPSAFIVGGGL 262


>GLCNE_CRIGR RecName: Full=Bifunctional UDP-N-acetylglucosamine
           2-epimerase/N-acetylmannosamine kinase;AltName:
           Full=UDP-GlcNAc-2-epimerase/ManAc kinase;
          Length = 722

 Score = 87.0 bits (214), Expect = 2e-19
 Identities = 78/270 (28%), Positives = 135/270 (50%), Gaps = 34/270 (12%)

Query: 7   IKNRTVVGVDIGGTKVNAGRVCGEN-LLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS 65
           ++  + + VD+GGT +    V  +  ++  Y    P   E     ++ + +   A+    
Sbjct: 404 LETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKL 463

Query: 66  EVEGIGVGIPS---VADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAI 122
               +GVGI +   V  +E  +++  + I+ W  + L+  L     +PV++DND NC A+
Sbjct: 464 NCRILGVGISTGGRVNPQEGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAM 523

Query: 123 GQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG-MLPYLD-------- 173
            +R +G+GK  ENFV             ++  L+  S+  A E G ++  LD        
Sbjct: 524 AERKFGQGKGQENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGS 583

Query: 174 -GILEDYCSG---QFFIKKIG------VEGVEI-----------LKRARNNDKDTINIYK 212
            G +E Y SG   Q   KK+       VEG+ +           ++ A+  +    NI +
Sbjct: 584 HGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEPVGALHLIQAAKLGNVKAQNILR 643

Query: 213 QFGKHLGVAIKSIMYTLDPEVIIIAGSIIS 242
             G  LG+ + +I++T+DP ++I++G + S
Sbjct: 644 TAGTALGLGVVNILHTMDPSLVILSGVLAS 673


>GLCNE_HUMAN RecName: Full=Bifunctional UDP-N-acetylglucosamine
           2-epimerase/N-acetylmannosamine kinase;AltName:
           Full=UDP-GlcNAc-2-epimerase/ManAc kinase;
          Length = 722

 Score = 85.5 bits (210), Expect = 5e-19
 Identities = 77/270 (28%), Positives = 135/270 (50%), Gaps = 34/270 (12%)

Query: 7   IKNRTVVGVDIGGTKVNAGRVCGEN-LLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS 65
           ++  + + VD+GGT +    V  +  ++  Y    P   E     ++ + +   A+    
Sbjct: 404 LETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKL 463

Query: 66  EVEGIGVGIPS---VADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAI 122
               +GVGI +   V  RE  +++  + I+ W  + L+  L     +PV++DND NC A+
Sbjct: 464 NCRILGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAL 523

Query: 123 GQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG-MLPYLD-------- 173
            +R +G+GK  ENFV             ++  L+  S+  A E G ++  LD        
Sbjct: 524 AERKFGQGKGLENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGS 583

Query: 174 -GILEDYCSG---QFFIKKIG------VEGVEI-----------LKRARNNDKDTINIYK 212
            G +E Y SG   Q   KK+       VEG+ +           ++ A+  +    +I +
Sbjct: 584 HGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILR 643

Query: 213 QFGKHLGVAIKSIMYTLDPEVIIIAGSIIS 242
             G  LG+ + +I++T++P ++I++G + S
Sbjct: 644 TAGTALGLGVVNILHTMNPSLVILSGVLAS 673


>GLCNE_RAT RecName: Full=Bifunctional UDP-N-acetylglucosamine
           2-epimerase/N-acetylmannosamine kinase;AltName:
           Full=UDP-GlcNAc-2-epimerase/ManAc kinase;
          Length = 722

 Score = 83.6 bits (205), Expect = 2e-18
 Identities = 76/270 (28%), Positives = 135/270 (50%), Gaps = 34/270 (12%)

Query: 7   IKNRTVVGVDIGGTKVNAGRVCGEN-LLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS 65
           ++  + + VD+GGT +    V  +  ++  Y    P   E     ++ + +   A+    
Sbjct: 404 LETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKL 463

Query: 66  EVEGIGVGIPS---VADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAI 122
               +GVGI +   V  +E  +++  + I+ W  + L+  L     +PV++DND NC A+
Sbjct: 464 NCRILGVGISTGGRVNPQEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAM 523

Query: 123 GQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG-MLPYLD-------- 173
            +R +G+GK  ENFV             ++  L+  S+  A E G ++  LD        
Sbjct: 524 AERKFGQGKGQENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGS 583

Query: 174 -GILEDYCSG---QFFIKKIG------VEGVEI-----------LKRARNNDKDTINIYK 212
            G +E Y SG   Q   KK+       VEG+ +           ++ A+  +    +I +
Sbjct: 584 HGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNVKAQSILR 643

Query: 213 QFGKHLGVAIKSIMYTLDPEVIIIAGSIIS 242
             G  LG+ + +I++T++P ++I++G + S
Sbjct: 644 TAGTALGLGVVNILHTMNPSLVILSGVLAS 673


>GLCNE_MOUSE RecName: Full=Bifunctional UDP-N-acetylglucosamine
           2-epimerase/N-acetylmannosamine kinase;AltName:
           Full=UDP-GlcNAc-2-epimerase/ManAc kinase;
          Length = 722

 Score = 83.6 bits (205), Expect = 2e-18
 Identities = 76/270 (28%), Positives = 135/270 (50%), Gaps = 34/270 (12%)

Query: 7   IKNRTVVGVDIGGTKVNAGRVCGEN-LLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS 65
           ++  + + VD+GGT +    V  +  ++  Y    P   E     ++ + +   A+    
Sbjct: 404 LETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKL 463

Query: 66  EVEGIGVGIPS---VADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAI 122
               +GVGI +   V  +E  +++  + I+ W  + L+  L     +PV++DND NC A+
Sbjct: 464 NCRILGVGISTGGRVNPQEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAM 523

Query: 123 GQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG-MLPYLD-------- 173
            +R +G+GK  ENFV             ++  L+  S+  A E G ++  LD        
Sbjct: 524 AERKFGQGKGQENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGS 583

Query: 174 -GILEDYCSG---QFFIKKIG------VEGVEI-----------LKRARNNDKDTINIYK 212
            G +E Y SG   Q   KK+       VEG+ +           ++ A+  +    +I +
Sbjct: 584 HGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNVKAQSILR 643

Query: 213 QFGKHLGVAIKSIMYTLDPEVIIIAGSIIS 242
             G  LG+ + +I++T++P ++I++G + S
Sbjct: 644 TAGTALGLGVVNILHTMNPSLVILSGVLAS 673


>GLK_BACHD RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
           Full=Glucose kinase;
          Length = 330

 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 88/293 (30%), Positives = 132/293 (45%), Gaps = 45/293 (15%)

