# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_13441.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACD30317.1  [L=484]
Description: ftul2 trkH GIB00719CH01 "K+ transporter (Trk) family protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.6e-43  151.3  28.5    7.8e-43  149.0  13.4    2.4  2  PF02386  Cation transport protein
  ------ inclusion threshold ------
       0.87   11.8   0.1         50    6.1   0.0    3.0  2  PF04505  Interferon-induced transmembrane protein
         17    7.6   0.0         36    6.5   0.0    1.4  1  PF05808  Podoplanin
         19    7.9   0.4         87    5.8   0.3    2.0  1  PF09398  FOP N terminal dimerisation domain
         58    6.1   3.3    3.1e+02    3.7   2.3    2.3  1  PF06422  CDR ABC transporter
         66    5.5   0.0      1e+02    4.9   0.0    1.2  1  PF01555  DNA methylase
         79    5.2   0.2    3.4e+02    3.2   0.1    2.1  1  PF09879  Predicted membrane protein (DUF2106)
         79    5.4   1.4    3.9e+02    3.1   1.0    2.2  1  PF10726  Protein of function (DUF2518)
    1.1e+02    5.1   2.0    5.7e+02    2.9   1.4    2.2  1  PF07234  Protein of unknown function (DUF1426)
    1.6e+02    5.0   1.3    3.2e+02    4.1   0.9    1.4  1  PF07377  Protein of unknown function (DUF1493)
    1.9e+02    3.0   0.0    2.9e+02    2.4   0.0    1.1  1  PF03917  Eukaryotic glutathione synthase, ATP binding domain
    4.1e+02    4.1   0.0    9.4e+02    3.0   0.0    1.6  1  PF08241  Methyltransferase domain
    4.6e+02    2.9   0.1      1e+03    1.8   0.1    1.4  1  PF11438  36-mer N-terminal peptide of the N protein (N36)
      6e+02    0.5   1.6    9.3e+02   -0.1   1.1    1.2  1  PF05758  Ycf1
    1.6e+03    1.7   0.8    3.8e+03    0.5   0.6    1.5  1  PF07123  Photosystem II reaction centre W protein (PsbW)


Domain and alignment annotation for each model:
>> PF02386  Cation transport protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    7.5   1.1    0.0013       8.9     254     295 ..      72     113 ..      40     123 .. 0.75
   2 !  149.0  13.4   1.2e-46   7.8e-43       2     339 .]     153     482 ..     152     482 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0013
     PF02386 254 llvflllfiivilegllLslleedpffldilfevvSAfGtVG 295
                 ++ ++  f++v+ ++ ++s  + + +f +++fe vS f t G
  ACD30317.1  72 IVTLVWIFVTVFGAIPYMSFPGLNLSFTNAVFESVSGFTTTG 113
                 333344455555555566665555559***********9998 PP

  == domain 2    score: 149.0 bits;  conditional E-value: 1.2e-46
     PF02386   2 lggseyrslkrlikilvvylfiieiiafvlllililtvklyseavr..kkggsalwdalfhslSafnnaGfsltseSlvsfnkavviqlvlifliilGg 98 
                 lg ++++++k+++++  ++ +i + i+ +++ ++++++ l+  + +    +g + +da++ ++S+++++Gf   ++S+ +  k +  ++v++++++lG+
  ACD30317.1 153 LGVGGMQLYKAEVSGQWKDDKIAPKISSTAKALWMVYLLLTFLCFIsyLLVGVEPFDAICYTFSTVSTGGFAPSDASMTD--KPLGMLIVCAIFLFLGA 249
                 78899***************************************99776778899**********************985..668************** PP

     PF02386  99 igFpvllrlliwikkkikkkelslflkdhprrtfl.llllsfvtllllevlavlnvlkslslgsrvlnaffqvvs.trtaGfsvv.dlsqlspaikvll 194
                 ++F  ++ +l+++k       +s ++++++++ ++ +l++  ++++++ +++ +   +   + s+v n++fqv+s + +aGf +  ++  ++++  ++l
  ACD30317.1 250 TSFKAHYIALSKFK-------ISHYFRNIEFKAYFyFLFFTSFIVCITIITHTN---DLSNIFSIVTNSIFQVISiSSSAGFVSDnNYYLWPSFLPIML 338
                 *************9.......777777777777765666666666666666666...5555566666666666552789***9872578999999**** PP

