# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_13443.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACD30434.1  [L=167]
Description: ftul2 ACD30434.1 GIB00719CH01 "pilus assembly protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
       0.45   12.5   2.4       0.82   11.6   1.7    1.4  1  PF02687  Predicted permease
        2.9   10.0   0.3        3.3    9.9   0.2    1.2  1  PF03677  Uncharacterised protein family (UPF0137)
        6.4    9.4   0.3         22    7.7   0.1    2.0  1  PF08838  Protein of unknown function (DUF1811)
        8.3    7.8   1.2         13    7.2   0.9    1.4  1  PF07946  Protein of unknown function (DUF1682)
         10    8.0   0.8         11    7.8   0.5    1.2  1  PF04998  RNA polymerase Rpb1, domain 5
         11    8.9   1.6         20    8.0   1.1    1.5  1  PF10046  Biogenesis of lysosome-related organelles complex-1
         14    8.2   0.6         23    7.5   0.4    1.4  1  PF10238  E2F-associated phosphoprotein
         15    7.8   0.3         34    6.6   0.1    1.7  1  PF11103  Protein of unknown function (DUF2887)
         17    7.6   0.9         32    6.7   0.3    1.7  1  PF06249  Ethanolamine utilisation protein EutQ
         19    6.5   0.6         35    5.7   0.2    1.4  1  PF03739  Predicted permease YjgP/YjgQ family
         27    6.4   0.1         35    6.0   0.1    1.1  1  PF07470  Glycosyl Hydrolase Family 88
         34    6.4   0.1         50    5.9   0.1    1.2  1  PF04252  Predicted SAM-dependent RNA methyltransferase
         38    6.7   0.1    1.3e+02    5.0   0.1    1.9  1  PF08766  DEK C terminal domain
         45    6.8   0.2         81    6.0   0.1    1.3  1  PF04226  Transglycosylase associated protein
         61    5.7   1.9         78    5.3   1.3    1.1  1  PF07891  Protein of unknown function (DUF1666)
         61    5.5   0.1    1.2e+02    4.5   0.0    1.5  1  PF02474  Nodulation protein A (NodA)
         68    5.8   0.2    1.7e+02    4.5   0.1    1.8  1  PF00377  Prion/Doppel alpha-helical domain
         80    5.7   0.1    1.3e+02    5.1   0.0    1.4  1  PF08285  Dolichol-phosphate mannosyltransferase subunit 3 (D
         82    6.4   2.4      1e+02    6.1   1.2    1.5  1  PF03197  Bacteriophage FRD2 protein
         90    6.0   0.4    1.8e+02    5.0   0.2    1.6  1  PF01890  Cobalamin synthesis G C-terminus
    1.3e+02    4.7   0.3    2.5e+02    3.8   0.1    1.5  1  PF06042  Bacterial protein of unknown function (DUF925)
    1.3e+02    4.7   1.0    2.2e+02    4.0   0.7    1.3  1  PF11779  Protein of unknown function (DUF3317)
    1.3e+02    4.4   1.5    1.7e+02    4.1   1.1    1.1  1  PF02366  Dolichyl-phosphate-mannose-protein mannosyltransfer
    1.7e+02    3.6   0.1    2.8e+02    2.9   0.1    1.3  1  PF03189  Protein of unknown function, DUF270
      2e+02    4.9   0.3    2.9e+02    4.4   0.2    1.3  1  PF01820  D-ala D-ala ligase N-terminus
    2.2e+02    3.9   0.3    3.7e+02    3.2   0.2    1.3  1  PF02902  Ulp1 protease family, C-terminal catalytic domain
    2.3e+02    3.8   1.2    4.3e+02    3.0   0.2    1.7  1  PF05978  Ion channel regulatory protein UNC-93
    2.4e+02    4.4   0.8    4.2e+02    3.6   0.6    1.3  1  PF08590  Domain of unknown function (DUF1771)
    2.5e+02    4.2   0.0    3.6e+02    3.7   0.0    1.4  1  PF01889  Membrane protein of unknown function DUF63
    2.6e+02    3.5   0.7      4e+02    2.9   0.5    1.2  1  PF03208  PRA1 family protein
    3.5e+02    3.0   0.0    4.4e+02    2.6   0.0    1.1  1  PF00716  Assemblin (Peptidase family S21)
    6.2e+02    2.3   0.0    7.6e+02    2.0   0.0    1.1  1  PF02129  X-Pro dipeptidyl-peptidase (S15 family)
    6.5e+02    3.1   1.1    1.9e+03    1.6   0.7    1.7  1  PF00473  Corticotropin-releasing factor family
    6.7e+02    3.6   3.4    1.2e+03    2.8   2.3    1.4  1  PF03929  PepSY-associated TM helix
    1.1e+03    2.0   2.6    5.6e+02    2.9   0.3    1.6  1  PF05620  Protein of unknown function (DUF788)
    1.1e+03    2.2   2.6    2.1e+03    1.3   1.8    1.4  1  PF00746  Gram positive anchor