Query: 7   IKNRTVVGVDIGGTKVNAG--RVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFT 64
           + +R  VGVD+GGT +        GE ++D +  +IP + +     +   + + + K  +
Sbjct: 1   MSDRWYVGVDVGGTTIKMAFLTTAGE-IVDKW--EIPTNKQDGGALITTNIADALDKRLS 57

Query: 65  ------SEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDAN 118
                 S++ GIG+G P   + + G +Y   NI  W++  LK+ LE E K+PV +DNDAN
Sbjct: 58  GHHKSKSDLIGIGLGAPGFIEMDTGFIYHAVNI-GWRDFPLKDKLEEETKLPVIVDNDAN 116

Query: 119 CFAIGQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYL------ 172
             A+G+   G G   +N                        N  AGE G +  +      
Sbjct: 117 IAALGEMWKGAGDGAKNMXXXXXXXXXXXXXXXXXXXXHGVNGMAGEIGHITVIPEGGAP 176

Query: 173 -----DGILEDYCSGQFFIKKIGVEGVEILKR---ARNNDKDTINIYK------------ 212
                 G LE   S    I +I  EGV   K    A + DK  +   K            
Sbjct: 177 CNCGKTGCLETVASAT-GIARIATEGVTEHKESQLALDYDKHGVLTAKXXXXXXXXXXXX 235

Query: 213 ------QFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFA 259
                     +LG AI ++   L+PE I+I G +  A +   K +    + +A
Sbjct: 236 XXXXXXHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYA 288


>GLK_BACSU RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
           Full=Glucose kinase;
          Length = 321

 Score = 72.8 bits (177), Expect = 3e-15
 Identities = 76/285 (26%), Positives = 122/285 (42%), Gaps = 46/285 (16%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEG---- 69
           G+D+GGT +    +       +   +I    E       D +  TIAK   S+++     
Sbjct: 8   GIDLGGTTIKLAFI-------NQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDELQKP 60

Query: 70  ------IGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIG 123
                 IG+G P   D   G+VY+  N+  W+   LK  LE E  +P  I+NDAN  A+G
Sbjct: 61  KHIIKYIGMGAPGPVDMAAGVVYETVNL-GWKNYALKNHLETETGIPAVIENDANIAALG 119

Query: 124 QRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYL----------- 172
           +   G G   ++                 G ++   N   GE G +  +           
Sbjct: 120 EMWKGAGDGAKDXXXXXXXXXXXXXXXANGEIVHGINGAGGEIGHICSIPEGGAPCNCGK 179

Query: 173 DGILEDYCSGQFFIK----KIG-------------VEGVEILKRARNNDKDTINIYKQFG 215
            G +E   S    ++    KI              +   ++ + A  ND+  + +     
Sbjct: 180 TGCIETIASATGIVRIAKEKIANAKKTTRLKATEQLSARDVFEAAGENDEIALEVVDYVA 239

Query: 216 KHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAF 260
           KHLG+ + ++  +L+P  I++ G +  A E     +    +  AF
Sbjct: 240 KHLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAF 284


>XYLR_ANATD RecName: Full=Xylose repressor;
          Length = 399

 Score = 70.1 bits (170), Expect = 2e-14
 Identities = 63/292 (21%), Positives = 126/292 (43%), Gaps = 35/292 (11%)

Query: 11  TVVGVDIGGTKVNA--GRVCGENLLDSYLS-KIPPDAEHNAQSVIDVVINTIAKV--FTS 65
           +++G+D+G   ++       GE + + Y + KI  D E   + + D++  ++ K      
Sbjct: 79  SIIGIDLGVDYIHIILSNFVGEVIFEEYANMKIGEDKEKLLRLLFDLIEKSVKKAPQTPK 138

Query: 66  EVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQR 125
                        ++E G V    N+K WQ + L+ I++ +F +PV+IDN+AN  A+G++
Sbjct: 139 XXXXXXXXXXXXXEKESGTVLLAPNLK-WQNVPLRSIVQQKFNLPVYIDNEANAGALGEK 197

Query: 126 LYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPYLD--------GI 175
            +G+  +  + +                 L + +   AGE G   + + D        G 
Sbjct: 198 WFGEWGKVSDLIYLSVGIGLGAGIIIDNKLFRGAAGFAGEVGHTTINFQDDVCSCGNIGC 257

Query: 176 LEDYCSGQFF---IKKIGVEGVE----------------ILKRARNNDKDTINIYKQFGK 216
           LE++ S +     IKK+  +GVE                I++ A+   +       +  +
Sbjct: 258 LENFASERALLSVIKKLVKQGVEDRYISWENVDEITPSRIIQAAKEGSRVCRMAILEVAE 317

Query: 217 HLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKLK 268
            +G+ + +++   +PE++II        E F + + + I   +FI Q   LK
Sbjct: 318 KMGIGVANLVNIFNPEMVIIGNKASFFGELFLEKLREVINQRSFIAQFYNLK 369


>NAGK_VIBF1 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 64.7 bits (156), Expect = 9e-13
 Identities = 78/265 (29%), Positives = 125/265 (47%), Gaps = 33/265 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSE--VEG-I 70
           G D+GGTK+  G    E L      +IP   E N   ++D + + IAK + +E  VEG +
Sbjct: 4   GFDVGGTKIEFGAF-NEKLERVATERIPTQTE-NYSLLVDDIASLIAK-YDAEFGVEGKV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + D E G +    N+ + +   L++ LEA+    V IDNDANCFA+ +    + 
Sbjct: 61  GLGIPGMEDAETGALL-TSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEEL 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--------------MLPYLD--- 173
           K   + +                      +  AGE G                P L+   
Sbjct: 120 KDSPSVMXXXXXXXXXXXXXXXXKAFSGYSHVAGELGHSRLPIDAWFHLGENAPLLECGC 179

Query: 174 ---GILEDYCSGQFFIKKIG------VEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +++Y SG+ F            + ++I+K     D + +    +F + L +   +
Sbjct: 180 GNKGCIDNYLSGRGFELLYAHYYGEQKKAIDIIKAHAEGDANAVEHVDRFMELLAICFAN 239

Query: 225 IMYTLDPEVIIIAGSIISAREFFEK 249
           +    DP V+ + G + +    +E+
Sbjct: 240 LFTCFDPHVVALGGGLSNFELIYEE 264


>NAGK_MANSM RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 83/288 (28%), Positives = 130/288 (45%), Gaps = 37/288 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEV--EGIG 71
           G DIGGTK+    V  + L   Y  ++    +   Q  +DV++N + K          +G
Sbjct: 4   GFDIGGTKIELA-VFNDKLERQYTERVETPKDSYEQW-LDVIVNLVEKADQKFACKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +G+P   + E GI  ++ NI+      + + L       V  +NDANCFA+ +    + +
Sbjct: 62  LGLPGFVNHETGIA-EITNIRVADNKPIIKDLSERLGREVRAENDANCFALSEAWDEENQ 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCG-AGEFGML---------------PYLD-- 173
           QY  FV                  +     G AGE G L               P  D  
Sbjct: 121 QYP-FVXXXXXXXXXXXXXXXXXKVHSGQIGMAGELGHLQLNYHALKLLGWDKAPIYDCG 179