     PF02386 195 mllMfiGgspgstaggiktvtfavilkal.keikraelpgakevkkfkgrslreqlvedallvflllfiivilegllLslleedpffldilfevvSAfG 292
                 m++++iGg+ gstagg+k++++ +  +    e  r ++p+ + ++k+++ +++eq++ ++  ++++++ii+   +l+L  ++ d    +++  ++++++
  ACD30317.1 339 MFIAIIGGCGGSTAGGLKMIRAILFKEKAiLEARRVIHPQGVFTVKLGDIHISEQALNRVSGFISVYIIIFAGGWLALLGCGLDI--PTAFSTIATTLS 435
                 *********************87776666899***************************************************99..99********** PP

     PF02386 293 tVGLSlGittknlslsptlgklvlillmiiGRleilpvlllfaiklp 339
                 +VG++lG + +n++ +p+ + ++  ++mi GRlei+++l+lf++ ++
  ACD30317.1 436 NVGPGLGDIGSNFKNLPKEALWICNFAMIAGRLEIFTILVLFMPDFW 482
                 ******************************************98776 PP

>> PF04505  Interferon-induced transmembrane protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.15     1e+03      20      52 ..      40      68 ..      37      69 .. 0.90
   2 ?    6.1   0.0    0.0075        50      51      81 ..     170     200 ..     140     201 .. 0.80

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.15
     PF04505 20 vlsilstlcCclPlGivAivfsvkvrdalaaGD 52
                vls ++t++C    G++  + s k++++l   D
  ACD30317.1 40 VLSFTVTFLC----GFLLWFISRKSNKKLSNRD 68
                899******9....9**99*******9998766 PP

  == domain 2    score: 6.1 bits;  conditional E-value: 0.0075
     PF04505  51 GDiegAqraSstAkllnivaivlgvvliill 81 
                  D + A + SstAk l +v ++l+++++i +
  ACD30317.1 170 KDDKIAPKISSTAKALWMVYLLLTFLCFISY 200
                 5778899*******************99987 PP

>> PF05808  Podoplanin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0054        36     118     144 ..      62      88 ..      57      92 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0054
     PF05808 118 ettdkkdGlavvtlvGiivGvllaigf 144
                 ++ +++dG+ +vtlv i v v+ ai +
  ACD30317.1  62 KKLSNRDGFLIVTLVWIFVTVFGAIPY 88 
                 66789****************999865 PP

>> PF09398  FOP N terminal dimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.3     0.013        87      10      47 ..      61     109 ..      55     114 .. 0.74

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.013
     PF09398  10 kkvlstkeGRlvaeLikefLeff...........eldftlavfqpEasl 47 
                  k ls ++G l+  L+  f+ +f           +l+ft+avf++ +++
  ACD30317.1  61 NKKLSNRDGFLIVTLVWIFVTVFgaipymsfpglNLSFTNAVFESVSGF 109
                 46788889999999988888877555555556668999****9987665 PP

>> PF06422  CDR ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   2.3     0.047   3.1e+02      36      78 ..     256     297 ..     248     310 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.047
     PF06422  36 YleesysYekshlwrnfgiliaflvfflivylilteliksaks 78 
                 Y++   +++ sh  rn+     f ++f++  ++++ +i++++ 
  ACD30317.1 256 YIAL-SKFKISHYFRNIEFKAYFYFLFFTSFIVCITIITHTND 297
                 6663.489************99999999999999999988766 PP

>> PF01555  DNA methylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.015     1e+02      34      64 ..     363     396 ..     353     449 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.015
                 HHHHHHHHHHHHB-----EEEEE-HHCHH-...H CS
     PF01555  34 flekvlkevrrvLkddgsifiniddseikk...e 64 
                 f ek + e+rrv  ++g++ +  +d+ i++   +
  ACD30317.1 363 FKEKAILEARRVIHPQGVFTVKLGDIHISEqalN 396
                 6789999*******************99874440 PP

>> PF09879  Predicted membrane protein (DUF2106)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.05   3.4e+02      10      45 ..       3      38 ..       1      46 [. 0.90