Domain and alignment annotation for each model:
>> PF02687  Predicted permease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.6   1.7    0.0003      0.82      48      86 ..      10      53 ..       1      55 [. 0.80

  Alignments for each domain:
  == domain 1    score: 11.6 bits;  conditional E-value: 0.0003
     PF02687 48 s...siillllllsvlilllavlilllllsisir..errkeigi 86
                    ++ ++l +l++l++l ++++ll++++++i+  +++ ei++
  ACD30434.1 10 AgfgIVESMLAALILLFVLSSGFLLLNSVLVNITleNKKDEIAT 53
                2355688999****************999999998888889987 PP

>> PF03677  Uncharacterised protein family (UPF0137)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.2    0.0012       3.3     161     218 ..      80     137 ..      40     159 .. 0.85

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.0012
     PF03677 161 kkvdvirkieGeskselldilrkelPllrekdveeaiesddrknkelsekllelL.kll 218
                  k  v++k +  +  e l+ ++++ Pl+   d+++  e+ d+kn++ + + ++++ k++
  ACD30434.1  80 IKTVVLEKQNEAKPEENLETVNRFKPLS-VADIRKMAEKADKKNQKAAANDVDIIyKVV 137
                 47778888888888999**********9.99*******999***999999998874444 PP

>> PF08838  Protein of unknown function (DUF1811)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.1    0.0079        22      15      46 ..     110     141 ..     100     162 .. 0.91

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0079
                 HHHHHHHHHHHHHH---HHHHHHHHHHHHHHH CS
     PF08838  15 eiaklkekarkaeqlGivnelavlerkialak 46 
                 +i k+ eka k +q+   n+++++ + + +a 
  ACD30434.1 110 DIRKMAEKADKKNQKAAANDVDIIYKVVNIAA 141
                 6999********************99999885 PP

>> PF07946  Protein of unknown function (DUF1682)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.9    0.0047        13     280     320 ..      85     124 ..      68     125 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0047
     PF07946 280 qEeaqekkeekkkeereaklaklsaeeqrKleeKerkkeer 320
                  E++ e+k e+  e  ++  + ls   +rK+ eK +kk+++
  ACD30434.1  85 LEKQNEAKPEENLETVNR-FKPLSVADIRKMAEKADKKNQK 124
                 466667777777777777.999*****************98 PP

>> PF04998  RNA polymerase Rpb1, domain 5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.5     0.004        11     159     225 ..      81     145 ..      16     165 .. 0.64

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.004
                 EEEEEEEEEEE-----EEEEEEEEEEEE---HHHHTT---.-ETTTEEES-HHHHHHH-------HH CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF04998 159 agekltdgrvdpeeklekkekelllktegtelqevyklqgvidndktvsndikeilkvlgIeaares 225
                 + +   +++  ++ +++ +  ++    ++ +++++ ++ +  +n+k   nd+  i+kv++I a  ++
  ACD30434.1  81 KTVV-LEKQNEAKPEENLETVNRFKPLSVADIRKMAEKAD-KKNQKAAANDVDIIYKVVNIAAIDNQ 145
                 2222.22223333334444555555668888888888888.88999999999999999988876554 PP

>> PF10046  Biogenesis of lysosome-related organelles complex-1 subunit 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   1.1    0.0072        20      22      75 ..      93     146 ..      77     161 .. 0.87