Query: 174 ----GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIK 223
                 L+ Y SG+ F      +K   +   EI++R    DK  ++    F +   +++ 
Sbjct: 180 CGNRACLDTYLSGRGFEMLYRDLKGEALSAKEIIERFYAADKTAVDFVGLFIELCAISLG 239

Query: 224 SIMYTLDPEVIIIAGSIISAREFFE---KAMWDEIKTFAFINQLKKLK 268
           +I+  LDP VI++ G + +    +E   KA+   +   A +  +KK K
Sbjct: 240 NIITALDPHVIVLGGGLSNFDYLYEALPKALPKHLMRSAKVPVIKKAK 287


>NAGK_ALISL RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 302

 Score = 62.0 bits (149), Expect = 6e-12
 Identities = 79/256 (30%), Positives = 120/256 (46%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSE--VEG-I 70
           G D+GGTK+  G    E L      +IP   E  +  V D+  + IAK + +E  VEG +
Sbjct: 4   GFDVGGTKIEFGAF-NEKLERVATERIPTQTEDYSLLVNDIA-SLIAK-YDAEFGVEGKV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + D E G +    N+ + +   L++ LEA+    V IDNDANCFA+ +    + 
Sbjct: 61  GLGIPGMEDAETGALL-TSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEEL 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--------------MLPYLD--- 173
           K   +                        +  AGE G                P L+   
Sbjct: 120 KDSPSXXXXXXXXXXXXXXXXXXXXXSGYSHVAGELGHSRLPIDAWFHLGEKAPLLECGC 179

Query: 174 ---GILEDYCSGQ----FFIKKIGVE--GVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +++Y SG+     +    G E   ++I+K     D D +    +F + L +   +
Sbjct: 180 GNKGCIDNYLSGRGFELLYAHYYGQEKKAIDIIKANEAGDADAVEHVDRFMELLAICFAN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           +    DP V+ + G +
Sbjct: 240 LFTCFDPHVVALGGGL 255


>NAGK_HAEI8 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 37/288 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPP---DAEHNAQSVIDVVINTIAKVFTSEVEGI 70
           G+DIGGTK+    V  E L   Y  ++P    D E    +++D+V     K    EV  +
Sbjct: 4   GLDIGGTKIELA-VFNEELEKLYSERVPTPKTDYEEWLNTIVDLVNRADEKF--GEVGTV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+G+P   +++ G+  ++ NI+      +   L       V  +NDANCFA+ +    + 
Sbjct: 61  GLGVPGFVNQQTGLA-EITNIRVADNKPILRDLSVRLGREVRAENDANCFALSEAWDTEN 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLP----------------YLDG 174
           +QY                     +       AGE G L                 Y  G
Sbjct: 120 QQYPXXXXXXXXXXXXXXXXXXXKVHSGQVGMAGELGHLQLNYHALKLLGWDNAPIYQCG 179

Query: 175 -----ILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIK 223
                 L++Y SG+ F      +K   +   EI+      ++  ++    F +   ++I 
Sbjct: 180 CGNKACLDNYLSGRGFEMLYRDLKGETLSAREIIDLFYQGNESAVDFVNLFVELAAISIG 239

Query: 224 SIMYTLDPEVIIIAGSIISAREFFE---KAMWDEIKTFAFINQLKKLK 268
           +I+   DP +I++ G + +    +E   KA+   +   A +  +KK K
Sbjct: 240 NIITAFDPHMIVLGGGLSNFDYLYEALPKALPPHLMRTAKVPPIKKAK 287


>NAGK_VIBPA RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 302

 Score = 59.3 bits (142), Expect = 4e-11
 Identities = 74/265 (27%), Positives = 122/265 (46%), Gaps = 33/265 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEV--EG-I 70
           G D+GGTK+  G       L+   ++  P    N + ++D +   + K + +E   EG I
Sbjct: 4   GFDVGGTKIEFGAF--NEKLERVATERVPTPTDNYELLVDTIAELVNK-YDAEFGCEGTI 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+G+P + D +   V  V N+ + +   L+  LEA+    V I+NDANCFA+ +    + 
Sbjct: 61  GLGLPGMEDADDATVLTV-NVPAAKGKPLRADLEAKIGRSVKIENDANCFALSEAWDEEL 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY----------------- 171
           +   +                 G +    N  AGE G   LP                  
Sbjct: 120 QDEPSVXXXXXXXXXXXXXXYDGKVFSGRNHVAGEVGHTRLPIDAWFHLGENAPLLGCGC 179

Query: 172 -LDGILEDYCSGQ----FFIKKIGVE--GVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G L+ Y SG+     +    G E   ++I+K     +   +   ++F + L +   +
Sbjct: 180 DKKGCLDSYLSGRGFELLYAHYYGEEKKAIDIIKAHAEGEAKAVEHVERFMELLAICFAN 239

Query: 225 IMYTLDPEVIIIAGSIISAREFFEK 249
           I    DP V+++ G + +    +E+
Sbjct: 240 IFTATDPHVVVLGGGLSNFELIYEE 264


>NAGK_VIBFM RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 59.3 bits (142), Expect = 4e-11
 Identities = 77/265 (29%), Positives = 121/265 (45%), Gaps = 33/265 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSE--VEG-I 70
           G D+GGTK+  G    E L      +IP   E N   ++D + + IAK + +E  VEG +
Sbjct: 4   GFDVGGTKIEFGAF-NEKLERVATERIPTQTE-NYSLLVDDIASLIAK-YDAEFGVEGKV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + D E G +    N+ + +   L++ LEA+    V IDNDANCFA+ +    + 
Sbjct: 61  GLGIPGMEDAETGALL-TSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEEL 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLP------------------ 170
           K   + +                      +  AGE G   LP                  
Sbjct: 120 KDSPSVMXXXXXXXXXXXXXXXXQAFSGYSHVAGELGHSRLPIDAWFHLGENAPXXXXXX 179

Query: 171 YLDGILEDYCSGQFFIKKIG------VEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
                 + Y SG+ F            + ++I+K     D + +    +F + L +   +
Sbjct: 180 XXXXXXDSYLSGRGFELLYAHYYGEQKKAIDIIKAHAEGDVNAVEHVDRFMELLAICFAN 239