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.05
     PF09879 10 lskpenlprlfalllalvlllgllvplslnedqlyp 45
                ls+  ++  +f ++l l +l  llv + ++ed  yp
  ACD30317.1  3 LSQKPKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYP 38
                788889999*************************98 PP

>> PF10726  Protein of function (DUF2518)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   1.0     0.059   3.9e+02      13      56 ..     278     321 ..     268     326 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.059
     PF10726  13 wlaiatlllavltvlafilkwglrFrlvGvtsFtllLtvslfal 56 
                 ++ ++t +++++t++++       F +v  ++F ++   s+ ++
  ACD30317.1 278 YFLFFTSFIVCITIITHTNDLSNIFSIVTNSIFQVISISSSAGF 321
                 5678999***************************9988888777 PP

>> PF07234  Protein of unknown function (DUF1426)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   1.4     0.085   5.7e+02      12      28 ..     276     292 ..     270     304 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.085
     PF07234  12 fewflffgaifiaitil 28 
                 + +flff++ ++ iti+
  ACD30317.1 276 YFYFLFFTSFIVCITII 292
                 458*************8 PP

>> PF07377  Protein of unknown function (DUF1493)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.9     0.048   3.2e+02      52      77 ..     252     277 ..     249     289 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.048
     PF07377  52 fkkFnVdlsnfeierYFkpeeespls 77 
                 fk+  ++ls+f+i+ YF++ e++  +
  ACD30317.1 252 FKAHYIALSKFKISHYFRNIEFKAYF 277
                 567789***********987776544 PP

>> PF03917  Eukaryotic glutathione synthase, ATP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0     0.043   2.9e+02     343     388 ..     357     402 ..     355     405 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.043
                 -ECEEEEE-TTEEEEEEEEEEB-----EEEE..TTEEEEE------ CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF03917 343 lsenillradeklekeevisElGiygtylrnikkdevivneqsGyl 388
                 ++++il + +  le ++vi   G++ + l +i+  e   n  sG++
  ACD30317.1 357 MIRAILFKEKAILEARRVIHPQGVFTVKLGDIHISEQALNRVSGFI 402
                 678999**99999********************9999999999997 PP

>> PF08241  Methyltransferase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.14   9.4e+02      77      94 ..     365     382 ..     357     383 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.14
     PF08241  77 ekalkeiaRvLkpgGllv 94 
                 eka+ e++Rv+ p G++ 
  ACD30317.1 365 EKAILEARRVIHPQGVFT 382
                 7999***********985 PP

>> PF11438  36-mer N-terminal peptide of the N protein (N36)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.1      0.15     1e+03      11      22 ..     163     174 ..     162     182 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.15
                 HHHHHHHHHT-G CS
     PF11438  11 AEKQAQWKAdri 22 
                 AE   QWK d+i
  ACD30317.1 163 AEVSGQWKDDKI 174
                 78889***9997 PP

>> PF05758  Ycf1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   1.1      0.14   9.3e+02     124     164 ..      15      55 ..      12      65 .. 0.90

  Alignments for each domain:
  == domain 1    score: -0.1 bits;  conditional E-value: 0.14
     PF05758 124 ilLpssvlaRLvniylfrcnnkilFvtSsfvgWliGhilfi 164
                 ++L   +l+ L+  y++  +n   Fv+S  v +l+G +l +
  ACD30317.1  15 MFLSLTMLSPLLVDYIYDEDNAYPFVLSFTVTFLCGFLLWF 55 
                 5788899999**************************99864 PP

>> PF07123  Photosystem II reaction centre W protein (PsbW)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.6      0.57   3.8e+03     102     114 ..      74      86 ..      69      91 .. 0.91

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 0.57
     PF07123 102 aLgwiLlgvfgli 114
                 +L wi ++vfg+i
  ACD30317.1  74 TLVWIFVTVFGAI 86 
                 699********98 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (484 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       617  (0.0517965); expected 238.2 (0.02)
Passed bias filter:                      193  (0.0162021); expected 238.2 (0.02)
Passed Vit filter:                        22  (0.00184688); expected 11.9 (0.001)
Passed Fwd filter:                        22  (0.00184688); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              15  [number of targets reported over threshold]
# CPU time: 0.30u 0.05s 00:00:00.35 Elapsed: 00:00:00
# Mc/sec: 3483.03
//