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0072
     PF10046  22 dlklLeklNeataekykeleqkakslekeleklkqkyeelkpylqqideieeqv 75 
                   + Le +N+     +++++++a++ +k+ +k+++ + ++  ++ +i +i++q+
  ACD30434.1  93 PEENLETVNRFKPLSVADIRKMAEKADKKNQKAAANDVDIIYKVVNIAAIDNQL 146
                 55679**********************************************996 PP

>> PF10238  E2F-associated phosphoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.4    0.0084        23      76     126 ..     107     154 ..      80     157 .. 0.73

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0084
     PF10238  76 kakkrkrnkkknekkkekakeeaeedeselyraVkCseCntevavldkdei 126
                 + ++ ++  +k++k   k+++ a +d + +y++V+    +++++v d  +i
  ACD30434.1 107 SVADIRKMAEKADK---KNQKAAANDVDIIYKVVNIAAIDNQLGVADCVKI 154
                 44444444444444...4445566799******************996555 PP

>> PF11103  Protein of unknown function (DUF2887)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.1     0.012        34     149     195 ..      45      95 ..      32     100 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.012
     PF11103 149 eekavekarqLlerae....qeltdeekkkellelietilvykfpklsree 195
                 e+k+ e a+ L er      + ++d++k+k+ +e+i+t+++ k ++ + ee
  ACD30434.1  45 ENKKDEIATILDERISiyrlTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEE 95 
                 455566677777777777778899*******************99998887 PP

>> PF06249  Ethanolamine utilisation protein EutQ
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.3     0.012        32       8      65 ..      78     135 ..      73     157 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.012
     PF06249   8 qlvrkvikeklglekaeqsesfkkkvdksGilsvklidvkvkkedrldtgnPkdvvlt 65 
                 ++++ v+ ek+ ++k e++ + +++  +  +  ++ ++ k +k+++  ++n  d+++ 
  ACD30434.1  78 EFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADKKNQKAAANDVDIIYK 135
                 5799***************99999999999****999******999999999888775 PP

>> PF03739  Predicted permease YjgP/YjgQ family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.2     0.013        35      87     151 ..      10      74 ..       8     100 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.013
     PF03739  87 sGislgrllrpilvlalllsvltlllseyvvPrankklesllqeilnkkpsllirpgvfindgdg 151
                 +G+++   ++  l+l ++ls + lll+ ++v  + ++ +  ++ il+++ s    +gvf   +++
  ACD30434.1  10 AGFGIVESMLAALILLFVLSSGFLLLNSVLVNITLENKKDEIATILDERISIYRLTGVFDDTKTK 74 
                 78889999999*****************************9999999999998888888776665 PP

>> PF07470  Glycosyl Hydrolase Family 88
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.1     0.013        35      37      99 ..      67     133 ..      59     140 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.013
                 HHHH---HHHHHHHHHHHHHHCHHHHTTTSGCCTT---TC....CCHHHHH--HHHHHHHHHHHC.C CS
     PF07470  37 ayeytgdeayleyakatvdsfldevgkrlelDhhdigfly....lllyeltkdeearklaleaadyv 99 
                 +++ t+ ++ +e++k+ v + ++e +++++l +++ ++ +    +++  ++ d++ +k+a + +d++
  ACD30434.1  67 VFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNRFKPLsvadIRKMAEKADKKNQKAAANDVDII 133
                 6788999999******************************655555888888999999999888844 PP

>> PF04252  Predicted SAM-dependent RNA methyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.1     0.018        50      12      80 ..      29      95 ..      21     103 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.018
     PF04252 12 sseWllLeykqiaeevGakllvtsakpelryaakklkgvneefkdleslkrskvilLDlraekeLkPed 80
                ss +llL++ ++   + +k   +++  ++r  + +l+gv  ++k++  ++  k ++L+ + e   kPe+
  ACD30434.1 29 SSGFLLLNSVLVNITLENKKDEIATILDERISIYRLTGVFDDTKTKDGIEFIKTVVLEKQNE--AKPEE 95
                56778888888888888888777888889****************************98865..56776 PP

>> PF08766  DEK C terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.047   1.3e+02      35      54 .]      41      60 ..      34      60 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.047
     PF08766 35 gvdLserKafIkelIeefLa 54
                ++ L ++K++I ++ +e+++
  ACD30434.1 41 NITLENKKDEIATILDERIS 60
                999***********999985 PP