Query: 225 IMYTLDPEVIIIAGSIISAREFFEK 249
           +    DP V+ + G + +    +E+
Sbjct: 240 LFTCFDPHVVALGGGLSNFELIYEE 264


>NAGK_PHOPR RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 58.5 bits (140), Expect = 6e-11
 Identities = 73/282 (25%), Positives = 125/282 (44%), Gaps = 31/282 (10%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G D+GGTK+  G       L+   ++       +   ++D ++  I K       EG +G
Sbjct: 4   GFDVGGTKIEFGAF--NEKLERVATERVATPRDDYDKLVDTIVGIIQKADNDLGCEGLVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +G+P + D   G V    NI + +   L++ LEA+    V IDNDANCFA+ +      +
Sbjct: 62  IGLPGMEDARDGSVL-TSNIPAAKGRFLRKDLEAKLGRTVTIDNDANCFALSEAWDESLQ 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
             ++                        N  AGE G   +P                   
Sbjct: 121 GEKSXXXXXXXXXXXXXXXXXXXXXSGMNHVAGELGHTRMPIDAWFSLGEKAPLFTCGCD 180

Query: 172 LDGILEDYCSGQFFIKKI------GVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +++Y SG+ F +         ++ +EI+K     +   +    +F + L + + +I
Sbjct: 181 NKGCIDNYLSGRGFEQLYAHYYGENLKAIEIIKLHATGEAKAVEHVDRFMEMLAICLANI 240

Query: 226 MYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKL 267
              LDP V+++ G + +    +++      K    + Q+ K+
Sbjct: 241 FTGLDPHVVVLGGGLSNFELLYQELPKRIAKHLLSVAQVPKI 282


>NAGK_HAES1 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 305

 Score = 58.5 bits (140), Expect = 6e-11
 Identities = 78/287 (27%), Positives = 129/287 (44%), Gaps = 35/287 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+    V  E L   Y  ++    +H+    ++V+ + + K       +G +G
Sbjct: 4   GFDIGGTKIELA-VFNEKLEKRYSERVDTP-KHSYDEWLNVITHLVQKADEKFACKGTVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +G+P   ++E GI  ++ NI+      + + L       V  +NDANCFA+ +      +
Sbjct: 62  IGVPGFVNQETGIA-EITNIRVADNKPILKDLSERLGREVRAENDANCFALSEAWDKDNQ 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGML---------------PYLD--- 173
           QY                          +  AGE G L               P  +   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXXXHSGQSGMAGELGHLQLNYHALKLLGWDKAPIYECGC 180

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
                L+ Y SG+ F      ++   +   EI++   + D+  +   + F +   ++I +
Sbjct: 181 GNKACLDTYLSGRGFEMLYRDLQGKALSAKEIIRCFYDKDESAVKFVELFIELCAISIGN 240

Query: 225 IMYTLDPEVIIIAGSIISAREFFE---KAMWDEIKTFAFINQLKKLK 268
           I+  LDP VII+ G + +    +E   KA+   +   A +  +KK K
Sbjct: 241 IITALDPHVIILGGGLSNFDYLYEALPKALPQHLMRTAKVPLIKKAK 287


>NAGK_YERPY RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 72/264 (27%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPCEDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +    + +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFR 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY--LD-------------- 173
            Y                          N   GEFG   LP   LD              
Sbjct: 121 TYPXXXXXXXXXXXXXXXXXXXXXXXXRNHITGEFGHFRLPVDALDILGADIPRVPCGCG 180

Query: 174 --GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F        +  +   +I+      +   +   ++F   L V + ++
Sbjct: 181 HRGCIENYISGRGFEWMYSHFYQHTLPATDIIAHYAAGEPKAVAHVERFMDVLAVCLGNL 240

Query: 226 MYTLDPEVIIIAGSIISAREFFEK 249
           +  LDP ++++ G + +  + +++
Sbjct: 241 LTMLDPHLVVVGGGLSNFEKIYQE 264


>NAGK_YERP3 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 69/264 (26%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +    + +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFR 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGM--------------LPYLD---- 173
            Y                          N   GEFG               +P++     
Sbjct: 121 TYPXXXXXXXXXXXXXXXXXXXXXXXXRNHITGEFGHFRLPVDALDILGADIPHVPCGCG 180

Query: 174 --GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F        +  +   +I+      +   +   ++F   L V + ++
Sbjct: 181 HRGCIENYISGRGFEWMYSHFYQHTLPATDIIAHYAAGEPKAVAHVERFMDVLAVCLGNL 240

Query: 226 MYTLDPEVIIIAGSIISAREFFEK 249
           +  LDP ++++ G + +  + +++
Sbjct: 241 LTMLDPHLVVVGGGLSNFEKIYQE 264


>NAGK_YERE8 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 74/265 (27%), Positives = 119/265 (44%), Gaps = 33/265 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNA---QSVIDVVINTIAKVFTSEVEGI 70
           G D+GGTK+  G V   NL   +  ++P   E  +   Q++ D+     A  F      +
Sbjct: 4   GFDMGGTKIELG-VFDANLQRIWHKRVPTPREDYSLLLQTLHDLTRE--ADEFCGSKGSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + + G V+   N+ +     L+  L       V IDNDANCFA+ +    + 
Sbjct: 61  GIGIPGLPNADDGTVFTA-NVPAAMGQSLQGDLSGLIGREVRIDNDANCFALSEAWDPEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY--LD------------- 173
           ++Y                          N   GEFG   LP   LD             
Sbjct: 120 RRYPXXXXXXXXXXXXXXXXXXXXXXSGRNHITGEFGHFRLPVDALDILGADIPRVSCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F        +  +   EI+      +   +   ++F   L V + +
Sbjct: 180 GHNGCIENYISGRGFEWMYKHFNQQSLPATEIIANYNLGESKAVAHVERFMDVLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSIISAREFFEK 249
           ++  LDP +++I G + +    +++
Sbjct: 240 LLTMLDPHLVVIGGGLSNFEHIYQE 264


>NAGK_YERPS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 57.4 bits (137), Expect = 1e-10
 Identities = 72/264 (27%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +    + +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFR 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY--LD-------------- 173
            Y                          N   GEFG   LP   LD              
Sbjct: 121 TYPXXXXXXXXXXXXXXXXXXXXXXXXRNHITGEFGHFRLPVDALDILGADIPRVPCGCG 180

Query: 174 --GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F        +  +   +I+      +   +   ++F   L V + ++
Sbjct: 181 HRGCIENYISGRGFEWMYSHFYQHTLPATDIIAHYAAGEPKAVAHVERFMDVLAVCLGNL 240