>> PF04226  Transglycosylase associated protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.1     0.029        81      27      44 ..      12      29 ..       2      30 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.029
     PF04226 27 aglivaiiGAviLLfivr 44
                 g++ + + A iLLf+++
  ACD30434.1 12 FGIVESMLAALILLFVLS 29
                467999*********986 PP

>> PF07891  Protein of unknown function (DUF1666)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   1.3     0.028        78     108     204 ..      48     142 ..      43     161 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.028
     PF07891 108 seklleiieesirvfweFlraDkeksslalkalkktqvedsadlellaevkkdlqkkekklkelrrsgkcilkkflkneeeeeevellfslidlklv 204
                  +++ +i++e i+++      D +k++  ++ +k    e +++++   ++++ ++ k   + ++r+  +   kk +k+    ++v ++   +++  +
  ACD30434.1  48 KDEIATILDERISIYRLTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADKKNQKAAA--NDVDIIYKVVNIAAI 142
                 57788899999999888888888888888888888888888899999999999999999999999999999999999886..556666666666555 PP

>> PF02474  Nodulation protein A (NodA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.044   1.2e+02     112     169 ..       2      58 ..       1      68 [. 0.84

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.044
     PF02474 112 vlqelgvpfafGtvrealrkhverllreglatilsgvrvrstladvyldlpptrvedv 169
                 +lq+++   +fG v + l   +  ++ ++   +l++v v+ tl++ + ++ +t +++ 
  ACD30434.1   2 LLQQIKSQAGFGIVESMLAALILLFVLSSGFLLLNSVLVNITLENKKDEI-ATILDER 58 
                 5899999*******************99999999*****99998866554.4555555 PP

>> PF00377  Prion/Doppel alpha-helical domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.062   1.7e+02      27      60 ..     131     164 ..     112     167 .] 0.82

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.062
                 B--B--GCSTSS-HHHHHHHHHHHHHHHCCHHCT CS
     PF00377  27 qvyYrevseanvtkekfvtdCvnitvkeykiets 60 
                  + Y+ v+ a + ++  v+dCv i   e k++ +
  ACD30434.1 131 DIIYKVVNIAAIDNQLGVADCVKIIEREVKQDDN 164
                 47899999999999999*****998888776654 PP

>> PF08285  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.047   1.3e+02      31      77 ..      13      59 ..       1      63 [. 0.76

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.047
     PF08285 31 kvveeilpllPlyllvlfGsYslltvgygvltfndcpeaakeLlkeI 77
                 +ve++l +l l+++++ G  +l +v++++   n ++e a+ L + I
  ACD30434.1 13 GIVESMLAALILLFVLSSGFLLLNSVLVNITLENKKDEIATILDERI 59
                47889999999999***************977777777676666665 PP

>> PF03197  Bacteriophage FRD2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   1.2     0.037     1e+02      15      97 ..      68     156 ..      59     161 .. 0.66

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.037
     PF03197  15 vkevesadgakavvkiecanGkifsadgelee...yfeiyedefkcfreytsekde...vkdeviksGvtkihCivdennvdeiiellr 97 
                  ++++++dg ++++++ +++ ++ + + +le+   + +++  + + + e  ++k++   ++d  i + v +i  i ++  v + ++++ 
  ACD30434.1  68 FDDTKTKDGIEFIKTVVLEKQNEAKPEENLETvnrFKPLSVADIRKMAEKADKKNQkaaANDVDIIYKVVNIAAIDNQLGVADCVKIIE 156
                 579999************99999888877665111556777777777777444443111334446666777766666666666666655 PP

>> PF01890  Cobalamin synthesis G C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.2     0.065   1.8e+02      28      71 ..     101     144 ..      78     160 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.065
                 CT--GGG---EEES.....-CCHHHHHHHCT--EEE--HHHHH. CS
     PF01890  28 aglaleavaaiatidlKadepgllelaeelglplrtfsaeeLae 71 
                 +++++ +va i  ++ Kad++  +++a+++++  ++++ +++++
  ACD30434.1 101 NRFKPLSVADIRKMAEKADKKNQKAAANDVDIIYKVVNIAAIDN 144
                 6789999************************9999999888875 PP

>> PF06042  Bacterial protein of unknown function (DUF925)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1     0.092   2.5e+02      26      43 ..     117     134 ..     111     161 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.092
     PF06042  26 vlhgravetelkDiDviY 43 
                 + ++++++   +D+D+iY
  ACD30434.1 117 KADKKNQKAAANDVDIIY 134
                 5677889999*******9 PP

>> PF11779  Protein of unknown function (DUF3317)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.7     0.079   2.2e+02      30      56 ..      15      42 ..       9      43 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.079
     PF11779 30 fntll.llllslilfaaylylpshivsi 56
                + ++l  l+l+++l +++l+l s +v i
  ACD30434.1 15 VESMLaALILLFVLSSGFLLLNSVLVNI 42
                4555548889999999999999988876 PP

>> PF02366  Dolichyl-phosphate-mannose-protein mannosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   1.1      0.06   1.7e+02     113     142 ..      12      41 ..       1      44 [. 0.81

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.06
     PF02366 113 tallaallvilenslitlsryiLldspLlf 142
                  +++ ++l +l+ +++ +s + Ll+s+L+ 
  ACD30434.1  12 FGIVESMLAALILLFVLSSGFLLLNSVLVN 41 
                 5777889999999***************85 PP

>> PF03189  Protein of unknown function, DUF270
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1     0.099   2.8e+02      85     158 ..      78     147 ..      75     162 .. 0.73

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.099
     PF03189  85 vwlrvlveeakleitkieqkkepeeeesallesssqstlkssktvekleqeklekekntvknlvkassteasae 158
                 ++++++v e++ e+++ e+ +++++ +   + ++++ ++k  k+++k+      ++ +++ ++v++ + +++  
  ACD30434.1  78 EFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADKKNQKAA----ANDVDIIYKVVNIAAIDNQLG 147
                 799999***9999999999999999998888888888777777777666....445566666666555555554 PP

>> PF01820  D-ala D-ala ligase N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.2      0.11   2.9e+02      31      93 ..      75     137 ..      56     138 .. 0.60

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.11
                 TTEEEEEEEE-----EEEEECCHCHTTSCGGCSTTB-SCC-HCHHHHB---.-TC-SEEEE-- CS
     PF01820  31 ekyevvpigitkegkwllaeeaeeeleekkkeekeekeeeeaeaelsekkeakekvdvvfpvl 93 
                 +++e+++  + ++++  + ee+ e ++  k  +  + ++ +++a ++++k+a+++vd+++ v+
  ACD30434.1  75 DGIEFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADKKNQKAAANDVDIIYKVV 137
                 666666666666665555555555555555555555445555555555555599999999875 PP

>> PF02902  Ulp1 protease family, C-terminal catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.2      0.13   3.7e+02      57      92 ..     104     139 ..      70     144 .. 0.76

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.13
                 .....H------TTCCHHCS..-GGG-SEEE--EET CS
     PF02902  57 keskkkdlyngvrrwtrkknkedlfdkdiiyiPine 92 
                 k  +  d+ +  +++++k++k+   d+diiy  +n+
  ACD30434.1 104 KPLSVADIRKMAEKADKKNQKAAANDVDIIYKVVNI 139
                 44444677777788888889999*******988886 PP

>> PF05978  Ion channel regulatory protein UNC-93
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.2      0.15   4.3e+02      69      93 ..      17      41 ..      11      44 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.15
     PF05978 69 alvigallyalfqlgFlflnsyyly 93
                +++ + +l +++  gFl lns+++ 
  ACD30434.1 17 SMLAALILLFVLSSGFLLLNSVLVN 41
                6889999999**********98765 PP

>> PF08590  Domain of unknown function (DUF1771)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.6      0.15   4.2e+02      44      58 ..     113     127 ..     110     131 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.15
                 -------SHHHHHHH CS
     PF08590  44 khgekaeeanreAAe 58 
                 k  eka+++n++AA+
  ACD30434.1 113 KMAEKADKKNQKAAA 127
                 77899*******997 PP