Query: 226 MYTLDPEVIIIAGSIISAREFFEK 249
           +  LDP ++++ G + +  + +++
Sbjct: 241 LTMLDPHLVVVGGGLSNFEKIYQE 264


>NAGK_YERPB RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 57.4 bits (137), Expect = 1e-10
 Identities = 72/264 (27%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +    + +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFR 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY--LD-------------- 173
            Y                          N   GEFG   LP   LD              
Sbjct: 121 TYPXXXXXXXXXXXXXXXXXXXXXXXXRNHITGEFGHFRLPVDALDILGADIPRVPCGCG 180

Query: 174 --GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F        +  +   +I+      +   +   ++F   L V + ++
Sbjct: 181 HRGCIENYISGRGFEWMYSHFYQHTLPATDIIAHYAAGEPKAVAHVERFMDVLAVCLGNL 240

Query: 226 MYTLDPEVIIIAGSIISAREFFEK 249
           +  LDP ++++ G + +  + +++
Sbjct: 241 LTMLDPHLVVVGGGLSNFEKIYQE 264


>NAGK_HAEIN RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 57.4 bits (137), Expect = 1e-10
 Identities = 77/288 (26%), Positives = 129/288 (44%), Gaps = 37/288 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPP---DAEHNAQSVIDVVINTIAKVFTSEVEGI 70
           G+DIGGTK+    V  E L   Y  ++P    D E    +++D+V     K    EV  +
Sbjct: 4   GLDIGGTKIELA-VFNEKLEKLYSERVPTPKTDYEEWLNTIVDLVNRADEKF--GEVGTV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+G+P   +++ G+  ++ NI+      +   L       V  +NDANCFA+ +    + 
Sbjct: 61  GLGVPGFVNQQTGLA-EIANIRVADNKPILCDLSTRLGREVRAENDANCFALSEAWDTEN 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLP----------------YLDG 174
           +QY                     +       AGE G L                 Y  G
Sbjct: 120 QQYSXXXXXXXXXXXXXXXXXXXKVHSGQVGMAGELGHLQLNYHALKLLGWDNAPIYQCG 179

Query: 175 -----ILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIK 223
                 L++Y SG+ F      +K   +   +I+     +++  ++    F +   ++I 
Sbjct: 180 CGNKACLDNYLSGRGFEMLYQDLKGETLSARKIINLFYQSNESAVDFVNLFVELAAISIG 239

Query: 224 SIMYTLDPEVIIIAGSIISAREFFE---KAMWDEIKTFAFINQLKKLK 268
           +I+   DP +I++ G + +    +E   KA+   +   A +  +KK K
Sbjct: 240 NIITAFDPHMIVLGGGLSNFDYLYEALPKALPPHLMRKAKVPPIKKAK 287


>NAGK_SHIBS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 56.2 bits (134), Expect = 3e-10
 Identities = 75/256 (29%), Positives = 113/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F      +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCR-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F               EI+      D+      +++   L V++ +
Sbjct: 180 GQHGCIENYLSGRGFAWXXXXXXXXXXXAPEIIALYNQGDEQARAHVERYLDLLAVSLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ERWT9 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 56.2 bits (134), Expect = 3e-10
 Identities = 73/255 (28%), Positives = 111/255 (43%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRV-CGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGIGV 72
           G DIGG+K+  G       L+       P D      + ID +    A  F      +G+
Sbjct: 4   GFDIGGSKIALGVYNAHRQLIWQRRVATPKDDYAQLLAAIDTLTQQ-ADGFCGVRGSVGI 62

Query: 73  GIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQ 132
           G+P +   + G ++   NI + +   L+  L A     V IDNDANCFA+ +    +  Q
Sbjct: 63  GVPGLPIADDGTIFSA-NIPAARGRTLRADLSARLGREVRIDNDANCFALSEAWDDEFMQ 121

Query: 133 YENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGM--------------LPYLD----- 173
           Y                      +   N   GE G               +P L      
Sbjct: 122 YPXXXXXXXXXXXXXXXXXXXKPVTGRNYVVGELGHMRLPVDALRVLGRDIPLLPCGCGK 181

Query: 174 -GILEDYCSG-------QFFIKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
            G +E Y SG        +F +K      EI++R    D D +   +++ + L V + +I
Sbjct: 182 YGCIEGYLSGNGFSWLWHYFYQKTH-SAPEIIRRYYEGDTDALAHTERYRELLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  LDP ++++ G +
Sbjct: 241 LTLLDPHLVVLGGGL 255


>NAGK_ECO7I RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 56.2 bits (134), Expect = 3e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-ASNVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_VIBCH RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 302

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 71/267 (26%), Positives = 124/267 (46%), Gaps = 37/267 (13%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G D+GGTK+  G    E L      ++    +  A+ +++ +   + K      VEG +G
Sbjct: 4   GFDVGGTKIEFGAF-NEQLERVATERVATPTDDYAK-LVETIAGLVHKYDAQFGVEGTVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + D + G V  V N+ + +   L+  LE +    V ++NDANCFA+ +    + K
Sbjct: 62  LGIPGMEDADNGCVLTV-NVPAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELK 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGML--------------PYL----- 172
           +  + +                 +    N  AGE G +              P L     
Sbjct: 121 EAASVMXXXXXXXXXXXXXXXXKVFSGRNHVAGEIGHMRLPIDAWFHLGEKAPLLGCGCG 180

Query: 173 -DGILEDYCSGQFF---------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAI 222
             G +++Y SG+ F          KK   + ++I+   +  +   +   ++F + L +  
Sbjct: 181 NKGCMDNYLSGRGFELLYEHYYGEKK---KAIDIITAQKEGESKAVEHVERFMELLAICF 237

Query: 223 KSIMYTLDPEVIIIAGSIISAREFFEK 249
            +I    DP V+++ G + +    +E+
Sbjct: 238 ANIFTANDPHVVVLGGGLSNYDLIYEE 264


>NAGK_SHIDS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOUT RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOSM RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOSE RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOLU RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOLI RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOLC RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOL5 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOK1 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOHS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECODH RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECOBW RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO8A RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO81 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO55 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO45 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO27 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYSXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIAFYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO24 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.8 bits (133), Expect = 4e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGQPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>XYLR_CALSR RecName: Full=Putative xylose repressor;
          Length = 399

 Score = 55.5 bits (132), Expect = 5e-10
 Identities = 59/214 (27%), Positives = 101/214 (47%), Gaps = 30/214 (14%)

Query: 79  DREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVX 138
           ++  G V    N+K WQ++ LK ++E+ F +PV+IDN+AN  A+G++ +G      + + 
Sbjct: 152 EKNSGTVLLAPNLK-WQDVPLKRMVESRFGLPVYIDNEANAGALGEKWFGGWGDVSHLLY 210

Query: 139 XXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPYLD--------GILEDYCSGQ---FF 185
                             + +   AGE G   + + D        G LE++ S +     
Sbjct: 211 XXXXXXXXXXXXXXXXXYRGAKGFAGEVGHMTIDFNDDVCSCGNVGCLENFASERALLSL 270

Query: 186 IKKIGVEGVE----------------ILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTL 229
           IK +   GVE                I++ A    +  +N        LG+ I +++   
Sbjct: 271 IKTLVESGVEDEYINRDTVEEMDAGYIIQSALQRSRVAMNAITDIANKLGIGIANLVNIF 330

Query: 230 DPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQ 263
           +P++++I        + F + +   +   AFI Q
Sbjct: 331 NPDIVVIGNKASFMGDLFLEELRRIVYKRAFITQ 364


>NAGK_SALHS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.5 bits (132), Expect = 5e-10
 Identities = 75/256 (29%), Positives = 118/256 (46%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIP-PDAEHNAQSVIDVVINTIAKVFTS-EVEG-I 70
           G DIGGTK+  G       L  +  ++P P A ++A   +D V   +A+      V+G +
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ-WEKRVPTPHASYSA--FLDAVCELVAEADQRFGVKGSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY----------------- 171
            QY                      +   +   GEFG   LP                  
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGC 179

Query: 172 -LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLLVIGGGL 255


>NAGK_ECOL6 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.5 bits (132), Expect = 5e-10
 Identities = 75/256 (29%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADRRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGRPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQYGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_SALPK RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.1 bits (131), Expect = 7e-10
 Identities = 75/256 (29%), Positives = 117/256 (45%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIP-PDAEHNAQSVIDVVINTIAKVFTS-EVEG-I 70
           G DIGGTK+  G       L  +  ++P P A + A   +D V   +A+      V+G +
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ-WEKRVPTPHASYGA--FLDAVCELVAEADQRFGVKGSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY----------------- 171
            QY                      +   +   GEFG   LP                  
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGC 179

Query: 172 -LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQMGCIENYLSGRGFAWLYQHYYHQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLLVIGGGL 255


>NAGK_SALPC RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.1 bits (131), Expect = 7e-10
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGAFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALPA RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.1 bits (131), Expect = 7e-10
 Identities = 75/256 (29%), Positives = 117/256 (45%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIP-PDAEHNAQSVIDVVINTIAKVFTS-EVEG-I 70
           G DIGGTK+  G       L  +  ++P P A + A   +D V   +A+      V+G +
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ-WEKRVPTPHASYGA--FLDAVCELVAEADQRFGVKGSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY----------------- 171
            QY                      +   +   GEFG   LP                  
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGC 179

Query: 172 -LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQMGCIENYLSGRGFAWLYQHYYHQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLLVIGGGL 255


>NAGK_SALCH RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.1 bits (131), Expect = 7e-10
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGAFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALAR RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 55.1 bits (131), Expect = 7e-10
 Identities = 74/255 (29%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV-FTSEVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADLRFGVKGAVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A  +  V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLERDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      DK      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYHQSLQAPEIIALWEQGDKQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP +++I G +
Sbjct: 241 LTIVDPCLLVIGGGL 255


>NAGK_SALPB RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.7 bits (130), Expect = 9e-10
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAQAHVERYLNLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_ESCF3 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.7 bits (130), Expect = 9e-10
 Identities = 75/256 (29%), Positives = 114/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+       ++   L V + +
Sbjct: 180 GQIGCIENYLSGRGFAWLWQHYYHQPLQAPEIIALWEEGDERAQAHVDRYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO5E RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.7 bits (130), Expect = 9e-10
 Identities = 75/256 (29%), Positives = 114/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           +   EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLPAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_ECO57 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.7 bits (130), Expect = 9e-10
 Identities = 75/256 (29%), Positives = 114/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           +   EI+      D+      +++   L V + +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLPAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_CITK8 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.7 bits (130), Expect = 9e-10
 Identities = 73/255 (28%), Positives = 116/255 (45%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G    E  L     K  P      ++ +  V + +A+     +V+G +G
Sbjct: 4   GFDIGGTKIALGVFDNERRLR--WEKRVPTPREGYEAFLTAVCDLVAEADQRFDVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG-MLPYLD----------------- 173
           QY                      +   +   GEFG M   +D                 
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGCSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 174 --GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QLGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALWEQGDERARAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLVVIGGGL 255


>NAGK_SALSV RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.3 bits (129), Expect = 1e-09
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALG2 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.3 bits (129), Expect = 1e-09
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRLGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALEP RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.3 bits (129), Expect = 1e-09
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALA4 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 54.3 bits (129), Expect = 1e-09
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SHIFL RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 53.1 bits (126), Expect = 3e-09
 Identities = 74/256 (28%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGKLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                      +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXXXXKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V++ +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVSLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_SHIF8 RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 53.1 bits (126), Expect = 3e-09
 Identities = 74/256 (28%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGKLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                      +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXXXXKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V++ +
Sbjct: 180 GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVSLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +DP++++I G +
Sbjct: 240 ILTIVDPDLVVIGGGL 255


>NAGK_SHISS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 74/256 (28%), Positives = 114/256 (44%), Gaps = 33/256 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G DIGGTK+  G       L     K  P    +  + +D V   +A+    F  +   +
Sbjct: 4   GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEADQRFGCK-GSV 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKG 130
           G+GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    + 
Sbjct: 61  GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF 119

Query: 131 KQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY-------LD-------- 173
            QY                   G  +   +   GEFG   LP        LD        
Sbjct: 120 TQYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGC 179

Query: 174 ---GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
              G +E+Y SG+ F           ++  EI+      D+      +++   L V + +
Sbjct: 180 GQIGCIENYLSGRGFAWLWQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN 239

Query: 225 IMYTLDPEVIIIAGSI 240
           I+  +D ++++I G +
Sbjct: 240 ILTIVDSDLVVIGGGL 255


>NAGK_SALTY RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   + +      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALNS RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   + +      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_SALDC RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 31/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   + +      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                      +   +   GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXXKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG 180

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 181 QMGCIENYLSGRGFAWLYQHYYHQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 240

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 241 LTIVDPDLLVIGGGL 255


>NAGK_PASMU RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 70/264 (26%), Positives = 119/264 (45%), Gaps = 32/264 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+    V  + L   Y  ++    E + +  ++ ++  + K     + +G +G
Sbjct: 4   GFDIGGTKIELA-VFNDQLEKQYSERVETPKE-SYEEWLNTIVRLVHKADEMFQCQGTVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP   +   GI  ++ NI++     + + LE      V  +NDANCFA+ +    +  
Sbjct: 62  LGIPGFVNPATGIA-EIVNIRAADHKPIIQDLETRLGREVRAENDANCFALSEAWDEENA 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG-------MLPYLDG---------- 174
           QY +                   +       AGE G        L  L G          
Sbjct: 121 QYPSVXXXXXXXXXXXXXXXXXKVHSGQTGMAGEVGHTQLNYHALRLLGGDNAPIYDCGC 180