>> PF01889  Membrane protein of unknown function DUF63
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.13   3.6e+02      12      50 ..       4      42 ..       2      80 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.13
     PF01889 12 epiktkegYnlvntltyaliLgvavylvykllkklkiei 50
                + ik + g+ +v+ +  aliL++++   + ll+ + ++i
  ACD30434.1  4 QQIKSQAGFGIVESMLAALILLFVLSSGFLLLNSVLVNI 42
                678999999999999999999999988888887777666 PP

>> PF03208  PRA1 family protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.5      0.15     4e+02     104     128 ..      18      42 ..       5      45 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.15
     PF03208 104 livsvlllfltsavsvllwlllvsl 128
                 ++++++llf++s++++ll ++lv +
  ACD30434.1  18 MLAALILLFVLSSGFLLLNSVLVNI 42 
                 5677889999999999999998865 PP

>> PF00716  Assemblin (Peptidase family S21)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.16   4.4e+02     135     181 ..      99     145 ..      90     158 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.16
                 HHTTSTTS-HHHHHHHHHHHHTH--.---SSCHHHHHHHHHHHHHCC CS
     PF00716 135 vierFsdLseaerealleeakqalgeaaeesfesdskvLLakavdal 181
                  ++rF+ Ls a+  +++e+a+++  +aa+++ ++  kv    a+d+ 
  ACD30434.1  99 TVNRFKPLSVADIRKMAEKADKKNQKAAANDVDIIYKVVNIAAIDNQ 145
                 67999999999999999977777777888888888888877778775 PP

>> PF02129  X-Pro dipeptidyl-peptidase (S15 family)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.27   7.6e+02     137     213 ..      56     132 ..      50     152 .. 0.64

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.27
                 BCHHIHCB----BBHHHHHHHCCHHCHHHCCTCCCGSTTCHHHHHHHHHHCCHHHHHHHSTTTHHHHCCCC--SSSH CS
     PF02129 137 dlydeyyregGlvrapggltwedldllaealesrradegdalkaaaryeaagdellkkqdretkvlselletgdyda 213
                 d    +yr +G++   ++ ++ +   +    ++++a++++ l++++r +  +   ++k++++    ++    +d d 
  ACD30434.1  56 DERISIYRLTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADKKNQKAAANDVDI 132
                 55555889999999999999988878888888888888889999999444444444444444222244444444444 PP

>> PF00473  Corticotropin-releasing factor family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.7      0.69   1.9e+03      18      32 ..     114     128 ..     111     128 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.69
                 HHHHHHHHHHHHHHH CS
     PF00473  18 eleraerrlrqaenN 32 
                 + e+a ++ ++a++N
  ACD30434.1 114 MAEKADKKNQKAAAN 128
                 889**********99 PP

>> PF03929  PepSY-associated TM helix
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   2.3      0.43   1.2e+03      10      26 ..      18      34 ..      14      35 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.43
     PF03929 10 glaallllvlllsGlil 26
                +laal+ll++l sG +l
  ACD30434.1 18 MLAALILLFVLSSGFLL 34
                689***********887 PP

>> PF05620  Protein of unknown function (DUF788)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.3       0.2   5.6e+02       1      27 [.     114     140 ..     114     145 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.2
     PF05620   1 MAnksaKkraaknkkilkqlllillai 27 
                 MA+k+ Kk+ ++ ++  + +++++ ++
  ACD30434.1 114 MAEKADKKNQKAAANDVDIIYKVVNIA 140
                 9********999999888888877665 PP

>> PF00746  Gram positive anchor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   1.8      0.76   2.1e+03      20      35 ..      19      34 ..      13      36 .. 0.72

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.76
     PF00746 20 ltlaGlllaaggglll 35
                l+++ ll+++++g+ll
  ACD30434.1 19 LAALILLFVLSSGFLL 34
                4566777777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (167 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       911  (0.0764775); expected 238.2 (0.02)
Passed bias filter:                      516  (0.0433177); expected 238.2 (0.02)
Passed Vit filter:                        37  (0.00310611); expected 11.9 (0.001)
Passed Fwd filter:                        37  (0.00310611); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              36  [number of targets reported over threshold]
# CPU time: 0.19u 0.06s 00:00:00.25 Elapsed: 00:00:00
# Mc/sec: 1897.56
//