Query: 175 ----ILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKS 224
                L+ Y SG+ F      ++   +    I++R    D+  +   + F +   ++I +
Sbjct: 181 GNRACLDTYLSGRGFEMLYRDMQGEALSAQAIIQRFYAGDQSAVKFVELFIELCAISIGN 240

Query: 225 IMYTLDPEVIIIAGSIISAREFFE 248
           ++  LDP VI++ G + +    +E
Sbjct: 241 LITVLDPHVIVLGGGLSNFDYLYE 264


>MAK_ECOLI RecName: Full=Fructokinase;         EC=2.7.1.4;AltName:
           Full=D-fructose kinase;AltName:
           Full=Manno(fructo)kinase;
          Length = 302

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 59/277 (21%), Positives = 109/277 (39%), Gaps = 35/277 (12%)

Query: 13  VGVDIGGTKVNAGRV--CGENLLDSYLSKIPPDAEHNAQSVIDVV-INTIAKVFTSEVEG 69
           +G+D+GGTK     +   GE L   Y  ++P   +   Q++  +  +  +A+  T +   
Sbjct: 3   IGIDLGGTKTEVIALGDAGEQL---YRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGT 59

Query: 70  IGVGIPSVADREKGIVYDVQNIKSWQEIH-LKEILEAEFKVPVFIDNDANCFAIGQRLYG 128
           +G+GIP       G+V +  +  +W       + L A  +  V + NDANC A+ + + G
Sbjct: 60  VGMGIPGSISPYTGVVKNANS--TWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDG 117

Query: 129 KGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPYLD------------- 173
                +                  G      N  AGE+G   LP++D             
Sbjct: 118 AAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCY 177

Query: 174 ----GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIK 223
               G +E + SG  F      +    ++G EI++    +D                ++ 
Sbjct: 178 CGKQGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVXXXXXXXXXXXXXKSLA 237

Query: 224 SIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAF 260
            ++  LDP+VI++ G + +    ++  +   IK F F
Sbjct: 238 HVVNILDPDVIVLGGGMSNVDRLYQ-TVGQLIKQFVF 273


>NAGK_VIBSL RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 302

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 71/266 (26%), Positives = 115/266 (43%), Gaps = 35/266 (13%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G D+GGTK+  G    E L      ++P   E + Q ++D +   + K       EG IG
Sbjct: 4   GFDVGGTKIEFGAF-NEKLERVATERVPTPTE-DYQLLLDTIAGLVKKYDNEFSCEGKIG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +G+P + D + G +  V N+ +     L++ LEA     V I+NDANCFA+ +    + K
Sbjct: 62  LGLPGMEDADDGTML-VVNVPASTGKPLRKDLEALIGRSVKIENDANCFALSEAWDDELK 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGML---------------------- 169
              +                   +    N  AGE G +                      
Sbjct: 121 DEPSVAXXXXXXXXXXXXXXXXKVFSGRNHVAGELGHMRLPLDAWFHLGDNAPXXXXXXX 180

Query: 170 ------PYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIK 223
                  YL G   +     +F +K   + +EI++     +        +F + L +   
Sbjct: 181 XXXXXDSYLSGRGFELIYEHYFGEK--KKAIEIIQAYNEGESKAAEHVDRFMELLAICFA 238

Query: 224 SIMYTLDPEVIIIAGSIISAREFFEK 249
           ++   LDP V+ + G + +    +E+
Sbjct: 239 NLFTGLDPHVVALGGGLSNFELIYEE 264


>NAGK_SALTI RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 302

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 74/255 (29%), Positives = 113/255 (44%), Gaps = 32/255 (12%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEG-IG 71
           G DIGGTK+  G       L     K  P    +  + +D V   +A+      V+G +G
Sbjct: 4   GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
           +GIP + + E G +Y   N+ +     L+  L A     V +DNDANCFA+ +    +  
Sbjct: 62  IGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG--MLPY------------------ 171
           QY                     +   S    GEFG   LP                   
Sbjct: 121 QYPXXXXXXXXXXXXXXXXXXKPITGQSYI-TGEFGHMRLPVDALTLMGFDFPLRRCGCG 179

Query: 172 LDGILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F           ++  EI+      D+      +++   L V + +I
Sbjct: 180 QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI 239

Query: 226 MYTLDPEVIIIAGSI 240
           +  +DP++++I G +
Sbjct: 240 LTIVDPDLLVIGGGL 254


>NAGK_YERPN RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 256

 Score = 50.1 bits (118), Expect = 2e-08
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 5/113 (4%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQ 124
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSE 113


>NAGK_YERPE RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 256

 Score = 50.1 bits (118), Expect = 2e-08
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 5/113 (4%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQ 124
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSE 113


>NAGK_YERPA RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 256

 Score = 50.1 bits (118), Expect = 2e-08
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 5/113 (4%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVV--INTIAKVFTSEVEGIG 71
           G D+GGTK+  G V  ENL   +  ++P   E   Q ++ ++  +   A  +      +G
Sbjct: 4   GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILRDLTEEADTYCGVQGSVG 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQ 124
           +GIP + + + G V+   N+ S     L+  L    +  V IDNDANCFA+ +
Sbjct: 62  IGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSE 113


>XYLR_LACPE RecName: Full=Xylose repressor;
          Length = 388

 Score = 48.5 bits (114), Expect = 7e-08
 Identities = 43/177 (24%), Positives = 77/177 (43%), Gaps = 17/177 (9%)

Query: 83  GIVYDVQNIKS-WQEIHLKEILE---AEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVX 138
           GI+ D Q + S W ++H  +I++   AEF VPV ++N+AN  AI +R +  G  Y N + 
Sbjct: 153 GIINDNQIVHSPWIDMHDIDIVKQFKAEFDVPVILENEANLSAIYERDFNAGLDYRNSIT 212

Query: 139 XXXXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDG------ILEDYCSGQFFIKKI--- 189
                           L +     AGE G    L G       +E  CS +  I ++   
Sbjct: 213 LSIHRGIGAGIILDKHLFRGKQGEAGEVGRSLTLLGPNTAGQSVESICSEEAIINRVKRI 272

Query: 190 ----GVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSIIS 242
                     +++  + +D++   I  Q    +   I +++ TL+P+ I I   +++
Sbjct: 273 KQDETTNRQTVVQLYQQHDREVERILSQSCSVIAGLIYNVVTTLNPDAIFINSELLA 329


>NAGK_VIBVY RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 47.4 bits (111), Expect = 1e-07
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 7/114 (6%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G D+GGTK+  G       L+   ++  P    +   +++ +   +AK    F  E + I
Sbjct: 4   GFDVGGTKIEFGAF--NEKLERVATERVPTPTDDYPLLLETIAGLVAKYDQEFACEGK-I 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQ 124
           G+G+P + D +   V  V N+ + +   L+  LEA+    V I+NDANCFA+ +
Sbjct: 61  GLGLPGMEDADDATVLTV-NVPAAKGKPLRADLEAKIGRSVKIENDANCFALSE 113


>NAGK_VIBVU RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 303

 Score = 47.4 bits (111), Expect = 1e-07
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 7/114 (6%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKV---FTSEVEGI 70
           G D+GGTK+  G       L+   ++  P    +   +++ +   +AK    F  E + I
Sbjct: 4   GFDVGGTKIEFGAF--NEKLERVATERVPTPTDDYPLLLETIAGLVAKYDQEFACEGK-I 60

Query: 71  GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQ 124
           G+G+P + D +   V  V N+ + +   L+  LEA+    V I+NDANCFA+ +
Sbjct: 61  GLGLPGMEDADDATVLTV-NVPAAKGKPLRADLEAKIGRSVKIENDANCFALSE 113


>MLC_ECOLI RecName: Full=Protein mlc;AltName: Full=Making large
           colonies protein;
          Length = 406

 Score = 44.3 bits (103), Expect = 1e-06
 Identities = 45/237 (18%), Positives = 89/237 (37%), Gaps = 31/237 (13%)

Query: 51  VIDVVINTIAKVFT------SEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILE 104
           ++D +I+ I + F         +  I + +P + D E GIV+ +   +  +E+ L E LE
Sbjct: 124 LLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALE 183

Query: 105 AEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAG 164
               VPV+I +D + + + + L+G  +   + +               G LL   +    
Sbjct: 184 QHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLV 243

Query: 165 EFGMLPYLDGILEDYCSGQFFIKKI-GVEGVEILKRARNNDKDTINIYKQ---------- 213
           E G           YC     ++ I  V+ +  L + R N   +  ++ Q          
Sbjct: 244 EIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQA 303

Query: 214 --------------FGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIK 256
                          G H+G  +  ++   +P+ I+I   +  A +     + D I+
Sbjct: 304 ALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIR 360


>GLK_STAXY RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
           Full=Glucose kinase;
          Length = 328

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 53/168 (31%), Positives = 82/168 (48%), Gaps = 12/168 (7%)

Query: 9   NRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHN-------AQSVIDVVINTIAK 61
           N+ ++  DIGGT    G +  ENL  + LSK   D + +        +++ D  I  I K
Sbjct: 2   NKIILAADIGGTTCKLG-IFDENL--NRLSKWSIDTDTSDTTGYLLLKNIYDSFIQHIDK 58

Query: 62  VFT--SEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANC 119
                S+V           + E G V    N+     +++++I +     PV++DNDAN 
Sbjct: 59  SDNTFSDVLXXXXXXXXXXNFETGEVNGAVNLYWKGTVNVRDIFKQFVDCPVYVDNDANV 118

Query: 120 FAIGQRLYGKGKQYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFG 167
            A+G++  G G   ++ V             + G ++   N    E G
Sbjct: 119 AALGEKHKGAGNGADDVVAXXXXXXXXXXXXSNGEIVHGHNGSGAEIG 166


>SCRK_BACSU RecName: Full=Putative fructokinase;       
           EC=2.7.1.4;AltName: Full=Glucomannan utilization protein
           E;
          Length = 299

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 61/252 (24%), Positives = 101/252 (40%), Gaps = 35/252 (13%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTS-EVEGIGV 72
           G++ GGTK     VC     D  +     D       + D  I  + + F+   ++ IG+
Sbjct: 4   GIEAGGTKF----VCAVGREDGTII----DRIEFPTKMPDETIEKVIQYFSQFSLQAIGI 55

Query: 73  GIPSVADREK-----GIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLY 127
           G     D +K     G +        W+     + ++ E K+PV    D N  A+G+ L+
Sbjct: 56  GSFGPVDNDKTSQTYGTITATPKA-GWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLF 114

Query: 128 GKGKQYENFVXXXXXXXXXXXXXNKGSLLKD-SNCGAGEF-----------GMLPYLDGI 175
           G+ K  ++ +              +G LL+  S+   G             G  PY    
Sbjct: 115 GEAKGLDSCLYXXXXXXXXXXXXVEGRLLQGLSHPEMGHIYIRRHPDDVYQGKCPYHGDC 174

Query: 176 LEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPEVII 235
            E   SG     + G +  ++         D   +++  G               P+ II
Sbjct: 175 FEGLASGPAIEARWGKKAADL--------SDIAQVWELEGXXXXXXXXXXXXXXXPKKII 226

Query: 236 IAGSIISAREFF 247
           + G ++  ++ F
Sbjct: 227 LGGGVMQQKQVF 238


>NAGK_ERWCT RecName: Full=N-acetyl-D-glucosamine kinase;       
           EC=2.7.1.59;AltName: Full=GlcNAc kinase;
          Length = 304

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 63/263 (23%), Positives = 105/263 (39%), Gaps = 31/263 (11%)

Query: 14  GVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTI--AKVFTSEVEGIG 71
           G D+GGTK+  G    E  L+    K  P   +N   ++ ++I+ +  A           
Sbjct: 4   GFDMGGTKIELGVFDAE--LNKVWQKRVPTPRNNYDDLLAMLIDLVHEADAXXXXXXXXX 61

Query: 72  VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK 131
                    ++G ++   N+ +     L+  L    +  V I NDANCF + +    + +
Sbjct: 62  XXXXXXXTGDEGALFTA-NLPATMGKPLRIDLSQRLQRDVRISNDANCFVLSEAWDAEFR 120

Query: 132 QYENFVXXXXXXXXXXXXXNKGSLLKDSNCGAGEFGML----PYLD-------------- 173
            Y                      +   N  AGEFG L      LD              
Sbjct: 121 SYPXXXXXXXXXXXXXXXXXXXRPVDGRNGIAGEFGHLRLPSDALDIIGVDIPRVKCGCG 180

Query: 174 --GILEDYCSGQFF------IKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSI 225
             G +E+Y SG+ F      +    +  V I++  R  ++  +    +F           
Sbjct: 181 QFGCIENYISGRGFEWLYEHLYGEALPAVTIIRHYRGGEEKALEFVDRFMDXXXXXXXXX 240

Query: 226 MYTLDPEVIIIAGSIISAREFFE 248
               DP ++++ G + +  E ++
Sbjct: 241 XXXFDPHLLVLGGGLSNFDEIYQ 263


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.335    0.148    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,995,627,097
Number of extensions: 360975995
Number of successful extensions: 1022783
Number of sequences better than 1.0e-03: 22482
Number of HSP's gapped: 992620
Number of HSP's successfully gapped: 27456
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)